RPSBLAST alignment of GI: 254780755 and protein with PDBid: 1wmw

>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genomics; 1.55A {Thermus thermophilus HB8} Length = 330
 Score =  128 bits (321), Expect = 2e-30
 Identities = 67/321 (20%), Positives = 125/321 (38%), Gaps = 15/321 (4%)

Query: 13  EKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIE 72
           + +   +L R+     +  D+++     GGK LR +LT+ +AL      +  +  A A+E
Sbjct: 10  QALQERLLARLDHPDPLYRDLLQDYPRRGGKMLRGLLTVYSALAHGAPLEAGLEAATALE 69

Query: 73  FIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEA 132
                 L+HDD+ D S  RRG+ A   +     ++  GD + ++ + ++ E  ++     
Sbjct: 70  LFQNWVLVHDDIEDGSEERRGRPALHRLHPMPLALNAGDAMHAEMWGLLAEGLARGLFPP 129

Query: 133 LSLVA-------CTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
             L+            +      +L    D+  EDY  ++  K A  ++A   +      
Sbjct: 130 EVLLEFHEVVRRTAYGQHLDLLWTLGGTFDLRPEDYFRMVAHKAA-YYTAVAPLRLGALL 188

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +   A +  G+ LG AFQ+VDDVL+  G     GK    D   GK TL ++   +  
Sbjct: 189 AGKTPPAAYEEGGLRLGTAFQIVDDVLNLEGG-EAYGKERAGDLYEGKRTLILLRFLEEA 247

Query: 246 TKREKNFWKSTINDGK--ISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR---- 299
              E+    + +   +       +      +  +RAL   +  A     +    L     
Sbjct: 248 PPEERARALALLALPREAKPEAEVGWLLERLLASRALAWAKAEAKRLQAEGLALLEAAFQ 307

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LP       L  ++   ++R
Sbjct: 308 DLPGKEALDHLRGLLAALVER 328