HHsearch alignment for GI: 254780767 and conserved domain: cd03800

>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
Probab=99.58  E-value=1.6e-11  Score=95.94  Aligned_cols=319  Identities=17%  Similarity=0.160  Sum_probs=180.8

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC--CHH--HH--HCCCEEE-ECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC--CC
Q ss_conf             7899999999997389983999971--789--99--4788065-04445311013674664599999999998610--01
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVG--GPS--LQ--KEGLVSL-FDFSELSVIGIMQVVRHLPQFIFRINQTVELI--VS   86 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giG--G~~--m~--~~G~~~~-~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i--~~   86 (383)
T Consensus        24 e~~v~~La~~L~~~-GH~V~V~t~~~~~~~~~~~~~~~gv~v~rl~~~~~~~~~~~~l~~~l~~~---~~~~~~~~~~~~   99 (398)
T cd03800          24 NVYVLELARALARL-GHEVDIFTRRIDDALPPIVELAPGVRVVRVPAGPAEYLPKEELWPYLDEF---ADDLLRFLRREG   99 (398)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCEEEECCCEEEEEECCCCCCCCCHHHHHHHHHHH---HHHHHHHHHHHC
T ss_conf             99999999999986-99699997247778888068249869999557885433277778789999---999999999838


Q ss_pred             CCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC--------CCCCCCCC---CCH---HHHHHHHHHHCCCCCCCHH
Q ss_conf             288868985117765799998663013463111100--------22110036---635---5799999864015677422
Q gi|254780767|r   87 SKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC--------PSVWAWRE---GRA---RKMCAYINQVISILPFEKE  152 (383)
Q Consensus        87 ~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~--------PqvWAWr~---~R~---k~~~~~~d~~~~ifpFE~~  152 (383)
T Consensus       100 ~~pDvIH~h~~~~-~~-~~~~~~~~-~~ip~V~t~H~l~~~~~~~~~~~~~~~~~~r~~~e~~~~~~ad~via~S~~~~~  176 (398)
T cd03800         100 GRPDLIHAHYWDS-GL-VALLLARR-LGIPLVHTFHSLGAVKRRHLGAADTYEPARRIEAEERLLRAADRVIASTPQEAE  176 (398)
T ss_pred             CCCCEEEECCCCH-HH-HHHHHHHH-HCCCEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCEEEECCHHHHH
T ss_conf             9988899888407-89-99999997-199999963751144433202355423478999999999849999987999999


Q ss_pred             HHHCCCCC---CEEECCCCC-CCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             32002553---147638821-12210013558889761876556505998538743012305111899987640273512
Q gi|254780767|r  153 VMQRLGGP---PTTFVGHPL-SSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       153 ~f~k~~~~---~~~fVGHPl-~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
T Consensus       177 ~~~~~~~~~~~~i~vI~nGvd~~~f~p~~~~~~~~~~~~~~~~~~~i~-~vG-Rl~-~~Kg~~~li~A~~~l~~~~~~~~  253 (398)
T cd03800         177 ELYSLYGAYPRRIRVVPPGVDLERFTPYGRAEARRARLLRDPDKPRIL-AVG-RLD-PRKGIDTLIRAYAELPELRERAN  253 (398)
T ss_pred             HHHHHHCCCCCCEEEECCCCCHHHCCCCCCHHHHHHHHCCCCCCCEEE-EEC-CCC-HHCCHHHHHHHHHHHHHHCCCCE
T ss_conf             999972999022899769867744388980589998608998994899-982-896-02098999999999887789968


Q ss_pred             EEECCCCC------HHHHHHHHHHHCCCCCEEEEEC----CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEEC
Q ss_conf             62016633------6889999996048885055205----52035788763552331-----156688876275302540
Q gi|254780767|r  229 FSLVTVSS------QENLVRCIVSKWDISPEIIIDK----EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIY  293 (383)
Q Consensus       229 ~~i~~~~~------~~~~~~~~~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Y  293 (383)
T Consensus       254 l~ivGg~~~~~~~~~~~~~~~~~~~~~l~~~V~f~G~~~~~~~~~~~~~adv~v~pS~~E~fgl~~lEAma~G~P-vIas  332 (398)
T cd03800         254 LVIVGGPRDDILAMDEEELRELARELGVIDRVDFPGRVSREDLPALYRAADVFVNPALYEPFGLTALEAMACGLP-VVAT  332 (398)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHCCCC-EEEC
T ss_conf             999968876531345999999999759987499889899899999998578887545133221489999982999-9993


Q ss_pred             CCCCCEEEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             5774100001024676102302440784---26124205489899999999984498999999999999-999838
Q gi|254780767|r  294 KSEWIVNFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       294 k~~~lt~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
T Consensus       333 ~~gg~~e~---------------v~~g~~G~l~~-----~~d~~~la~ai~~ll~d~~~~~~~g~~ar~~~~~~fs  388 (398)
T cd03800         333 AVGGPRDI---------------VVDGVTGLLVD-----PRDPEALAAALRRLLTDPALRRRLSRAGLRRARARYT  388 (398)
T ss_pred             CCCCCHHH---------------HCCCCEEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             89980777---------------41797189978-----9999999999999977999999999999999998689