HHsearch alignment for GI: 254780767 and conserved domain: cd03808

>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases. cap1E in Streptococcus pneumoniae is required for the synthesis of type 1 capsular polysaccharides.
Probab=99.63  E-value=4.2e-12  Score=99.81  Aligned_cols=320  Identities=18%  Similarity=0.213  Sum_probs=180.4

Q ss_pred             EEEEEECCCCH--HHHHHHHHHHHHHHCCCCEEEEEECCHH---HHHCCCEEE-ECHHHCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             59999768214--7899999999997389983999971789---994788065-04445311013674664599999999
Q gi|254780767|r    5 KIAVIAGEISG--DLLAGDLIKSLKEMVSYPINLVGVGGPS---LQKEGLVSL-FDFSELSVIGIMQVVRHLPQFIFRIN   78 (383)
Q Consensus         5 ki~i~aGE~SG--D~~~a~li~~Lk~~~~~~~~~~giGG~~---m~~~G~~~~-~~~~~l~v~G~~evl~~~~~~~~~~~   78 (383)
T Consensus         1 kil~i~~-~~GG~e~~~~~La~~L~~~-Gh~V~vit~~~~~~~~~~~~gv~~~~~~~~~~---~~-----~~~~~~~~~~   70 (359)
T cd03808           1 KILHIVT-VDGGLYSFRLPLIKALRAA-GYEVHVVAPPGDELEELEALGVKVIPIPLDRR---GI-----NPFKDLKALL   70 (359)
T ss_pred             CEEEEEC-CCCHHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHCCCEEEEECCCCC---CC-----CHHHHHHHHH
T ss_conf             9899975-8765999999999999976-99999997079874336757988999278777---78-----8699999999


Q ss_pred             HHHHHCCCCCCCEEEEECH-HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCC-----CHH----HHHHHHHHHCCCCC
Q ss_conf             9986100128886898511-7765799998663013463111100221100366-----355----79999986401567
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDN-PDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREG-----RAR----KMCAYINQVISILP  148 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~-pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~-----R~k----~~~~~~d~~~~ifp  148 (383)
T Consensus        71 ~l~~~i~~~~pDvIh~~~~~~~~~~~la~~~~~---~~~~v~~~h~~~~~~~~~~~~~~~~~~~~k~~~~~~~~ii~~S~  147 (359)
T cd03808          71 RLYRLLRKERPDIVHTHTPKPGILGRLAARLAG---VPKVIYTVHGLGFVFTSGGLKRRLYLLLERLALRFTDKVIFQNE  147 (359)
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCC---CCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             999999984998999906513578999998649---98699995677401245477899999999999964999999498


Q ss_pred             CCHHHHHCCC----CCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCC
Q ss_conf             7422320025----531476388211221001355888976187655650599853874301230511189998764027
Q gi|254780767|r  149 FEKEVMQRLG----GPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRN  224 (383)
Q Consensus       149 FE~~~f~k~~----~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~  224 (383)
T Consensus       148 ~~~~~~~~~~~~~~~~~~~i~~~gv-d~-~~~~-----~~~~~~~~-~~~~i~~vG-rl~~-~Kg~~~li~a~~~l~~~~  217 (359)
T cd03808         148 DDRDLALKLGIIKKKKTVLIPGSGV-DL-DRFS-----PSPEPIPE-DDPVFLFVA-RLLK-DKGIDELLEAARILKAKG  217 (359)
T ss_pred             HHHHHHHHHCCCCCCCEEEECCCCC-CH-HHCC-----CCCCCCCC-CCEEEEEEC-CCCH-HCCHHHHHHHHHHHHHHC
T ss_conf             9999999837997460899779976-86-6538-----66546898-984999980-4632-207399999999998639


Q ss_pred             CCCEEEECCCCCH-HHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCC
Q ss_conf             3512620166336-88999999604888505520--552035788763552331-----156688876275302540577
Q gi|254780767|r  225 PFFRFSLVTVSSQ-ENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       225 ~~~~~~i~~~~~~-~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~  296 (383)
T Consensus       218 ~~~~l~ivG~g~~~~~~~~~~~~~~~~~~~v~f~G~~~~~~~~~~~~di~v~pS~~Egf~~~~lEAma~G~PvI-~s~~g  296 (359)
T cd03808         218 PNVRLLLVGDGDEENPAAILEIEKLGLEGRVEFLGFRDDVPELLAAADVFVLPSYREGLPRVLLEAMAMGRPVI-ATDVP  296 (359)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHCCCCEE-ECCCC
T ss_conf             98089997688725899999999718898699807577899999960215787521357842899986699899-94899


Q ss_pred             CCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             410000102467610230244078426124205489899999999984498999999999999-999838
Q gi|254780767|r  297 WIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       297 ~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
T Consensus       297 g~---------------~e~i~~~~~--G~l~~~~d~~~la~~i~~ll~~~~~~~~~~~~a~~~~~~~fs  349 (359)
T cd03808         297 GC---------------REAVIDGVN--GFLVPPGDAEALADAIERLIEDPELRARMGQAARKRAEEEFD  349 (359)
T ss_pred             CH---------------HHHHHCCCC--EEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             72---------------888607981--899899999999999999988999999999999999998779