PSIBLAST alignment of GI: 254780755 and protein with PDB id: 1wy0

gi|90108478|pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342
 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 94/336 (27%), Positives = 158/336 (47%), Gaps = 17/336 (5%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEM-IPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           + L     +  + ++  I + I       + +  ++   +GGKR+RP + L +   +   
Sbjct: 5   EELFARIKEKAKLIDEKIFELIPEKDPRVLYEAARHYPLAGGKRVRPFVVLTSTEAVGGD 64

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC- 119
               +  A AIE IH  +L+HDD++D    RRGK     +WG   ++L GD L S+AF  
Sbjct: 65  PLRAIYPAVAIELIHNYSLVHDDIMDMDETRRGKPTVHRIWGVNMAILAGDLLFSKAFEA 124

Query: 120 ----MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSA 175
                +   K    LE +   +  L EG+ R L   K   VT E+Y+ +I  KT  LF A
Sbjct: 125 VARAEIPPEKKARVLEVIVKASNELCEGQARDLEFEKKSTVTIEEYMEMISGKTGALFEA 184

Query: 176 ALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPT 235
           + +V  +I        +AL S+G N+GIAFQ+ DDVLD   +  ++GK +G D R GK T
Sbjct: 185 SAKVGGIIGTDNEEYIKALSSWGRNVGIAFQIWDDVLDLIADEKKLGKPVGSDIRKGKKT 244

Query: 236 LPVILAFQRGTKREKNFWKSTIND-----------GKISVENLKKAFIIMRENRALVDTE 284
           L V   F+   +++K  +                  +    ++ +A  ++++  ++    
Sbjct: 245 LIVAHFFENADEKDKQRFLKIFGKYAGDVKGRGIIEEDIKSDVMEAIDLLKKYGSIDYAA 304

Query: 285 YRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320
             A    +KA ++LR LP S  +  L  +  F ++R
Sbjct: 305 EIAKDMIKKANEALRILPKSKARMDLELLAKFIVER 340