BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780762|ref|YP_003065175.1| recombination protein RecR [Candidatus Liberibacter asiaticus str. psy62] (201 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780762|ref|YP_003065175.1| recombination protein RecR [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 407 bits (1047), Expect = e-116, Method: Compositional matrix adjust. Identities = 201/201 (100%), Positives = 201/201 (100%) Query: 1 MQKKITGKEIENLIKILARIPGFGPRSARRATLHLVKKKEQLLGPLAEAMANIYNKVCLC 60 MQKKITGKEIENLIKILARIPGFGPRSARRATLHLVKKKEQLLGPLAEAMANIYNKVCLC Sbjct: 1 MQKKITGKEIENLIKILARIPGFGPRSARRATLHLVKKKEQLLGPLAEAMANIYNKVCLC 60 Query: 61 SICGNVDTTDPCAICIDQQRDASVIIVVEDVADLWALERSKAVNALYHVLGGSLSPLDRI 120 SICGNVDTTDPCAICIDQQRDASVIIVVEDVADLWALERSKAVNALYHVLGGSLSPLDRI Sbjct: 61 SICGNVDTTDPCAICIDQQRDASVIIVVEDVADLWALERSKAVNALYHVLGGSLSPLDRI 120 Query: 121 GPEDIGIQSLIERIEVKKIRELIFAISATIEGQTTAHYIMDKLKGIDVKITRLAYGIPMG 180 GPEDIGIQSLIERIEVKKIRELIFAISATIEGQTTAHYIMDKLKGIDVKITRLAYGIPMG Sbjct: 121 GPEDIGIQSLIERIEVKKIRELIFAISATIEGQTTAHYIMDKLKGIDVKITRLAYGIPMG 180 Query: 181 SELDYLDDGTIFEAIRSRTVL 201 SELDYLDDGTIFEAIRSRTVL Sbjct: 181 SELDYLDDGTIFEAIRSRTVL 201 >gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 430 Score = 25.0 bits (53), Expect = 1.0, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 49 AMANIYNKVCLCSICGNVDT 68 A N+Y ++ CS CGN + Sbjct: 342 AGQNLYREISSCSTCGNFQS 361 >gi|254780696|ref|YP_003065109.1| glutathione synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 124 DIGIQ-SLIERIEVKKIRELIFAISATIEGQTTAHYIMDKLKGIDVKI 170 +I IQ + I ++VK+ A+ A + G HY D+L D KI Sbjct: 6 NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKI 53 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 22.7 bits (47), Expect = 4.4, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 157 HYIMDKLKGIDVKITRLAYGIPMGSELDYLDDGTIFEAIRSRTVL 201 HYI + ++ + Y +P G +D L I EA+ VL Sbjct: 142 HYIFHNSQDVNFPLIEAVYSLPTGLSVD-LFKKIIVEALSRLPVL 185 >gi|254780975|ref|YP_003065388.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 21.9 bits (45), Expect = 8.1, Method: Compositional matrix adjust. Identities = 9/33 (27%), Positives = 20/33 (60%) Query: 12 NLIKILARIPGFGPRSARRATLHLVKKKEQLLG 44 ++I I+ PGFG + +T+ +++ + L+G Sbjct: 134 DMILIMTVNPGFGGQQLIESTIPKIRQAKALIG 166 >gi|254780978|ref|YP_003065391.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 21.9 bits (45), Expect = 8.3, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 159 IMDKLKGIDVKITRLAYGIPMGSELDYL 186 + D + +D I + GIP LDYL Sbjct: 250 VPDYERALDQSIQGMTVGIPKEYRLDYL 277 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.139 0.398 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 120,796 Number of Sequences: 1233 Number of extensions: 4637 Number of successful extensions: 14 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 8 length of query: 201 length of database: 328,796 effective HSP length: 70 effective length of query: 131 effective length of database: 242,486 effective search space: 31765666 effective search space used: 31765666 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)