PSIBLAST alignment of GI: 254780755 and protein with PDB id: 3lvs

>gi|290790316|pdb|3LVS|A Chain A, Crystal Structure Of Farnesyl Diphosphate Synthase From Rhodobacter Capsulatus Sb1003 Length = 298
>gi|290790317|pdb|3LVS|B Chain B, Crystal Structure Of Farnesyl Diphosphate Synthase From Rhodobacter Capsulatus Sb1003 Length = 298
 Score = 54.2 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVE-MIPDVVKYLIFSGGKRLRPMLTLATALMLEY 59
           M +  +   +  + V   +   I       + D + Y    GGKRLR  L + +A +   
Sbjct: 1   MSLFSERLKEIQDAVETAMAAAIGRLPAGDLRDAMAYAAQ-GGKRLRAFLAIESAAIHGI 59

Query: 60  RGDNHVLLACAIEFIHTATLLHDD--VVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQA 117
                +  A A+E +H  +L+HDD   +D+  LRRG       W + T+VL GD L + A
Sbjct: 60  SMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLA 119

Query: 118 FCMV 121
           F + 
Sbjct: 120 FELC 123