>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.80 E-value=5.7e-08 Score=71.22 Aligned_cols=80 Identities=18% Similarity=0.266 Sum_probs=67.7 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) T Consensus 126 ~~~LSgG~kqrv~la~al~---------~~p~lllLDEPt~gLDp~~~~~i~~~i~~~~~~g~til~ssH~l~e~~~~~d 196 (210) T cd03269 126 VEELSKGNQQKVQFIAAVI---------HDPELLILDEPFSGLDPVNVELLKDVIRELARAGKTVILSTHQMELVEELCD 196 (210) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 5778998999999999995---------7998999928866799999999999999999689899998884899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) T Consensus 197 ~--i~vl~~G~iv~ 208 (210) T cd03269 197 R--VLLLNKGRAVL 208 (210) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988998

HHsearch alignment for GI: 254780766 and conserved domain: cd03269