PSIBLAST alignment of GI: 254780755 and protein with PDB id: 1wmw

gi|73535442|pdb|1WMW|A Chain A, Crystal Structure Of Geranulgeranyl Diphosphate Synthase From Thermus Thermophilus Length = 330
>gi|73535443|pdb|1WMW|B Chain B, Crystal Structure Of Geranulgeranyl Diphosphate Synthase From Thermus Thermophilus Length = 330
 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 59/319 (18%), Positives = 114/319 (35%), Gaps = 11/319 (3%)

Query: 13  EKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIE 72
           + +   +L R+     +  D+++     GGK LR +LT+ +AL      +  +  A A+E
Sbjct: 10  QALQERLLARLDHPDPLYRDLLQDYPRRGGKMLRGLLTVYSALAHGAPLEAGLEAATALE 69

Query: 73  FIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAF------CMVIETKS 126
                 L+HDD+ D S  RRG+ A   +     ++  GD + ++ +              
Sbjct: 70  LFQNWVLVHDDIEDGSEERRGRPALHRLHPMPLALNAGDAMHAEMWGLLAEGLARGLFPP 129

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +  LE   +V  T     L  L           +    + +  A  ++A   +       
Sbjct: 130 EVLLEFHEVVRRTAYGQHLDLLWTLGGTFDLRPEDYFRMVAHKAAYYTAVAPLRLGALLA 189

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A +  G+ LG AFQ+VDDVL+  G      +  G+ +   +  + +    +   
Sbjct: 190 GKTPPAAYEEGGLRLGTAFQIVDDVLNLEGGEAYGKERAGDLYEGKRTLILLRFLEEAPP 249

Query: 247 KREKNFWKSTINDGKISVE-NLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR----CL 301
           +             +   E  +      +  +RAL   +  A     +    L      L
Sbjct: 250 EERARALALLALPREAKPEAEVGWLLERLLASRALAWAKAEAKRLQAEGLALLEAAFQDL 309

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P       L  ++   ++R
Sbjct: 310 PGKEALDHLRGLLAALVER 328