RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780764|ref|YP_003065177.1| hypothetical protein CLIBASIA_03275 [Candidatus Liberibacter asiaticus str. psy62] (194 letters) >gnl|CDD|115031 pfam06347, SH3_4, Bacterial SH3 domain. This family consists of several hypothetical bacterial proteins of unknown function. These are composed of SH3-like domains. Length = 55 Score = 60.0 bits (146), Expect = 4e-10 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Query: 61 KASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSG 117 K R N R GP V+ YL G+PV VVK NW ++R DG GWI +SLL G Sbjct: 1 KKKRVNLRKGPSPDAKVI-AYLEPGVPVRVVKCNGNWCRVR-ADGATGWIYQSLLWG 55 Score = 53.5 bits (129), Expect = 3e-08 Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 136 INLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWG 186 +NL K P + ++A +EPGV + + +C+G WC GWI + +WG Sbjct: 5 VNLRKGPSPDAKVIAYLEPGVPVRVVKCNGNWCRVRADGATGWIYQSLLWG 55 >gnl|CDD|182809 PRK10884, PRK10884, SH3 domain-containing protein; Provisional. Length = 206 Score = 30.8 bits (70), Expect = 0.22 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 68 RIGPGIMYTVVCTYLTKGLPVEV--VKEYENWRQIRDFDGTIGWINKSLLSGKRS 120 R GPG Y +V T L G V + V N+ QIRD G WI LS S Sbjct: 37 RSGPGDQYRIVGT-LNAGEEVTLLQVNANTNYAQIRDSKGRTAWIPLKQLSTTPS 90 >gnl|CDD|128583 smart00287, SH3b, Bacterial SH3 domain homologues. Length = 63 Score = 30.0 bits (68), Expect = 0.46 Identities = 14/64 (21%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Query: 55 PRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVV-KEYENWRQIRDFDGTIGWINKS 113 + N R GPG ++ L KG V+V+ + ++W +I G G++ Sbjct: 1 SETAVVTGDGLNVRSGPGTSSPII-GTLKKGDKVKVLGVDGQDWAKITYGSGQRGYVPGY 59 Query: 114 LLSG 117 +++ Sbjct: 60 VVNT 63 >gnl|CDD|116824 pfam08239, SH3_3, Bacterial SH3 domain. Length = 52 Score = 28.7 bits (65), Expect = 1.0 Identities = 10/45 (22%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Query: 136 INLYKKPDIQSIIVAKVEPGVLLTIRECSGEWC-FGYNLDTEGWI 179 +N+ P S I+ ++ G +T+ + W YN G++ Sbjct: 3 LNVRSGPGTSSKIIGQLPKGTKVTVLGETNGWYKIEYN-GKTGYV 46 >gnl|CDD|183487 PRK12382, PRK12382, putative transporter; Provisional. Length = 392 Score = 28.5 bits (64), Expect = 1.3 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 59 TIKASRANSRIGPGIMYTVVCTYLTKGLPVEVV 91 T S AN + I + V TY+T GLP+ V+ Sbjct: 7 TETRSSANFSLFR-IAFAVFLTYMTVGLPLPVI 38 >gnl|CDD|162179 TIGR01057, topA_arch, DNA topoisomerase I, archaeal. This model describes topoisomerase I from archaea. These enzymes are involved in the control of DNA topology. DNA topoisomerase I belongs to the type I topoisomerases, which are ATP-independent. Length = 618 Score = 28.3 bits (63), Expect = 1.5 Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 6/56 (10%) Query: 94 YENWRQIRDFDGTIGWINKSLLSGKRSAIVS------PWNRKTNNPIYINLYKKPD 143 E R+I F W+ K+ L + W+ + I L K P Sbjct: 201 VEREREINLFVPKPYWVIKATLEKGGGVFDARPEKWKIWSEEEAKSIKEELKKSPW 256 >gnl|CDD|129107 smart00874, B5, tRNA synthetase B5 domain. This domain is found in phenylalanine-tRNA synthetase beta subunits. Length = 71 Score = 27.5 bits (62), Expect = 2.6 Identities = 11/45 (24%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 55 PRFVTIKASRANSRIGPGIMYTVVCTYLTK-GLPVEVVKEYENWR 98 PR +T++ R N +G + + L + G VEV + + Sbjct: 1 PRTITLRRERINRLLGLDLSAEEIEEILKRLGFEVEVSGDDDTLE 45 >gnl|CDD|169983 PRK09579, PRK09579, multidrug efflux protein; Reviewed. Length = 1017 Score = 25.6 bits (56), Expect = 9.4 Identities = 28/99 (28%), Positives = 37/99 (37%), Gaps = 29/99 (29%) Query: 75 YTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPI 134 YT T + K P EY + QI F+G I LL PWN + + Sbjct: 576 YTDEFTPIFKSFP-----EYYSSFQINGFNGVQSGIGGFLL--------KPWNERERTQM 622 Query: 135 YINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNL 173 + P +Q AK+E E G FG+NL Sbjct: 623 EL----LPLVQ----AKLE--------EIPGLQIFGFNL 645 >gnl|CDD|182846 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional. Length = 1109 Score = 25.4 bits (56), Expect = 9.4 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Query: 100 IRDFDGTIGWINKSLLSGKRSAIVSPWNRK 129 IRD G++ IN R+ +S W+RK Sbjct: 944 IRDLTGSVTKIN------TRATTISDWDRK 967 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.441 Gapped Lambda K H 0.267 0.0738 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,198,080 Number of extensions: 193252 Number of successful extensions: 349 Number of sequences better than 10.0: 1 Number of HSP's gapped: 347 Number of HSP's successfully gapped: 22 Length of query: 194 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 106 Effective length of database: 4,092,969 Effective search space: 433854714 Effective search space used: 433854714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.6 bits)