RPSBLAST alignment of GI: 254780755 and protein with PDBid: 2her

>2her_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structural genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* 2q58_A* Length = 368
 Score =  144 bits (364), Expect = 3e-35
 Identities = 56/326 (17%), Positives = 119/326 (36%), Gaps = 33/326 (10%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYL------IFSGGKRLRPMLTLATALML----EYRG 61
            + + + +LK++  + E+   V++Y           GK +R  + +  + +       + 
Sbjct: 35  FKVIVYNVLKKLPLNDEIRKPVIEYYLNCIDYNVKKGKHIRGKILVLISSLSSAYSNIKR 94

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D+  LL   +E I    L+ DD++D    RRG     +V G   ++    FL   +  ++
Sbjct: 95  DSIYLLGWVVEAIQALILIADDIMDSGKFRRGAPCWYIVHGQSNAINDIFFLKMLSLSLI 154

Query: 122 IETKSQEALEALSLVACTLAE----GELRQL-----SLSKNLDVTEEDY-LHVIKSKTAV 171
            E  S    + +  +     E      L Q            D   E Y   V    +  
Sbjct: 155 FELSSVFGNDIVMKIQKIYNESIFFTVLGQHLDLSYFDLSKADKISERYFSMVEMKTSRY 214

Query: 172 LFSAALEVSSLIAGVQNSV--RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDF 229
            F   +     ++ +Q S      +++    LG  +Q+ +DV DY         +  +D 
Sbjct: 215 TFYMPVFFGLTLSEIQVSSAQLNLIEAILYKLGEFYQVHNDVSDYL-----FNDSNADDI 269

Query: 230 RNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYS 289
              K T P+  +F+   +  K            +   +K  + +++ N   ++ +  A  
Sbjct: 270 CRFKLTWPLQKSFEIADEEMKLKISENYGK---NSSLVKDCYNLLKINEHYLEYQRNALD 326

Query: 290 YGQKAKDSLRCLPDSSWKKSLMEVVD 315
           Y       ++ + D S +K  + ++ 
Sbjct: 327 Y---LIKLVKDITDDSLQKVFIHLIH 349