RPSBLAST alignment of GI: 254780755 and protein with PDBid: 2h8o

>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} Length = 335
 Score =  147 bits (372), Expect = 2e-36
 Identities = 69/261 (26%), Positives = 118/261 (45%), Gaps = 15/261 (5%)

Query: 32  DVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDV--VDDSA 89
           + +++ + +GGKRLRP L + +  +L    +  + +  A+E +H  +L+HDD+  +DD  
Sbjct: 75  EAMRHGVLNGGKRLRPFLVIESVALLGGDAEAGLHVGAALECLHCYSLVHDDLPAMDDDD 134

Query: 90  LRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLS 149
           LRRG+      +   T++L GD LL+ AF ++    +  A E  + +  +LA        
Sbjct: 135 LRRGQPTVHRKFDEATAILAGDSLLTLAFDIIASDDNPLAAERKAALVISLARAAGIGGM 194

Query: 150 LSKNL--------DVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNL 201
                           E+  + +   KT  L   A E  ++IAG   + RQ L+ +G  +
Sbjct: 195 AGGQALDLAAEKKAPDEDGIITLQAMKTGALLRFACEAGAIIAGSNQAERQRLRLFGEKI 254

Query: 202 GIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGK 261
           G++FQL DD+LD   +   MGK  G+D   GK TL  +       ++ +           
Sbjct: 255 GLSFQLADDLLDLTADAATMGKATGKDAARGKGTLVALRGEAWAREKLQEQVAEASELLA 314

Query: 262 I---SVENLKKA--FIIMREN 277
                   L  A  FI  R++
Sbjct: 315 PYGEKAAILIAAARFIAERKS 335