RPSBLAST alignment for GI: 254780755 and conserved domain: PLN02857

>gnl|CDD|178448 PLN02857, PLN02857, octaprenyl-diphosphate synthase. Length = 416
 Score =  176 bits (447), Expect = 8e-45
 Identities = 103/319 (32%), Positives = 178/319 (55%), Gaps = 15/319 (4%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTL----ATALM--LEYRGDNH 64
           D++++N  +   + ++  ++    + +  +GGKR+RP L      ATA +  L+     H
Sbjct: 104 DLQQLNDNLQSIVGAENPVLMSAAEQIFGAGGKRMRPALVFLVSRATAELAGLKELTTEH 163

Query: 65  VLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIET 124
             LA   E IHTA+L+HDDV+D+S +RRGK     ++G + +VL GDF+ +Q+   +   
Sbjct: 164 RRLAEITEMIHTASLIHDDVLDESDMRRGKETVHQLYGTRVAVLAGDFMFAQSSWYLANL 223

Query: 125 KSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIA 184
            + E ++ +S V    A GE++Q S   + DVT ++YL     KTA L +A+ + +++ +
Sbjct: 224 DNLEVIKLISQVIKDFASGEIKQASSLFDCDVTLDEYLLKSYYKTASLIAASTKSAAIFS 283

Query: 185 GVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQR 244
           GV +SV++ +  YG NLG+AFQ+VDD+LD+     ++GK  G D   G  T PVI A ++
Sbjct: 284 GVDSSVKEQMYEYGKNLGLAFQVVDDILDFTQSTEQLGKPAGSDLAKGNLTAPVIFALEK 343

Query: 245 GTK-REKNFWKSTINDGKISVEN-LKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
             + RE       I + +   E  L++A  ++ E   +   +  A      A  +L CLP
Sbjct: 344 EPELRE-------IIESEFCEEGSLEEAIELVNEGGGIERAQELAKEKADLAIQNLECLP 396

Query: 303 DSSWKKSLMEVVDFCLQRL 321
             +++ SL ++VD+ L+R+
Sbjct: 397 RGAFRSSLEDMVDYNLERI 415