RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780764|ref|YP_003065177.1| hypothetical protein CLIBASIA_03275 [Candidatus Liberibacter asiaticus str. psy62] (194 letters) >d1m9sa3 b.34.11.1 (A:466-551) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]} Length = 86 Score = 29.4 bits (66), Expect = 0.20 Identities = 12/79 (15%), Positives = 31/79 (39%), Gaps = 10/79 (12%) Query: 47 EIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLT-----KGLPVEVVKEYEN----W 97 ++ K + + ++ + NS + T ++ +G + +++E + W Sbjct: 4 KMEYDKGVTAYARVRNASGNS-VWTKPYNTAGAKHVNKLSVYQGKNMRILREAKTPITTW 62 Query: 98 RQIRDFDGTIGWINKSLLS 116 Q IGW++ L+ Sbjct: 63 YQFSIGGKVIGWVDTRALN 81 >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Score = 26.3 bits (58), Expect = 1.9 Identities = 7/28 (25%), Positives = 10/28 (35%) Query: 152 VEPGVLLTIRECSGEWCFGYNLDTEGWI 179 ++T+ E W FG GW Sbjct: 29 FSKHDIITVLEQQENWWFGEVHGGRGWF 56 >d1m9sa4 b.34.11.1 (A:552-629) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]} Length = 78 Score = 25.9 bits (57), Expect = 2.3 Identities = 8/30 (26%), Positives = 13/30 (43%) Query: 89 EVVKEYENWRQIRDFDGTIGWINKSLLSGK 118 + E + W +IR IGW + L + Sbjct: 49 QATIEGQLWYRIRTSSTFIGWTKAANLRAQ 78 >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Score = 25.5 bits (56), Expect = 3.2 Identities = 7/28 (25%), Positives = 10/28 (35%) Query: 152 VEPGVLLTIRECSGEWCFGYNLDTEGWI 179 G + + + GEW G D G Sbjct: 27 FTEGEEILVTQKDGEWWTGSIGDRSGIF 54 >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Score = 24.1 bits (52), Expect = 7.2 Identities = 6/29 (20%), Positives = 16/29 (55%) Query: 82 LTKGLPVEVVKEYENWRQIRDFDGTIGWI 110 + K +E++ + W ++R+ G G++ Sbjct: 20 VMKDDVLEILDDRRQWWKVRNASGDSGFV 48 >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Length = 99 Score = 23.9 bits (51), Expect = 9.0 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 138 LYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFG-YNLDTEG 177 LY+KP + + V G +T+ CS + Y+L EG Sbjct: 3 LYEKPSLSAQPGPTVLAGENVTLS-CSSRSSYDMYHLSREG 42 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.140 0.441 Gapped Lambda K H 0.267 0.0702 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 780,600 Number of extensions: 35968 Number of successful extensions: 75 Number of sequences better than 10.0: 1 Number of HSP's gapped: 75 Number of HSP's successfully gapped: 8 Length of query: 194 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 113 Effective length of database: 1,295,466 Effective search space: 146387658 Effective search space used: 146387658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.1 bits)