RPSBLAST alignment of GI: 254780755 and protein with PDBid: 3m0g

>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, isoprene biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297
 Score =  174 bits (441), Expect = 3e-44
 Identities = 77/293 (26%), Positives = 127/293 (43%), Gaps = 22/293 (7%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY 59
           M + E L  +  + V   +   I       + D + Y    GGKRLR  L + +A +   
Sbjct: 1   MSLSERLK-EVQDAVETAMAAAIGRLPAGDLRDAMAY-AAQGGKRLRAFLAIESAAIHGI 58

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVV--DDSALRRGKVAARLVWGNQTSVLVGDFLLSQA 117
                +  A A+E +H  +L+HDD+   D+  LRRG       W + T+VL GD L + A
Sbjct: 59  SMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLA 118

Query: 118 FCMVIETKSQEALEALSLVA----CTLAEGELRQLSL-----SKNLDVTEEDYLHVIKSK 168
           F +  +     A   ++LVA     + AEG +   +L     +  + +T ++ + +   K
Sbjct: 119 FELCTDPVLGSAENRVALVAALAQASGAEGMVYGQALDIAAETAAVPLTLDEIIRLQAGK 178

Query: 169 TAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGED 228
           T  L S A +  +++AG     R  L +Y   LG+AFQ+ DD+LD  G     GK +G+D
Sbjct: 179 TGALISFAAQAGAILAGAD---RGPLTAYATALGLAFQIADDILDVEGNEEAAGKRLGKD 235

Query: 229 FRNGKPTLPVILAFQRGTKREKNFWKSTINDGKI---SVENLKKA--FIIMRE 276
               K T   +L       R  +              +   L+    ++I R+
Sbjct: 236 AEAHKATFVSLLGLAGAKSRAADLVAEAEAALAPYGEAASTLRACARYVIERD 288