RPSBLAST alignment for GI: 254780755 and conserved domain: pfam00348

>gnl|CDD|144078 pfam00348, polyprenyl_synt, Polyprenyl synthetase. Length = 260
 Score =  209 bits (534), Expect = 8e-55
 Identities = 84/221 (38%), Positives = 133/221 (60%), Gaps = 6/221 (2%)

Query: 34  VKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRG 93
           + Y + +GGKR+RP+L +  A  L    +  + LACAIE IHTA+L+HDD++D+S LRRG
Sbjct: 5   MLYYLLAGGKRIRPLLVVLAARALGVEPETLLYLACAIEMIHTASLVHDDLMDNSDLRRG 64

Query: 94  KVAARLVWGNQTSVLVGDFLLSQAFCMVIETK----SQEALEALSLVACTLAEGELRQLS 149
           K      +G   ++L GD LLS+AF ++          + +    L     A+GE+ QL 
Sbjct: 65  KPTCHKKFGEAGAILAGDALLSRAFQLLALLGHVRPEPKYILISELANAVGAQGEVGQLM 124

Query: 150 --LSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQL 207
              ++  D+T E+YL ++  KTA LF A++++ +++AG      + L  +G +LG+AFQ+
Sbjct: 125 DLETEGKDITLEEYLRIVSYKTAALFYASVQLGAIVAGADEEDEKDLYDFGRDLGLAFQI 184

Query: 208 VDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
            DD+LD  G+  E+GK +G D + GK TLPV+LA +   + 
Sbjct: 185 QDDILDLTGDTEELGKPVGTDLQEGKSTLPVLLALEGAREE 225