HHsearch alignment for GI: 254780767 and conserved domain: cd04951

>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have
Probab=99.62  E-value=6.5e-12  Score=98.58  Aligned_cols=322  Identities=13%  Similarity=0.149  Sum_probs=186.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             47899999999997389983999971789994788065044453110136746645999999999986100128886898
Q gi|254780767|r   15 GDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI   94 (383)
Q Consensus        15 GD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~   94 (383)
T Consensus        14 ~e~~~~~la~~L~~~-G~~V~v~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~pDvIh~   85 (360)
T cd04951          14 AEKQVVDLADQFVAK-GHQVAIISLTGESEVKP-------PIDATIILNLNMSKNPLSFLLALWKLRKILRQFKPDVVHA   85 (360)
T ss_pred             HHHHHHHHHHHHHHC-CCEEEEEEECCCCCCCC-------CCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             799999999999976-99899998179854443-------3457337863766676789999999999999829999998


Q ss_pred             EC-HHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHH-----HHHHHHHHCCCCCCCHHHHHCCC---CCCEEEC
Q ss_conf             51-177657999986630134631111002211003663557-----99999864015677422320025---5314763
Q gi|254780767|r   95 VD-NPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARK-----MCAYINQVISILPFEKEVMQRLG---GPPTTFV  165 (383)
Q Consensus        95 iD-~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~-----~~~~~d~~~~ifpFE~~~f~k~~---~~~~~fV  165 (383)
T Consensus        86 h~~~~~~~~~~~~~~---~~~~~~i~t~h~~~-~--~~~~~~~~~~~~~~~~~~~~~vs~~~~~~~~~~~~~~~~ki~vI  159 (360)
T cd04951          86 HMFHANIFARLLRLF---LPSPPLICTAHSKN-E--GGRLRMLAYRLTDFLSDLTTNVSKEALDYFIASKAFNANKSFVV  159 (360)
T ss_pred             CCCCHHHHHHHHHHH---CCCCCEEEEECCCC-C--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEE
T ss_conf             663078999999985---79981999858887-5--41799999999988878652333999999998558884448996


Q ss_pred             CCCCC-CCCC-CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHH
Q ss_conf             88211-2210-013558889761876556505998538743012305111899987640273512620166336889999
Q gi|254780767|r  166 GHPLS-SSPS-ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRC  243 (383)
Q Consensus       166 GHPl~-d~~~-~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~  243 (383)
T Consensus       160 ~ngvd~~~f~~~~~~~~~~r~~~~~~~~~~~-il~vg-Rl~~-~Kg~~~li~a~~~l~~~~~~~~l~ivG~G~~~~~l~~  236 (360)
T cd04951         160 YNGIDTDRFRKDPARRLKIRNALGVKNDTFV-ILAVG-RLVE-AKDYPNLLKAFAKLLSDYLDIKLLIAGDGPLRATLER  236 (360)
T ss_pred             CCCCCHHHCCCCHHHHHHHHHHCCCCCCCEE-EEEEE-CCCC-CCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
T ss_conf             6873444218761567889986199989879-99984-0663-3115789999999986489979999678256788876


Q ss_pred             HHHHCCCCCEEEEEC--CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHH
Q ss_conf             996048885055205--52035788763552331-----15668887627530254057741000010246761023024
Q gi|254780767|r  244 IVSKWDISPEIIIDK--EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNL  316 (383)
Q Consensus       244 ~~~~~~~~~~i~~~~--~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNi  316 (383)
T Consensus       237 ~~~~~~l~~~v~f~G~~~d~~~~~~~adi~v~pS~~Egfg~~~lEAma~G~P-vI~s~~gg~~eii~---~~--------  304 (360)
T cd04951         237 LIKALGLSNRVKLLGLRDDIAAYYNAADLFVLSSAWEGFGLVVAEAMACELP-VVATDAGGVREVVG---DS--------  304 (360)
T ss_pred             HHHHHCCCCCEEECCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCC-EEECCCCCHHHEEC---CC--------
T ss_conf             6776177761542475102689876214255886557887089999985999-99878997265574---86--------


Q ss_pred             HCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH-HHHHHHCCCCCHHHHHHHH
Q ss_conf             407842612420548989999999998449899999999999-9999838999989999999
Q gi|254780767|r  317 IVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFE-NLWDRMNTKKPAGHMAAEI  377 (383)
Q Consensus       317 i~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~-~~~~~Lg~~~~a~~~AA~~  377 (383)
T Consensus       305 --G-~lv~-----~~d~~~la~~i~~ll~~~~~~~~~~~~~~~~v~~~fs----~~~~~~~~  354 (360)
T cd04951         305 --G-LIVP-----ISDPEALANKIDEILKMSGEERDIIGARRERIVKKFS----INSIVQQW  354 (360)
T ss_pred             --E-EEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC----HHHHHHHH
T ss_conf             --4-9983-----9999999999999987919999999999999998699----99999999