RPSBLAST alignment for GI: 254780755 and conserved domain: PRK10888

>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional. Length = 323
 Score =  267 bits (685), Expect = 2e-72
 Identities = 135/316 (42%), Positives = 193/316 (61%), Gaps = 1/316 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+G+ HV
Sbjct: 8   ELTAQDMAGVNAAILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQGNAHV 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+    
Sbjct: 68  TIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLG 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S ++AG
Sbjct: 128 SLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGILAG 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                 + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ A   G
Sbjct: 188 CTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGETLGKNVGDDLNEGKPTLPLLHAMHHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ LPD+ 
Sbjct: 248 TPEQAAMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTP 306

Query: 306 WKKSLMEVVDFCLQRL 321
           W+++L+ +    +QR 
Sbjct: 307 WREALIGLAHIAVQRD 322