>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. Note that this gene appears to be required for PQQ in biosynthesis in Methylobacterium extorquens (under the name pqqG) and in Klebsiella pneumoniae but that the equivalent pqqV in Acinetobacter calcoaceticus is not necessary for heterologous expression of PQQ biosynthesis in Escherichia coli. Based on this latter finding, it is suggested that PqqB might be a transporter or a PQQ-dependent enzyme rather than a PQQ biosynthesis enzyme .; GO: 0006810 transport, 0018189 pyrroloquinoline quinone biosynthetic process.

Probab=94.27 E-value=0.19 Score=28.20 Aligned_cols=74 Identities=20% Similarity=0.370 Sum_probs=55.5 Q ss_pred CCCEEEEEECCCCEEEEECCCCCHHHHHHHHHH-------CC-C---CEEEEEECCCCCCCCCCCHHHHHH-HCCCEEEC Q ss_conf 571699998899849998389999999999997-------49-9---752999869885210110567886-07955405 Q gi|254780758|r 15 KQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQS-------RN-F---HVKQIWITHGHVDHVGGAAQLKED-LSLTIIGP 82 (216) Q Consensus 15 ~~N~~li~~~~~~~~ilID~G~~~~~i~~~l~~-------~~-~---~i~~Ii~TH~H~DH~gg~~~l~~~-~~~~i~~~ 82 (216) T Consensus 36 RTQsSiAvS~DG~rW~L~NASPD---iRQQi~a~paL~P~~~aLR~TpI~~V~Lt~g~iDH~tGLL~LREgq~pf~~yat 112 (314) T TIGR02108 36 RTQSSIAVSADGERWVLLNASPD---IRQQIQAFPALHPQRGALRDTPIEGVVLTDGEIDHVTGLLSLREGQQPFTLYAT 112 (314) T ss_pred CCCEEEEECCCCCCEEEECCCHH---HHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEEC T ss_conf 54116888678873586707964---888886203215777888657604788206622456412333037885148627 Q ss_pred CHHHHHHHC Q ss_conf 843898840 Q gi|254780758|r 83 HKDDAAMMG 91 (216) Q Consensus 83 ~~~~~~~~~ 91 (216) T Consensus 113 ~~Vlq~L~~ 121 (314) T TIGR02108 113 EMVLQDLSD 121 (314) T ss_pred CHHHHHHHC T ss_conf 157888754

HHsearch alignment for GI: 254780758 and conserved domain: TIGR02108