HHsearch alignment for GI: 254780767 and conserved domain: cd03798

>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
Probab=99.58  E-value=2e-12  Score=101.91  Aligned_cols=324  Identities=16%  Similarity=0.199  Sum_probs=180.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCC---EEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH--CCCCCCC
Q ss_conf             7899999999997389983999971789994788---0650444531101367466459999999999861--0012888
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGL---VSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL--IVSSKPD   90 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~---~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~--i~~~~Pd   90 (383)
T Consensus        17 e~~~~~la~~L~~~-G~~V~Vit~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~D   95 (377)
T cd03798          17 GIFVKELARALAKR-GVEVTVLAPGPWGPKLLDLLKGRLVGVERLPVLLPVVPLLKGPLLYLLAARALLKLLKLKRFRPD   95 (377)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999977-99699995379875312312575200034454554443310466778999999999997469986


Q ss_pred             EEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCCCC-----HHHHHHHHHHHCCCCCCCHHHHHCCC--CCCE
Q ss_conf             6898511776579999866301346311110-02211003663-----55799999864015677422320025--5314
Q gi|254780767|r   91 VLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWREGR-----ARKMCAYINQVISILPFEKEVMQRLG--GPPT  162 (383)
Q Consensus        91 ~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~~R-----~k~~~~~~d~~~~ifpFE~~~f~k~~--~~~~  162 (383)
T Consensus        96 vI~~~-~~~~~~~~~~~~~~~-~~~~~v~~~h~~~~~~~~~~~~~~~~~~~~~~~ad~ii~~S~~~~~~~~~~~~~~~~i  173 (377)
T cd03798          96 LIHAH-FAYPDGFAAALLKRK-LGIPLVVTLHGSDVNLLPRKRLLRALLRRALRRADAVIAVSEALADELKALGIDPEKV  173 (377)
T ss_pred             EEEEC-CCCHHHHHHHHHHHH-CCCCEEEEECCCHHHHCCCCHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHCCCCCCE
T ss_conf             89978-840679999999997-3998899967741431023168999999999858999988989999999858996559


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHH
Q ss_conf             76388211221001355888976187655650599853874301230511189998764027351262016633688999
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVR  242 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~  242 (383)
T Consensus       174 ~vi~ngi-d~~~f~~~~~~~~~~~~~~~~~-~~i~~~Gr-l~~-~Kg~~~li~a~~~l~~~~~~~~l~i~G~g~~~~~l~  249 (377)
T cd03798         174 TVIPNGV-DTERFSPADRAEARKLGLPEDK-KVILFVGR-LVP-RKGIDYLIEALARLLKKRPDVHLVIVGDGPLREALE  249 (377)
T ss_pred             EEECCCC-CHHHCCCCCHHHHHHHCCCCCC-EEEEEEEE-CCC-CCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHH
T ss_conf             9988975-7875498877789860899998-59999824-520-018289999999988748885224326827888999


Q ss_pred             HHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEE
Q ss_conf             999604888505520----552035788763552331-----15668887627530254057741000010246761023
Q gi|254780767|r  243 CIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCAL  313 (383)
Q Consensus       243 ~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~L  313 (383)
T Consensus       250 ~~~~~~~l~~~v~~~g~v~~~~~~~~~~~adv~v~pS~~E~~~~~~lEama~G~P-vI~~~~gg~~--------------  314 (377)
T cd03798         250 ALAAELGLEDRVTFLGAVPHEEVPAYYAAADVFVLPSLREGFGLVLLEAMACGLP-VVATDVGGIP--------------  314 (377)
T ss_pred             HHHHHCCCCCEEEECCCEEHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC-EEECCCCCHH--------------
T ss_conf             9988618873698605210010101333377413785576512558999975997-9995899869--------------


Q ss_pred             EHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0244078426124205489899999999984498999999999999999838
Q gi|254780767|r  314 PNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       314 pNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
T Consensus       315 -e~i~~~~~-G-~~~~~~~~~~l~~~i~~l~~~~~~~-~~~~~~~~~~~~fs  362 (377)
T cd03798         315 -EIITDGEN-G-LLVPPGDPEALAEAILRLLADPWLR-LGRAARRRVAERFS  362 (377)
T ss_pred             -HHHCCCCE-E-EEECCCCHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHHCC
T ss_conf             -98517974-9-9979999999999999998799999-99999999998699