RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780759|ref|YP_003065172.1| hypothetical protein CLIBASIA_03230 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >gnl|CDD|35467 KOG0246, KOG0246, KOG0246, Kinesin-like protein [Cytoskeleton]. Length = 676 Score = 29.3 bits (65), Expect = 0.51 Identities = 18/66 (27%), Positives = 24/66 (36%), Gaps = 7/66 (10%) Query: 61 KNDE--KYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTIS 118 N+ ++T L K I F AT G +TM +FS D I Sbjct: 271 SNELVYRFTAKPLVKTI-----FEGGMATCFAYGQTGSGKTYTMGGDFSGKAQDCSKGIY 325 Query: 119 ACASDD 124 A A+ D Sbjct: 326 ALAARD 331 >gnl|CDD|32239 COG2056, COG2056, Predicted permease [General function prediction only]. Length = 444 Score = 28.3 bits (63), Expect = 0.99 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 1 MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLS 42 +N +A++IS L +G V LT+ I + A ++LS Sbjct: 19 VNVVLALIISALVAGLVGGLGLTETINAFISGLGGNANVALS 60 >gnl|CDD|38719 KOG3509, KOG3509, KOG3509, Basement membrane-specific heparan sulfate proteoglycan (HSPG) core protein [Posttranslational modification, protein turnover, chaperones]. Length = 964 Score = 25.4 bits (55), Expect = 6.8 Identities = 18/90 (20%), Positives = 26/90 (28%), Gaps = 5/90 (5%) Query: 77 SDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKN-----DEKYTISACASDDKGNKSTL 131 +DT K+T+S E S + + C G Sbjct: 674 ADTTTVLIKSTVSTDCTPSECSSANLEGALCYGGGKTDIIAAEVEQCQCPKGLVGTSCED 733 Query: 132 CVECPSPSTPGQYDLNHCAECENTTSKGLC 161 C E + ST G C +CE + C Sbjct: 734 CAEGYTLSTTGGLYPGLCEDCECNSHISQC 763 >gnl|CDD|37682 KOG2471, KOG2471, KOG2471, TPR repeat-containing protein [General function prediction only]. Length = 696 Score = 25.1 bits (54), Expect = 9.1 Identities = 11/42 (26%), Positives = 23/42 (54%) Query: 8 LISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGS 49 ++S+ +GC H++L K++E+ T +S K+G+ Sbjct: 59 VVSYYKTGCTQHSVLLKELEALTADADAPGDVSSGLSLKQGT 100 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.310 0.124 0.354 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,655,889 Number of extensions: 69782 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 10 Length of query: 162 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,405,363 Effective search space: 334807588 Effective search space used: 334807588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 53 (24.2 bits)