RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780759|ref|YP_003065172.1| hypothetical protein CLIBASIA_03230 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >d1t2sa_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 123 Score = 25.9 bits (57), Expect = 1.6 Identities = 4/32 (12%), Positives = 15/32 (46%) Query: 65 KYTISSLTKKIESDTDFRREKATISLSAHDKE 96 Y ++ L++ S F + ++++++ Sbjct: 56 VYRVNGLSRAPASSETFEHDGKKVTIASYFHS 87 >d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]} Length = 387 Score = 23.7 bits (51), Expect = 8.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 57 FSVPKNDEKYTISSLTKKIESDTD 80 FS+PK + I + K+++S D Sbjct: 334 FSLPKEKISHIIFTSNKQVKSKED 357 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.310 0.124 0.354 Gapped Lambda K H 0.267 0.0609 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 507,163 Number of extensions: 20487 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 8 Length of query: 162 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 83 Effective length of database: 1,322,926 Effective search space: 109802858 Effective search space used: 109802858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 49 (22.9 bits)