HHsearch alignment for GI: 254780767 and conserved domain: PRK00025

>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed.
Probab=100.00  E-value=0  Score=878.30  Aligned_cols=376  Identities=36%  Similarity=0.639  Sum_probs=361.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
T Consensus         1 ~mkifi~aGE~SGD~~ga~li~~Lk~~-~~~~~~~GiGG~~M~~~G~~~l~d~~~l~vmG~~evl~~~~~~~~~~~~~~~   79 (382)
T PRK00025          1 PLRIAIVAGEVSGDLLGAGLIRALKAQ-APNLEFVGIGGPRMEAAGFESLFDMEELAVMGLVEVLPRLPRLLKIRKELKR   79 (382)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHH-CCCCEEEEECCHHHHHCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             948999906841889999999999831-9896799988299997699544775783130199999779999999999999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCE
Q ss_conf             10012888689851177657999986630134631111002211003663557999998640156774223200255314
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPT  162 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~  162 (383)
T Consensus        80 ~i~~~~Pd~vi~ID~pgFnlrlak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~D~ll~ifPFE~~~f~~~-g~~~  158 (382)
T PRK00025         80 LLLAEPPDVFILIDAPDFNLRLAKKLKKALPGIPIIHYVSPSVWAWRPGRAKKIAKATDHVLAILPFEAAFYDKL-GVPV  158 (382)
T ss_pred             HHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHC-CCCC
T ss_conf             998649999999778306599999999716999889994715654064189999999987610876568999865-9981


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHH
Q ss_conf             763882112210013558889761876556505998538743012305111899987640273512620166336-8899
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLV  241 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~  241 (383)
T Consensus       159 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~i~lLPGSR~~EI~~~lPi~l~a~~~l~~~~p~~~fvip~~~~~~~~~i  238 (382)
T PRK00025        159 TYVGHPLADEIPLEPDRAAARAELGLDPDARVLALLPGSRGSEIKRLLPTFLEAAQLLQQRYPDLRFVVPLANPKRREQF  238 (382)
T ss_pred             EECCCCHHHHCCCCCCHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
T ss_conf             35698156432235687999987399855661787058858999997899999999999878993999955887789999


Q ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-EECCCCCCEEEEHHHCCC
Q ss_conf             9999604888505520552035788763552331156688876275302540577410000-102467610230244078
Q gi|254780767|r  242 RCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-IFYIKTWTCALPNLIVDY  320 (383)
Q Consensus       242 ~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~~lik~~~i~LpNii~~~  320 (383)
T Consensus       239 ~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~~~P~Vv~Yk~~~lt~~i~k~lvkv~~isL~Nii~~k  318 (382)
T PRK00025        239 EQLLAEYAPDLSVTLLDGQAREAMAAADAALAASGTVTLEAALLGVPMVVGYKVKPLTFWIAKRLVKVPYISLPNLLAGE  318 (382)
T ss_pred             HHHHHHCCCCCCEEEECCCCHHHHHHCCEEEECCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEHHHHHCCC
T ss_conf             99998479998389826841778873888765377799999997198589980789999999996569976524875499


Q ss_pred             CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             42612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  321 PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       321 ~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
T Consensus       319 ~ivPEllQ~~~~~~~i~~~~~~ll~d~~~~~~~~~~~~~lr~~L~-~g-as~raA~~Il~~l  378 (382)
T PRK00025        319 ELVPELLQEEATPEKLARALLELLADGARRQALLEGFTELHQYLR-CG-AAERAAQAVLELL  378 (382)
T ss_pred             CCCHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC-CC-HHHHHHHHHHHHH
T ss_conf             766134056699999999999996699999999999999999857-89-9999999999999