RPSBLAST alignment of GI: 254780755 and protein with PDBid: 2ftz

>2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} Length = 284
 Score =  101 bits (251), Expect = 3e-22
 Identities = 47/267 (17%), Positives = 90/267 (33%), Gaps = 9/267 (3%)

Query: 13  EKVNFLILKRICSDVEMI-PDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           E V   I + +    +++  + + Y    GG R+RP+L L     L    +  + +A A+
Sbjct: 16  EXVEERIREILRPGWDLLTEEAMLYSATVGGXRIRPLLVLTLGEDLGVEEEXLLDVAVAV 75

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E  HTA+L+HDD+         +            + +              +    +  
Sbjct: 76  ELFHTASLIHDDLPPIDNADFRRGXPSCHRTYGEDIALLAGDGLFFLAFSQISXIGNSXI 135

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQ--NS 189
                           + +       E     V +       + AL      A       
Sbjct: 136 FEEFSETAYXLLLGEAMDVEFERRXMEVSQEMVERMYA--FXTGALFAFCFSAPFILXGX 193

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
               +   G   G+AFQ+ DD+ D  G   ++GK++G+D      TL   +  Q   +  
Sbjct: 194 DHTXMXLLGEXFGVAFQIYDDLXDILGSFEKVGKDLGKD--TEXVTLVXXVGIQXAREMA 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRE 276
             +++  +    I  E L +   ++ E
Sbjct: 252 DXYYEEVL--XGIESEGLFRTLFLLXE 276