PSIBLAST alignment of GI: 254780755 and protein with PDB id: 3oyr

>gi|308388198|pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345
>gi|308388199|pdb|3OYR|B Chain B, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345
 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 150/320 (46%), Positives = 210/320 (65%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  L  L   DM  VN LI  R+ SDV +IP + ++LI +GGKRLRP++T+A A +    
Sbjct: 24  VDRLVRLAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGAD 83

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D+   LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +
Sbjct: 84  NDHFQKLAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFEL 143

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++ET S +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  
Sbjct: 144 MVETNSMKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELFAAASEAG 203

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++ AGV  +  +AL+ YG+NLG+AFQL DD LDY G    +GKN G+DFR GK TLP++L
Sbjct: 204 AVSAGVDVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLL 263

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  R   RE  FW+  I   + +  + ++A  ++  + AL  T   A  Y  KAK +L  
Sbjct: 264 AIARSGPREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAM 323

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            P + W+++L E+ DF + R
Sbjct: 324 FPANDWREALEELADFAVSR 343