PSIBLAST alignment of GI: 254780755 and protein with PDB id: 3ipi

>gi|257472035|pdb|3IPI|A Chain A, Crystal Structure Of A Geranyltranstransferase From The Methanosarcina Mazei Length = 295
 Score = 76.9 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 64/305 (20%), Positives = 120/305 (39%), Gaps = 39/305 (12%)

Query: 15  VNFLILKRIC-SDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEF 73
           V   I + I   +   +   V+++  SGGKR+RP++ L  + +        +  A A+E 
Sbjct: 14  VEAGIKESITLIEDPGLKKXVEHVCHSGGKRIRPIILLLVSEICSGSYSRSLNAALAVEX 73

Query: 74  IHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEAL 133
            H+A+L+HDD++D   +RR   +A   +G   ++L GD+L+  A  +   +   E +   
Sbjct: 74  XHSASLIHDDLLDQGLVRRNLPSAPEKFGPSGALLCGDYLI--AKSIAFISPYGEKVIQD 131

Query: 134 SLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQA 193
              A              ++    E DY   I  KTA LF+ +  + +   G +  + + 
Sbjct: 132 FGKAGXDXAEGEVLDLKLEDESFGENDYFKCIYKKTASLFAISASIGAYTGGAEEELAER 191

Query: 194 LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFW 253
              +G  LG A+Q+VDD+L++           G++ +    TLP I       +      
Sbjct: 192 FSHFGNALGTAYQIVDDILEFLE------VVEGKESKFTSETLPHIYXKSTSKEE----- 240

Query: 254 KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEV 313
                                    AL  +      +   AK++L    +   +  L ++
Sbjct: 241 -------------------------ALKKSIDCVKLHVAAAKETLETFRECPARDKLFQI 275

Query: 314 VDFCL 318
            D+  
Sbjct: 276 TDYIT 280