Query         gi|254780767|ref|YP_003065180.1| lipid-A-disaccharide synthase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 383
No_of_seqs    189 out of 1971
Neff          6.9 
Searched_HMMs 39220
Date          Sun May 29 18:53:14 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780767.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00025 lpxB lipid-A-disaccha 100.0       0       0  878.3  32.3  376    3-382     1-378 (382)
  2 pfam02684 LpxB Lipid-A-disacch 100.0       0       0  852.9  30.2  369    6-377     1-372 (373)
  3 COG0763 LpxB Lipid A disacchar 100.0       0       0  815.0  31.1  377    3-382     1-379 (381)
  4 PRK01021 lpxB lipid-A-disaccha 100.0       0       0  805.2  29.1  372    5-381   228-605 (607)
  5 TIGR00215 lpxB lipid-A-disacch 100.0       0       0  390.7  18.6  375    3-380     6-392 (393)
  6 TIGR03492 conserved hypothetic 100.0       0       0  338.8  24.4  339    7-382     2-396 (396)
  7 PRK00726 murG N-acetylglucosam 100.0 2.2E-26 5.6E-31  194.1  24.0  340    5-382     3-357 (359)
  8 cd03785 GT1_MurG MurG is an N-  99.9   9E-25 2.3E-29  183.4  22.5  333    5-374     1-348 (350)
  9 PRK12446 N-acetylglucosaminyl   99.9 1.9E-24 4.9E-29  181.3  23.2  333    5-380     3-351 (352)
 10 COG0707 MurG UDP-N-acetylgluco  99.9 5.3E-23 1.4E-27  171.7  23.4  335    4-381     1-354 (357)
 11 TIGR01133 murG undecaprenyldip  99.9 1.8E-21 4.7E-26  161.6  21.6  337    1-372     2-363 (368)
 12 PRK13609 diacylglycerol glucos  99.9 1.4E-19 3.5E-24  149.3  23.5  338    3-381     4-369 (388)
 13 PRK13608 diacylglycerol glucos  99.9   9E-19 2.3E-23  143.8  25.5  334    3-383     5-370 (391)
 14 COG4370 Uncharacterized protei  99.7 2.4E-16 6.2E-21  127.8  15.4  345    3-380     6-409 (412)
 15 cd03817 GT1_UGDG_like This fam  99.7 1.6E-14 4.2E-19  115.7  22.5  329    5-367     1-364 (374)
 16 cd03799 GT1_amsK_like This is   99.7   7E-14 1.8E-18  111.5  23.0  321    5-365     1-347 (355)
 17 cd04962 GT1_like_5 This family  99.7 6.9E-14 1.8E-18  111.6  22.8  333    4-367     1-358 (371)
 18 cd03801 GT1_YqgM_like This fam  99.7 1.5E-13 3.7E-18  109.4  24.2  329    5-366     1-362 (374)
 19 cd03821 GT1_Bme6_like This fam  99.7 5.1E-13 1.3E-17  105.9  25.1  332    5-365     1-365 (375)
 20 cd03812 GT1_CapH_like This fam  99.6 4.6E-12 1.2E-16   99.6  28.2  300   15-354    14-338 (358)
 21 cd03811 GT1_WabH_like This fam  99.6 5.1E-13 1.3E-17  105.9  22.8  317    5-358     1-344 (353)
 22 cd03820 GT1_amsD_like This fam  99.6   1E-13 2.6E-18  110.5  19.1  318    5-365     1-338 (348)
 23 cd03808 GT1_cap1E_like This fa  99.6 4.2E-12 1.1E-16   99.8  26.9  320    5-365     1-349 (359)
 24 cd04951 GT1_WbdM_like This fam  99.6 6.5E-12 1.7E-16   98.6  26.2  322   15-377    14-354 (360)
 25 TIGR03088 stp2 sugar transfera  99.6 1.9E-12 4.9E-17  102.0  23.2  313   16-366    17-359 (374)
 26 cd03807 GT1_WbnK_like This fam  99.6 3.1E-12   8E-17  100.7  24.1  323    5-365     1-352 (365)
 27 cd03796 GT1_PIG-A_like This fa  99.6 1.4E-12 3.6E-17  103.0  21.4  313   16-367    17-355 (398)
 28 cd03819 GT1_WavL_like This fam  99.6 6.2E-12 1.6E-16   98.7  23.1  305   16-360    13-345 (355)
 29 cd03800 GT1_Sucrose_synthase T  99.6 1.6E-11 4.2E-16   95.9  25.2  319   16-365    24-388 (398)
 30 cd03814 GT1_like_2 This family  99.6 4.5E-13 1.1E-17  106.3  17.2  322    5-366     1-352 (364)
 31 cd03798 GT1_wlbH_like This fam  99.6   2E-12 5.2E-17  101.9  20.4  324   16-365    17-362 (377)
 32 cd03794 GT1_wbuB_like This fam  99.6 6.7E-12 1.7E-16   98.5  21.4  333    5-365     1-385 (394)
 33 cd03823 GT1_ExpE7_like This fa  99.5   5E-12 1.3E-16   99.3  19.5  325    5-377     1-353 (359)
 34 cd03822 GT1_ecORF704_like This  99.5 1.3E-11 3.3E-16   96.6  21.3  323   16-381    16-364 (366)
 35 TIGR03449 mycothiol_MshA UDP-N  99.5 7.9E-11   2E-15   91.4  23.7  332   11-370    17-392 (405)
 36 PRK10307 predicted glycosyl tr  99.5 1.3E-09 3.4E-14   83.3  27.7  340    4-367     1-401 (415)
 37 cd03809 GT1_mtfB_like This fam  99.5 1.8E-11 4.5E-16   95.7  17.9  316   13-365    14-355 (365)
 38 cd03805 GT1_ALG2_like This fam  99.5 1.9E-10 4.8E-15   88.9  23.0  330    4-366     1-385 (392)
 39 cd03795 GT1_like_4 This family  99.5 1.6E-11 4.1E-16   96.0  17.4  324    5-364     1-351 (357)
 40 PRK05749 3-deoxy-D-manno-octul  99.5 4.5E-11 1.1E-15   93.1  19.3  328    6-382    52-419 (423)
 41 TIGR03590 PseG pseudaminic aci  99.5 4.1E-12   1E-16   99.9  14.0  252    4-294     1-269 (280)
 42 TIGR03568 NeuC_NnaA UDP-N-acet  99.5 9.3E-11 2.4E-15   91.0  20.7  308    4-351     1-343 (365)
 43 cd03825 GT1_wcfI_like This fam  99.4 7.1E-11 1.8E-15   91.7  19.1  323    4-377     1-358 (365)
 44 cd03784 GT1_Gtf_like This fami  99.4 1.7E-09 4.3E-14   82.7  24.0  335    4-381     1-401 (401)
 45 COG0381 WecB UDP-N-acetylgluco  99.4 8.9E-10 2.3E-14   84.5  21.5  337    1-382     1-372 (383)
 46 cd05844 GT1_like_7 Glycosyltra  99.4 2.5E-10 6.4E-15   88.1  17.5  260   77-376    71-363 (367)
 47 pfam04007 DUF354 Protein of un  99.3 9.8E-11 2.5E-15   90.8  15.0  300    4-345     1-309 (335)
 48 cd04955 GT1_like_6 This family  99.3 1.1E-09 2.8E-14   83.9  19.8  313   15-367    17-352 (363)
 49 PRK09922 UDP-D-galactose:(gluc  99.3 1.1E-09 2.8E-14   83.8  18.2  308    2-352     1-332 (361)
 50 pfam04101 Glyco_tran_28_C Glyc  99.3 4.2E-11 1.1E-15   93.2  10.8  158  194-370     1-164 (167)
 51 COG1817 Uncharacterized protei  99.2 8.4E-09 2.1E-13   78.0  17.4  305    4-348     1-316 (346)
 52 cd03786 GT1_UDP-GlcNAc_2-Epime  99.1 2.3E-08 5.8E-13   75.2  17.6  339    5-378     1-362 (363)
 53 cd03792 GT1_Trehalose_phosphor  99.1 5.1E-08 1.3E-12   72.9  19.0  320   10-367     8-359 (372)
 54 cd03818 GT1_ExpC_like This fam  99.1 1.8E-07 4.5E-12   69.3  21.0  315   21-365    15-385 (396)
 55 COG0859 RfaF ADP-heptose:LPS h  99.0 1.2E-07 3.1E-12   70.4  18.1  317    3-346     1-332 (334)
 56 COG3980 spsG Spore coat polysa  99.0 1.3E-07 3.3E-12   70.2  17.1  291    4-356     1-303 (318)
 57 pfam00534 Glycos_transf_1 Glyc  98.9 6.3E-08 1.6E-12   72.3  13.9  160  178-358     1-170 (172)
 58 PRK00654 glgA glycogen synthas  98.9 4.8E-06 1.2E-10   59.9  23.0  187  179-383   278-476 (476)
 59 cd03802 GT1_AviGT4_like This f  98.9 1.2E-06 3.1E-11   63.8  19.9  287    4-347     1-309 (335)
 60 PRK10422 lipopolysaccharide co  98.9 3.6E-06 9.1E-11   60.7  21.4  312    3-347     5-346 (352)
 61 TIGR03087 stp1 sugar transfera  98.9   8E-07   2E-11   65.0  17.7  319   14-367    14-384 (397)
 62 pfam02350 Epimerase_2 UDP-N-ac  98.8 1.5E-07 3.8E-12   69.8  13.0  276   74-378    53-345 (346)
 63 cd03804 GT1_wbaZ_like This fam  98.8 2.1E-07 5.5E-12   68.8  13.3  284   19-353    15-333 (351)
 64 COG1519 KdtA 3-deoxy-D-manno-o  98.8 4.9E-06 1.2E-10   59.8  19.8  320   18-381    64-418 (419)
 65 cd04949 GT1_gtfA_like This fam  98.8 9.9E-08 2.5E-12   71.0  10.8  148  198-366   208-365 (372)
 66 PRK10916 ADP-heptose:LPS hepto  98.8   9E-07 2.3E-11   64.7  15.7  314    4-346     1-345 (348)
 67 cd04946 GT1_AmsK_like This fam  98.8 5.4E-06 1.4E-10   59.5  19.3  225  104-363   142-394 (407)
 68 COG1819 Glycosyl transferases,  98.8 5.3E-06 1.4E-10   59.6  19.0  345    3-382     1-399 (406)
 69 PRK10964 ADP-heptose:LPS hepto  98.6 7.4E-06 1.9E-10   58.6  16.6  306    4-345     1-321 (322)
 70 TIGR01426 MGT glycosyltransfer  98.6 1.3E-06 3.3E-11   63.6  12.1  328   15-382     7-427 (429)
 71 COG4671 Predicted glycosyl tra  98.6 1.4E-06 3.7E-11   63.3  12.1  322    3-348     9-367 (400)
 72 cd03813 GT1_like_3 This family  98.6 5.1E-06 1.3E-10   59.7  13.9  153  193-362   294-458 (475)
 73 TIGR02149 glgA_Coryne glycogen  98.5 2.6E-06 6.7E-11   61.6  11.4  332   17-380    20-414 (416)
 74 cd03789 GT1_LPS_heptosyltransf  98.5 3.7E-05 9.4E-10   54.0  16.8  218    5-295     1-226 (279)
 75 PRK10125 predicted glycosyl tr  98.4 0.00023 5.9E-09   48.8  18.3  183  160-378   212-399 (405)
 76 cd01635 Glycosyltransferase_GT  98.3 6.1E-05 1.6E-09   52.6  14.8   90  208-298   117-216 (229)
 77 cd03791 GT1_Glycogen_synthase_  98.1 0.00024 6.2E-09   48.6  13.0  163  179-357   281-456 (476)
 78 cd03806 GT1_ALG11_like This fa  98.0  0.0015 3.7E-08   43.4  17.0  255   77-365    96-412 (419)
 79 pfam01075 Glyco_transf_9 Glyco  97.7 0.00051 1.3E-08   46.5   9.8  103  189-296   104-214 (249)
 80 pfam00201 UDPGT UDP-glucoronos  97.7  0.0052 1.3E-07   39.8  18.3  105  259-378   331-438 (501)
 81 pfam04464 Glyphos_transf CDP-G  97.6  0.0016   4E-08   43.3  10.9  179  183-380     2-186 (186)
 82 pfam03033 Glyco_transf_28 Glyc  97.4 0.00089 2.3E-08   44.9   7.6  106    6-119     1-114 (136)
 83 pfam06258 DUF1022 Protein of u  97.3  0.0071 1.8E-07   38.9  11.1  224   53-297    18-256 (308)
 84 COG3660 Predicted nucleoside-d  97.2   0.021 5.3E-07   35.8  15.7  256    4-297     1-276 (329)
 85 TIGR02095 glgA glycogen/starch  96.9   0.041   1E-06   33.9  13.1  304   33-354    87-493 (517)
 86 KOG1111 consensus               96.8  0.0063 1.6E-07   39.3   6.9  106  190-297   191-305 (426)
 87 COG1887 TagB Putative glycosyl  96.7    0.04   1E-06   34.0  10.8  224  140-379   149-385 (388)
 88 TIGR02195 heptsyl_trn_II lipop  96.5   0.017 4.4E-07   36.3   7.7  313    5-344     1-360 (361)
 89 cd03816 GT1_ALG1_like This fam  96.3   0.046 1.2E-06   33.6   8.8  126  209-357   246-395 (415)
 90 TIGR03609 S_layer_CsaB polysac  95.9    0.17 4.2E-06   29.9  14.3  195   88-292    64-275 (298)
 91 TIGR00236 wecB UDP-N-acetylglu  95.7    0.19 4.8E-06   29.5  16.3  347    4-378     1-376 (380)
 92 KOG0853 consensus               95.4    0.25 6.3E-06   28.7  11.5  154  210-380   288-467 (495)
 93 cd04950 GT1_like_1 Glycosyltra  95.3     0.1 2.6E-06   31.2   7.3  184   89-292   102-307 (373)
 94 COG2327 WcaK Polysaccharide py  94.5    0.42 1.1E-05   27.3  13.5  269    4-293     1-311 (385)
 95 PRK10017 putative pyruvyl tran  94.4    0.45 1.1E-05   27.0  20.4  324    4-353     1-399 (426)
 96 PRK11083 DNA-binding response   94.2     0.5 1.3E-05   26.8   8.5   81    1-122     1-83  (229)
 97 PHA01630 putative group 1 glyc  94.0    0.52 1.3E-05   26.6   8.4  147  138-302    95-251 (333)
 98 PHA01633 putative glycosyl tra  93.7    0.36 9.2E-06   27.7   7.0  148  190-352   146-315 (335)
 99 COG1165 MenD 2-succinyl-6-hydr  93.0    0.49 1.3E-05   26.8   6.7   15   34-48    109-124 (566)
100 COG0438 RfaG Glycosyltransfera  92.1    0.99 2.5E-05   24.8  10.8  151  194-364   200-361 (381)
101 pfam05159 Capsule_synth Capsul  92.0    0.27   7E-06   28.5   4.4   98  195-292   119-224 (268)
102 COG0297 GlgA Glycogen synthase  91.7     1.1 2.9E-05   24.4   9.5  153  177-343   277-439 (487)
103 PRK11337 DNA-binding transcrip  90.4    0.68 1.7E-05   25.9   5.1   44   50-94      3-47  (293)
104 pfam08660 Alg14 Oligosaccharid  89.8     1.6 4.2E-05   23.3   8.1  146    7-167     2-165 (166)
105 PRK10840 transcriptional regul  89.7     1.7 4.3E-05   23.3   7.7   81    1-120     1-86  (216)
106 PRK13114 consensus              89.5     1.7 4.4E-05   23.2   7.7  122    6-141    17-167 (266)
107 PRK13134 consensus              87.7     1.6   4E-05   23.5   5.4  122    6-141    23-172 (257)
108 TIGR02193 heptsyl_trn_I lipopo  87.7     2.3 5.8E-05   22.4  16.0  270    5-296     1-313 (359)
109 PRK10046 dpiA two-component re  87.6     2.3 5.8E-05   22.4   7.8   80    2-120     3-84  (225)
110 PRK11302 DNA-binding transcrip  87.5     1.1 2.7E-05   24.5   4.5   30   63-92      3-33  (284)
111 pfam04413 Glycos_transf_N 3-De  86.8     2.5 6.5E-05   22.1   7.5  146    6-171    24-183 (186)
112 COG4641 Uncharacterized protei  86.4     2.6 6.8E-05   22.0  11.3  284   21-363    22-345 (373)
113 PRK13112 consensus              85.9     1.8 4.7E-05   23.0   4.9  121    6-140    22-171 (279)
114 TIGR02472 sucr_P_syn_N sucrose  85.5     2.3 5.8E-05   22.4   5.3  251   71-353    95-419 (445)
115 PRK13122 consensus              85.5     1.8 4.6E-05   23.0   4.7  124    1-141     1-152 (242)
116 PRK09987 dTDP-4-dehydrorhamnos  85.4       3 7.6E-05   21.6   7.5   90    4-126     1-108 (299)
117 cd01425 RPS2 Ribosomal protein  85.3       3 7.7E-05   21.6   5.9   20  277-296   141-160 (193)
118 PRK04607 consensus              85.3       3 7.7E-05   21.6   6.5   90    1-94      2-119 (330)
119 pfam00290 Trp_syntA Tryptophan  85.1     1.8 4.6E-05   23.1   4.6  122    6-141    13-163 (258)
120 PRK13132 consensus              84.3     1.9 4.8E-05   22.9   4.4  123    6-141    15-161 (246)
121 pfam00072 Response_reg Respons  84.1     1.1 2.8E-05   24.4   3.1   42   79-120    33-76  (111)
122 PRK13140 consensus              84.0     2.9 7.3E-05   21.7   5.2  124    6-141    18-168 (257)
123 PRK13120 consensus              83.7     3.3 8.4E-05   21.3   5.4  122    6-141    25-175 (285)
124 PRK13113 consensus              83.6     3.4 8.8E-05   21.2   5.5  121    6-140    21-170 (263)
125 PRK13124 consensus              83.5     3.3 8.3E-05   21.4   5.3  121    6-141    13-161 (257)
126 cd04724 Tryptophan_synthase_al  83.2     2.1 5.3E-05   22.6   4.3  121    6-140     4-152 (242)
127 PRK13118 consensus              82.9     2.9 7.3E-05   21.7   4.8   58   77-139   111-169 (269)
128 CHL00200 trpA tryptophan synth  82.2     2.8   7E-05   21.8   4.6  124    6-141    19-168 (263)
129 PRK13121 consensus              82.2     3.4 8.6E-05   21.3   5.0  124    6-141    21-171 (265)
130 pfam00318 Ribosomal_S2 Ribosom  82.0     3.1 7.9E-05   21.5   4.8   19  278-296   152-170 (205)
131 PRK13111 trpA tryptophan synth  82.0     2.6 6.6E-05   22.0   4.3  122    6-141    13-162 (256)
132 PRK03367 consensus              81.7     4.2 0.00011   20.7   7.4  105    1-108     2-144 (329)
133 cd00156 REC Signal receiver do  81.6     1.6   4E-05   23.4   3.1   41   80-120    33-75  (113)
134 PRK11557 putative DNA-binding   81.3     3.6 9.1E-05   21.1   4.9   27   66-92      7-33  (282)
135 PRK06180 short chain dehydroge  81.3     4.3 0.00011   20.5   6.6   35    1-40      1-35  (277)
136 PRK13127 consensus              81.2     3.5   9E-05   21.1   4.8  120    6-139    15-162 (262)
137 PRK13123 consensus              81.2     2.7 6.9E-05   21.9   4.2  124    6-141    19-166 (256)
138 PRK13138 consensus              81.2     2.5 6.3E-05   22.1   4.0  121    6-140    17-168 (264)
139 PRK02304 adenine phosphoribosy  80.8     3.5 8.8E-05   21.2   4.7   54   64-120    26-79  (174)
140 PRK13135 consensus              80.8     4.4 0.00011   20.5   5.2  122    6-141    21-170 (267)
141 PRK13119 consensus              80.8     4.5 0.00011   20.4   5.5  122    6-139    19-167 (261)
142 PRK09390 fixJ response regulat  80.8     1.9 4.8E-05   23.0   3.3   35   85-119    44-80  (202)
143 PRK06555 pyrophosphate--fructo  80.2     4.7 0.00012   20.3   9.5  118    1-119     1-146 (403)
144 TIGR01182 eda 2-dehydro-3-deox  80.0     1.4 3.6E-05   23.7   2.4   26  200-225    33-58  (205)
145 cd07020 Clp_protease_NfeD_1 No  79.9     4.8 0.00012   20.2   5.2   60   73-132    14-77  (187)
146 cd03793 GT1_Glycogen_synthase_  79.9     3.2 8.1E-05   21.4   4.2  101  260-367   467-574 (590)
147 PRK09739 hypothetical protein;  79.8     4.8 0.00012   20.2   7.1   37    1-38      1-41  (201)
148 TIGR02015 BchY chlorophyllide   79.8    0.98 2.5E-05   24.8   1.6  225   84-356   163-421 (426)
149 pfam00551 Formyl_trans_N Formy  79.0     2.9 7.3E-05   21.7   3.7   95    4-108     1-96  (181)
150 PRK07454 short chain dehydroge  78.9     5.2 0.00013   20.0   5.8   35    1-40      3-37  (241)
151 cd01143 YvrC Periplasmic bindi  78.4     1.9 4.8E-05   22.9   2.7   60   80-150    52-111 (195)
152 PRK13125 trpA tryptophan synth  77.7     5.6 0.00014   19.8   5.7  119    6-140     9-155 (247)
153 cd05013 SIS_RpiR RpiR-like pro  77.7     5.6 0.00014   19.8   5.4  108   21-151     5-116 (139)
154 PRK09468 ompR osmolarity respo  77.5     2.5 6.4E-05   22.1   3.1   42   81-122    42-85  (239)
155 PRK09958 DNA-binding transcrip  77.5     2.5 6.3E-05   22.1   3.0   46  330-382   158-203 (204)
156 COG1030 NfeD Membrane-bound se  77.0     5.8 0.00015   19.7   5.1   63   72-136    40-108 (436)
157 PRK13137 consensus              76.9     5.9 0.00015   19.7   5.1  123    6-141    29-177 (266)
158 PRK13129 consensus              76.5       6 0.00015   19.6   7.3  120    6-139    23-170 (267)
159 PRK09836 DNA-binding transcrip  76.4     2.4 6.1E-05   22.2   2.8   77    4-121     1-79  (226)
160 PRK10693 response regulator of  76.1       3 7.6E-05   21.6   3.2   42   79-120    42-85  (337)
161 COG4753 Response regulator con  76.0       3 7.7E-05   21.6   3.1   72   37-118     5-80  (475)
162 PRK02947 hypothetical protein;  75.8     6.3 0.00016   19.5   5.5  193   19-248    30-239 (247)
163 PRK10643 DNA-binding transcrip  75.5     3.5 8.9E-05   21.2   3.4   78    4-122     1-80  (222)
164 KOG1465 consensus               75.0     6.6 0.00017   19.4   6.5   97  195-299   165-280 (353)
165 PRK09935 transcriptional regul  75.0       3 7.6E-05   21.6   2.9   22  215-236    66-87  (210)
166 PRK10124 putative UDP-glucose   74.8     4.6 0.00012   20.3   3.9   26   18-43    155-180 (464)
167 pfam07355 GRDB Glycine/sarcosi  73.7     4.4 0.00011   20.5   3.5   70   74-146    66-154 (349)
168 PRK10499 N,N'-diacetylchitobio  73.7     7.1 0.00018   19.1   9.1   83    1-100     1-84  (106)
169 cd07015 Clp_protease_NfeD Nodu  73.6     7.1 0.00018   19.1   5.1   56   74-131    15-76  (172)
170 PRK13117 consensus              72.8     6.6 0.00017   19.3   4.3   58   77-139   111-169 (268)
171 PRK13139 consensus              72.4     7.6 0.00019   18.9   4.8   57   78-139   110-167 (254)
172 pfam06925 MGDG_synth Monogalac  72.3     7.6 0.00019   18.9   5.3   83   76-192    77-161 (169)
173 PRK10923 glnG nitrogen regulat  72.3     4.8 0.00012   20.2   3.4   36   84-119    43-80  (469)
174 PRK13115 consensus              72.1     7.6 0.00019   18.9   4.4  124    6-141    28-176 (269)
175 PRK09483 response regulator; P  71.8     4.2 0.00011   20.7   3.0   20  215-234    64-83  (216)
176 cd01139 TroA_f Periplasmic bin  71.7     7.9  0.0002   18.8   4.6   90   18-120    26-124 (342)
177 PRK10403 transcriptional regul  71.6     3.2 8.2E-05   21.4   2.4   31  331-367   169-199 (215)
178 cd01147 HemV-2 Metal binding p  71.2     4.6 0.00012   20.4   3.2   42   81-124    67-108 (262)
179 PRK10336 DNA-binding transcrip  70.7     2.8   7E-05   21.8   1.9   39   82-120    38-78  (219)
180 pfam02601 Exonuc_VII_L Exonucl  70.3     8.4 0.00021   18.6   8.3   92    3-120    14-113 (295)
181 PRK01909 pdxA 4-hydroxythreoni  69.8     8.6 0.00022   18.6   7.7   90    2-94      4-113 (329)
182 pfam05693 Glycogen_syn Glycoge  69.7     7.8  0.0002   18.9   4.0   98  260-367   462-569 (633)
183 PRK10161 transcriptional regul  69.6     5.9 0.00015   19.7   3.4   80    1-122     1-84  (229)
184 PRK00742 chemotaxis-specific m  69.5       5 0.00013   20.1   3.0   76    4-119     3-80  (345)
185 cd00529 RuvC_resolvase Hollida  69.4     8.8 0.00022   18.5   6.1   80   67-146    38-131 (154)
186 pfam04392 ABC_sub_bind ABC tra  69.3     8.8 0.00022   18.5   4.4  166   77-293    48-217 (292)
187 PRK10651 transcriptional regul  69.2     2.1 5.3E-05   22.7   1.0   34  329-368   169-202 (216)
188 TIGR01818 ntrC nitrogen regula  68.8     7.7  0.0002   18.9   3.9  146   75-249    29-182 (471)
189 COG0039 Mdh Malate/lactate deh  68.8       9 0.00023   18.4   4.6   61  268-334   226-288 (313)
190 cd06334 PBP1_ABC_ligand_bindin  68.6     9.1 0.00023   18.4   4.2  156   79-255    58-225 (351)
191 PRK12555 chemotaxis-specific m  68.6     5.3 0.00014   19.9   3.0   78    3-120     1-80  (340)
192 PRK10816 DNA-binding transcrip  68.4     3.2 8.1E-05   21.4   1.8   44   79-122    35-80  (223)
193 cd05005 SIS_PHI Hexulose-6-pho  67.9     6.4 0.00016   19.4   3.3   49   88-146    75-126 (179)
194 PRK13116 consensus              67.8     9.4 0.00024   18.3   4.1   17  102-118    82-98  (278)
195 PRK13133 consensus              67.4     9.1 0.00023   18.4   4.0  124    6-141    19-173 (267)
196 pfam10906 DUF2697 Protein of u  67.3     3.7 9.6E-05   21.0   2.0   45   94-139     8-56  (68)
197 PRK13435 response regulator; P  67.2     6.7 0.00017   19.3   3.3   77    3-120     1-80  (141)
198 PRK10365 transcriptional regul  66.8     6.5 0.00017   19.4   3.2   13    2-14      4-16  (441)
199 PRK09423 gldA glycerol dehydro  66.7     9.9 0.00025   18.2   7.6   89    5-127    31-119 (366)
200 pfam04230 PS_pyruv_trans Polys  66.6      10 0.00025   18.2  10.4   35  259-293   221-255 (258)
201 PRK11173 two-component respons  66.3     6.3 0.00016   19.5   3.0   79    1-121     1-81  (237)
202 cd07021 Clp_protease_NfeD_like  66.2      10 0.00026   18.1   4.8   48   75-124    16-68  (178)
203 PRK05299 rpsB 30S ribosomal pr  66.1      10 0.00026   18.1   4.4   20  277-296   171-190 (255)
204 PRK03379 vitamin B12-transport  66.1      10 0.00026   18.1   4.7   71   66-147    55-125 (265)
205 PRK13131 consensus              65.7      10 0.00026   18.0   6.3   56   78-138   105-161 (257)
206 pfam00056 Ldh_1_N lactate/mala  65.4       9 0.00023   18.4   3.7   36  200-235    85-120 (142)
207 pfam07454 SpoIIP Stage II spor  65.2      11 0.00027   18.0   4.5   37  195-231   179-215 (258)
208 cd01140 FatB Siderophore bindi  65.1     5.3 0.00013   20.0   2.4   37   81-123    65-101 (270)
209 KOG2941 consensus               65.0      11 0.00027   18.0   8.6  132  207-360   267-423 (444)
210 PRK11361 acetoacetate metaboli  64.8     7.5 0.00019   19.0   3.1   18   19-37     63-80  (457)
211 cd01980 Chlide_reductase_Y Chl  64.7     2.2 5.6E-05   22.5   0.4  155   82-252    85-255 (416)
212 PRK10481 hypothetical protein;  64.6     8.1 0.00021   18.7   3.3   30   71-100    72-101 (224)
213 pfam07302 AroM AroM protein. T  64.2     8.2 0.00021   18.7   3.3   31   71-101    70-100 (221)
214 pfam01408 GFO_IDH_MocA Oxidore  63.9      11 0.00029   17.8   5.2   90    4-118     1-90  (120)
215 cd02068 radical_SAM_B12_BD B12  63.8     9.7 0.00025   18.2   3.6   35   85-119    36-73  (127)
216 TIGR00661 MJ1255 conserved hyp  63.3      11 0.00029   17.7  13.1  271    6-296     3-308 (353)
217 KOG1387 consensus               63.2      11 0.00029   17.7   3.9  255   77-367   139-446 (465)
218 PRK09534 btuF corrinoid ABC tr  62.6     7.7  0.0002   18.9   2.9   61   80-151   111-171 (364)
219 TIGR00993 3a0901s04IAP86 chlor  62.2     3.8 9.8E-05   20.9   1.3   66   71-150   190-259 (772)
220 PRK10610 chemotaxis regulatory  62.0     8.8 0.00022   18.5   3.1   35   85-119    47-85  (129)
221 PRK03877 consensus              61.9      12 0.00031   17.6   8.1  120    1-127     1-161 (328)
222 cd06346 PBP1_ABC_ligand_bindin  61.7      12 0.00031   17.6   4.2   44   75-119    54-97  (312)
223 PRK13358 protocatechuate 4,5-d  61.7      10 0.00027   18.0   3.4   32   71-102    25-56  (269)
224 PRK03946 pdxA 4-hydroxythreoni  61.3      12 0.00032   17.5   7.6  117    2-126     1-141 (304)
225 cd01339 LDH-like_MDH L-lactate  61.3      12 0.00032   17.5   4.6   33  201-233    83-115 (300)
226 cd01141 TroA_d Periplasmic bin  61.2     9.2 0.00023   18.4   3.1   37   81-120    62-98  (186)
227 PRK09581 pleD response regulat  61.1      10 0.00026   18.1   3.3   39   82-120    40-82  (457)
228 KOG0680 consensus               60.6      12 0.00031   17.6   3.6   55  289-343   241-309 (400)
229 PRK06223 malate dehydrogenase;  60.0      13 0.00033   17.4   4.1   60  269-334   227-288 (312)
230 cd06325 PBP1_ABC_uncharacteriz  59.9      13 0.00034   17.4   4.3  166   78-293    50-218 (281)
231 PRK05654 acetyl-CoA carboxylas  59.7     3.9   1E-04   20.8   1.0   81  281-365   192-284 (288)
232 TIGR02918 TIGR02918 conserved   58.4      11 0.00027   18.0   3.0  145  190-348   325-480 (511)
233 PRK10710 DNA-binding transcrip  58.2     5.7 0.00015   19.7   1.6   39   81-120    47-87  (240)
234 PRK00994 F420-dependent methyl  57.8      11 0.00029   17.8   3.1   61    5-95      4-66  (276)
235 pfam01761 DHQ_synthase 3-dehyd  57.8      14 0.00036   17.1  10.0   87    4-120    20-112 (310)
236 PRK10430 DNA-binding transcrip  57.1      13 0.00034   17.3   3.3   78    4-120     2-83  (239)
237 PRK10766 DNA-binding transcrip  56.8     9.3 0.00024   18.4   2.5   79    1-122     1-81  (224)
238 cd01148 TroA_a Metal binding p  56.6      15 0.00038   17.0   4.2   67   81-149    72-141 (284)
239 PRK05920 aromatic acid decarbo  56.4      15 0.00038   17.0  11.8   37    1-40      1-38  (205)
240 pfam04396 consensus             56.2      15 0.00039   17.0   4.2  113   13-130    18-148 (149)
241 TIGR01771 L-LDH-NAD L-lactate   56.1      15 0.00038   17.0   3.5   59  201-260    82-140 (302)
242 cd06333 PBP1_ABC-type_HAAT_lik  55.5      16  0.0004   16.9   4.0   43   76-120    54-96  (312)
243 cd07368 PhnC_Bs_like PhnC is a  55.5      13 0.00033   17.4   3.0   31   71-101    29-59  (277)
244 PRK01966 ddl D-alanyl-alanine   55.4      16  0.0004   16.9   5.1   39    1-40      1-44  (344)
245 TIGR01973 NuoG NADH-quinone ox  55.3      16  0.0004   16.9   3.8   46   79-128   390-441 (715)
246 KOG4626 consensus               55.2      16  0.0004   16.8   5.8  160  183-361   750-919 (966)
247 TIGR01212 TIGR01212 radical SA  55.1      12 0.00031   17.5   2.9  108   64-224    95-208 (307)
248 PRK13126 consensus              54.9      16  0.0004   16.8   5.5  119    6-140    10-146 (237)
249 pfam02310 B12-binding B12 bind  54.9      16  0.0004   16.8   7.7   42   78-119    41-86  (121)
250 cd02070 corrinoid_protein_B12-  54.8      16 0.00041   16.8   4.1   69  152-235   104-174 (201)
251 TIGR02154 PhoB phosphate regul  54.0      12 0.00031   17.6   2.7   42   77-119    35-81  (226)
252 cd06289 PBP1_MalI_like Ligand-  53.8      16 0.00042   16.7  12.7   43   76-120    43-85  (268)
253 cd00650 LDH_MDH_like NAD-depen  53.8      17 0.00042   16.7   5.5   35  201-235    87-121 (263)
254 pfam01497 Peripla_BP_2 Peripla  53.8      17 0.00042   16.7   4.8   83   19-121     8-90  (236)
255 PRK11475 DNA-binding transcrip  53.0       5 0.00013   20.1   0.6  157  188-381    36-195 (205)
256 TIGR03659 IsdE heme ABC transp  52.9      17 0.00043   16.6   4.7   38   81-122    84-121 (289)
257 CHL00148 orf27 Ycf27; Reviewed  52.9     5.3 0.00013   20.0   0.7   39   83-122    45-85  (240)
258 PRK00066 ldh L-lactate dehydro  52.7      17 0.00044   16.6   4.8   60  269-334   233-294 (315)
259 PRK09554 feoB ferrous iron tra  52.5      17 0.00044   16.6   3.4  104    1-110     1-110 (772)
260 COG1995 PdxA Pyridoxal phospha  52.2      17 0.00045   16.5   7.3  135    1-141     1-175 (332)
261 TIGR03127 RuMP_HxlB 6-phospho   52.2      17 0.00045   16.5   3.4   49   88-146    72-123 (179)
262 PRK11517 transcriptional regul  51.8      18 0.00045   16.5   3.7   76    4-121     1-78  (223)
263 COG3563 KpsC Capsule polysacch  51.8      18 0.00045   16.5   4.0  197  124-330   365-625 (671)
264 cd07367 CarBb CarBb is the B s  51.5      18 0.00046   16.5   3.3   30   71-100    25-54  (268)
265 TIGR01090 apt adenine phosphor  51.3      10 0.00025   18.1   1.9   57   52-108     5-72  (175)
266 COG3947 Response regulator con  51.3      18 0.00046   16.4   3.5   45   78-122    34-80  (361)
267 cd06564 GH20_DspB_LnbB-like Gl  51.2      18 0.00046   16.4   4.1   86   73-159    80-165 (326)
268 cd06337 PBP1_ABC_ligand_bindin  51.0      18 0.00047   16.4   4.0   45   77-123    58-102 (357)
269 COG0614 FepB ABC-type Fe3+-hyd  50.4      19 0.00047   16.4   4.1   39   81-123   108-146 (319)
270 CHL00174 accD acetyl-CoA carbo  50.4       5 0.00013   20.2   0.2   79  283-364   214-303 (305)
271 PRK06924 short chain dehydroge  50.0      19 0.00048   16.3   5.3   33    4-41      1-33  (251)
272 cd06326 PBP1_STKc_like Type I   49.9      19 0.00048   16.3   4.2  153   76-255    56-221 (336)
273 cd06340 PBP1_ABC_ligand_bindin  49.8      19 0.00049   16.3   4.4   42   78-121    60-101 (347)
274 cd01337 MDH_glyoxysomal_mitoch  49.3      10 0.00026   18.1   1.7   16  307-322   260-275 (310)
275 cd00762 NAD_bind_malic_enz NAD  49.0      14 0.00036   17.2   2.4  107   78-223    96-221 (254)
276 PRK13365 protocatechuate 4,5-d  48.8      20  0.0005   16.2   3.2   30   71-100    31-60  (279)
277 COG1737 RpiR Transcriptional r  48.7      15 0.00038   17.0   2.5   32   62-93      4-36  (281)
278 cd01144 BtuF Cobalamin binding  48.5      20 0.00051   16.2   4.7   73   67-151    36-109 (245)
279 TIGR01902 dapE-lys-deAc N-acet  48.3     9.5 0.00024   18.3   1.4   20   12-31     11-31  (352)
280 PRK10701 DNA-binding transcrip  48.2       6 0.00015   19.6   0.4   40   82-122    39-80  (240)
281 PRK13856 two-component respons  48.2      19 0.00049   16.3   3.0   42   80-122    37-80  (241)
282 TIGR03288 CoB_CoM_SS_B CoB--Co  47.5      21 0.00053   16.1   3.4   20   87-106    69-88  (290)
283 PRK00843 egsA NAD(P)-dependent  47.4      21 0.00053   16.1   8.2   86    5-125    36-121 (351)
284 PRK13136 consensus              47.1      21 0.00053   16.0   4.7  120    6-140    16-163 (253)
285 TIGR00504 pyro_pdase pyrrolido  46.9      16 0.00041   16.8   2.4   87  207-295    38-140 (220)
286 COG0163 UbiX 3-polyprenyl-4-hy  46.8      21 0.00054   16.0   4.6  152    3-159     2-188 (191)
287 COG4741 Predicted secreted end  46.7      12  0.0003   17.7   1.7   35  130-169    82-116 (175)
288 cd07949 PCA_45_Doxase_B_like_1  46.7      21 0.00054   16.0   3.2   31   71-101    31-61  (276)
289 PTZ00325 malate dehydrogenase;  46.6      12  0.0003   17.7   1.7   27  307-334   259-286 (313)
290 PRK04507 consensus              46.6      21 0.00054   16.0  10.3  104    1-107     1-139 (323)
291 cd06335 PBP1_ABC_ligand_bindin  46.4      21 0.00055   16.0   4.5   42   77-120    56-97  (347)
292 PRK13364 protocatechuate 4,5-d  46.4      21 0.00055   16.0   3.2   30   71-100    31-60  (279)
293 TIGR02875 spore_0_A sporulatio  46.3      14 0.00035   17.3   2.0   34  236-275   155-188 (270)
294 cd03788 GT1_TPS Trehalose-6-Ph  46.2      22 0.00055   15.9  17.7  263   85-380   127-457 (460)
295 cd07950 Gallate_Doxase_N The N  46.2      22 0.00055   15.9   3.2   31   71-101    31-61  (277)
296 cd06348 PBP1_ABC_ligand_bindin  46.0      22 0.00055   15.9   4.1   50   77-128    56-107 (344)
297 PRK07114 keto-hydroxyglutarate  46.0      13 0.00032   17.5   1.8   41   78-120     7-47  (223)
298 cd06341 PBP1_ABC_ligand_bindin  45.9      22 0.00056   15.9   4.1  153   79-256    58-219 (341)
299 KOG1192 consensus               45.8      22 0.00056   15.9   5.4   39    3-42      6-44  (496)
300 COG1179 Dinucleotide-utilizing  45.8      22 0.00056   15.9   8.2   71   18-94     20-103 (263)
301 PRK13931 stationary phase surv  45.8      13 0.00033   17.4   1.8   35   85-119    84-126 (261)
302 cd04795 SIS SIS domain. SIS (S  45.7      21 0.00053   16.1   2.8   32   87-120    46-80  (87)
303 CHL00067 rps2 ribosomal protei  45.7      22 0.00056   15.9   4.8   18  279-296   173-190 (227)
304 pfam03959 FSH1 Serine hydrolas  45.7      22 0.00056   15.9   5.4   44    2-46      3-47  (210)
305 pfam06838 Alum_res Aluminium r  45.3      19 0.00049   16.2   2.6   24   74-97    175-198 (405)
306 cd07364 PCA_45_Dioxygenase_B S  45.3      22 0.00057   15.8   3.2   30   71-100    31-60  (277)
307 PRK03659 glutathione-regulated  45.2      22 0.00057   15.8   3.2   95   91-231   402-496 (602)
308 cd01823 SEST_like SEST_like. A  45.2      22 0.00057   15.8   4.7   31   13-44     29-59  (259)
309 cd06329 PBP1_SBP_like_3 Peripl  45.1      22 0.00057   15.8   4.0   40   86-125    64-110 (342)
310 PRK00421 murC UDP-N-acetylmura  44.9      20  0.0005   16.2   2.6   36   87-128    66-103 (459)
311 pfam07014 Hs1pro-1_C Hs1pro-1   44.7      23 0.00058   15.8   2.9   11   33-43     20-30  (261)
312 KOG3349 consensus               44.7      23 0.00058   15.8   3.9   35  259-293    72-107 (170)
313 COG1091 RfbD dTDP-4-dehydrorha  44.6      23 0.00058   15.8   6.4   80    4-120     1-98  (281)
314 PRK13366 protocatechuate 4,5-d  44.5      23 0.00058   15.8   3.1   30   71-100    31-60  (284)
315 PRK11752 putative glutathione   44.5     6.2 0.00016   19.5  -0.0   22  118-139     4-25  (264)
316 TIGR00421 ubiX_pad polyprenyl   44.1      23 0.00059   15.7   4.2  141    5-156     1-180 (181)
317 TIGR00863 P2X cation transport  44.1     3.5 8.8E-05   21.2  -1.4   18  241-258   313-330 (377)
318 PRK13933 stationary phase surv  43.4      16  0.0004   16.8   1.9   36   83-118    82-125 (253)
319 COG0052 RpsB Ribosomal protein  43.2      24 0.00061   15.6   4.8   38  249-298   154-191 (252)
320 PRK09590 celB cellobiose phosp  42.9      24 0.00062   15.6   5.3   77    5-93      4-81  (104)
321 PRK05693 short chain dehydroge  42.8      24 0.00062   15.6   7.3   32    4-40      1-32  (274)
322 PRK13935 stationary phase surv  42.8      14 0.00037   17.1   1.6   39   82-120    80-126 (255)
323 pfam02670 DXP_reductoisom 1-de  42.6      23 0.00059   15.7   2.7   44  241-284    62-108 (129)
324 PRK13529 malate dehydrogenase;  42.5      23 0.00057   15.8   2.6   26  123-148   208-239 (563)
325 PRK10949 protease 4; Provision  42.5      25 0.00063   15.6   4.6   20   19-39     97-116 (618)
326 TIGR03190 benz_CoA_bzdN benzoy  42.3      25 0.00063   15.6   4.3   38   88-125    88-126 (377)
327 COG0777 AccD Acetyl-CoA carbox  41.9      25 0.00064   15.5   2.8   93  265-366   171-283 (294)
328 cd06355 PBP1_FmdD_like Peripla  41.8      25 0.00064   15.5   4.2   22  212-233   176-197 (348)
329 PRK10529 DNA-binding transcrip  41.7      12  0.0003   17.7   1.1   38   82-120    39-78  (225)
330 cd01844 SGNH_hydrolase_like_6   41.5      25 0.00065   15.5   4.0   24   15-42     19-42  (177)
331 pfam11633 Nsp3 Replicase polyp  41.3      26 0.00065   15.4   3.5   32   77-112    25-56  (142)
332 TIGR00087 surE 5'/3'-nucleotid  41.2      16  0.0004   16.9   1.6   93  195-292    72-174 (326)
333 pfam04227 Indigoidine_A Indigo  40.7      22 0.00057   15.8   2.3   48  262-310   136-193 (293)
334 PRK09814 hypothetical protein;  40.6      26 0.00067   15.4   2.9  109   82-202    57-178 (337)
335 PRK06182 short chain dehydroge  40.5      26 0.00067   15.4   5.6   34    1-40      1-34  (273)
336 PRK13934 stationary phase surv  40.3      18 0.00047   16.4   1.9   34   86-119    82-124 (266)
337 KOG3946 consensus               40.3      13 0.00033   17.4   1.1   12  134-145   150-161 (338)
338 TIGR02469 CbiT precorrin-6Y C5  40.2      13 0.00034   17.3   1.1   69  273-342    29-102 (135)
339 cd07369 PydA_Rs_like PydA is a  40.1      27 0.00068   15.3   3.3   31   71-101    29-59  (329)
340 COG2910 Putative NADH-flavin r  40.1      27 0.00068   15.3   6.0   48    4-57      1-55  (211)
341 COG2197 CitB Response regulato  39.7      27 0.00069   15.3   3.6   33  214-246    62-94  (211)
342 PRK06395 phosphoribosylamine--  39.7      27 0.00069   15.3   7.6   88    3-118     2-93  (435)
343 pfam02075 RuvC Crossover junct  39.6      27 0.00069   15.3   5.8   75   71-146    40-129 (148)
344 cd01979 Pchlide_reductase_N Pc  39.5      27  0.0007   15.3   9.1  152   78-250    76-251 (396)
345 cd01149 HutB Hemin binding pro  38.7      26 0.00066   15.4   2.4   40   81-123    51-90  (235)
346 TIGR01465 cobM_cbiF precorrin-  38.6      17 0.00044   16.5   1.5  164  103-304    17-201 (252)
347 PRK00346 surE stationary phase  38.5      19 0.00049   16.3   1.7   10   85-94     79-88  (246)
348 TIGR02468 sucrsPsyn_pln sucros  38.3      28 0.00073   15.1   4.9  239   87-368   381-663 (1072)
349 COG0746 MobA Molybdopterin-gua  38.2      29 0.00073   15.1   5.7  113    1-133     2-128 (192)
350 cd06295 PBP1_CelR Ligand bindi  37.9      29 0.00074   15.1  12.0  134   79-234    55-194 (275)
351 KOG2892 consensus               37.7      29 0.00074   15.1   2.7   76    3-94      4-82  (320)
352 PTZ00117 malate dehydrogenase;  37.7      29 0.00074   15.1   4.2   59  270-335   230-290 (313)
353 COG4245 TerY Uncharacterized p  37.6      29 0.00074   15.1   3.5   13  191-203   107-119 (207)
354 PRK05086 malate dehydrogenase;  37.5      20 0.00051   16.2   1.7   33    4-39      1-35  (312)
355 PRK00286 xseA exodeoxyribonucl  37.5      29 0.00075   15.1   8.1   34  193-233   136-169 (443)
356 PRK13367 protocatechuate 4,5-d  37.5      22 0.00056   15.9   1.9   79   71-157    31-121 (418)
357 PRK13373 putative dioxygenase;  37.4      29 0.00075   15.1   3.4   34   71-104    29-62  (344)
358 cd07373 2A5CPDO_A The alpha su  37.2      30 0.00075   15.0   3.1   31   68-98     22-52  (271)
359 COG2204 AtoC Response regulato  37.0      30 0.00076   15.0   3.3   31   88-118    48-80  (464)
360 cd01853 Toc34_like Toc34-like   36.9      30 0.00076   15.0   2.6   77   19-96     17-122 (249)
361 cd06338 PBP1_ABC_ligand_bindin  36.7      30 0.00077   15.0   4.0   49   78-128    61-111 (345)
362 PRK13370 mhpB 3-(2,3-dihydroxy  36.7      30 0.00077   15.0   3.3   49   56-104     9-58  (313)
363 cd03360 LbH_AT_putative Putati  36.6     8.6 0.00022   18.6  -0.3   46   85-132    53-98  (197)
364 TIGR03407 urea_ABC_UrtA urea A  36.6      30 0.00077   15.0   4.2   54  235-288   255-311 (359)
365 PRK06179 short chain dehydroge  36.4      30 0.00078   15.0   7.7   36    1-41      1-36  (270)
366 TIGR03669 urea_ABC_arch urea A  36.2      31 0.00078   14.9   3.6   42  236-277   254-295 (374)
367 TIGR03570 NeuD_NnaD sugar O-ac  36.1      31 0.00078   14.9   6.7  101    5-132     1-101 (201)
368 TIGR01284 alt_nitrog_alph nitr  36.0      15 0.00038   17.0   0.8   39   63-101   127-180 (468)
369 COG3914 Spy Predicted O-linked  36.0      31 0.00079   14.9  11.1  305   11-363   263-594 (620)
370 cd01825 SGNH_hydrolase_peri1 S  36.0      31 0.00079   14.9   5.9   23   73-95     79-101 (189)
371 PRK07735 NADH dehydrogenase su  35.9      21 0.00053   16.0   1.6   33  138-172   380-412 (420)
372 pfam01973 MAF_flag10 Protein o  35.3      32 0.00081   14.8   3.6   82   23-119    15-98  (169)
373 pfam01993 MTD methylene-5,6,7,  35.2      32 0.00081   14.8   3.6   62    5-95      3-66  (276)
374 pfam09861 DUF2088 Uncharacteri  35.1      32 0.00081   14.8   3.4   57  190-246    53-113 (203)
375 PRK11544 hycI hydrogenase 3 ma  34.9      26 0.00066   15.4   1.9   23   81-103    47-69  (156)
376 cd02876 GH18_SI-CLP Stabilin-1  34.9      32 0.00082   14.8  10.0  117    7-146    44-185 (318)
377 cd06268 PBP1_ABC_transporter_L  34.8      32 0.00082   14.8   4.0   38   83-122    61-98  (298)
378 cd06570 GH20_chitobiase-like_1  34.7      32 0.00082   14.8   4.4   84   73-161    66-157 (311)
379 pfam01975 SurE Survival protei  34.6      25 0.00063   15.5   1.8   21  272-292   103-125 (190)
380 cd02067 B12-binding B12 bindin  34.4      33 0.00083   14.8   3.5   89    8-102     2-93  (119)
381 PRK00232 pdxA 4-hydroxythreoni  34.4      33 0.00083   14.7   7.7  121    1-127     2-165 (334)
382 TIGR00603 rad25 DNA repair hel  34.0      13 0.00032   17.5   0.2   99   78-214   502-603 (756)
383 pfam02603 Hpr_kinase_N HPr Ser  34.0      33 0.00085   14.7   5.0   79   34-119    27-110 (127)
384 KOG1602 consensus               33.9      33 0.00085   14.7   5.5   61  104-167    72-134 (271)
385 COG0496 SurE Predicted acid ph  33.9      23 0.00059   15.7   1.6   33   86-118    81-121 (252)
386 cd01829 SGNH_hydrolase_peri2 S  33.6      34 0.00086   14.7   6.2  115    8-172     3-121 (200)
387 COG0159 TrpA Tryptophan syntha  33.4      34 0.00086   14.6   4.2   44   80-125   114-158 (265)
388 smart00732 YqgFc Likely ribonu  33.2      34 0.00087   14.6   4.7   44   75-119    38-89  (99)
389 COG0800 Eda 2-keto-3-deoxy-6-p  33.1      34 0.00087   14.6   2.4   36   82-119     8-43  (211)
390 cd07365 MhpB_like Subunit B of  32.9      34 0.00088   14.6   3.3   47   56-102     9-56  (310)
391 COG0417 PolB DNA polymerase el  32.8      35 0.00088   14.6   3.8   43   74-118   212-255 (792)
392 cd06315 PBP1_ABC_sugar_binding  32.4      35  0.0009   14.5   4.3   39   78-119    46-86  (280)
393 COG2086 FixA Electron transfer  32.4      35  0.0009   14.5   7.7   93   16-121    39-145 (260)
394 cd06347 PBP1_ABC_ligand_bindin  32.4      35  0.0009   14.5   4.1   43   78-122    57-99  (334)
395 COG2984 ABC-type uncharacteriz  32.1      36 0.00091   14.5   4.6  125   75-237    75-199 (322)
396 PRK12767 carbamoyl phosphate s  31.9      36 0.00091   14.5   9.6   96    4-118     2-99  (325)
397 COG3911 Predicted ATPase [Gene  31.8      29 0.00073   15.1   1.7   27    1-29      6-32  (183)
398 pfam04414 tRNA_deacylase D-ami  31.8      36 0.00092   14.5   3.3   23  202-224    47-70  (214)
399 PRK03562 glutathione-regulated  31.7      36 0.00092   14.5   3.3   96   90-231   400-495 (615)
400 cd01146 FhuD Fe3+-siderophore   31.4      36 0.00093   14.4   2.3   38   81-123    58-95  (256)
401 PRK08621 galactose-6-phosphate  31.4      37 0.00093   14.4   3.4   16   95-110    38-53  (142)
402 PRK11658 UDP-4-amino-4-deoxy-L  31.1      13 0.00033   17.4  -0.1   58   85-149   118-178 (379)
403 PRK10360 DNA-binding transcrip  30.9      37 0.00095   14.4   3.4   13  355-367   171-183 (196)
404 TIGR02360 pbenz_hydroxyl 4-hyd  30.7      38 0.00096   14.3   2.6   23    1-24      1-23  (393)
405 pfam03310 Cauli_DNA-bind Cauli  30.6      38 0.00096   14.3   5.8   27   64-90      9-35  (121)
406 TIGR03446 mycothiol_Mca mycoth  30.5      38 0.00096   14.3   3.9   27   74-100   107-133 (283)
407 TIGR03025 EPS_sugtrans exopoly  30.4      38 0.00097   14.3   6.6   34    5-42    127-160 (445)
408 COG0673 MviM Predicted dehydro  30.3      38 0.00097   14.3   6.7   93    1-118     1-95  (342)
409 cd05785 DNA_polB_like2_exo A s  30.3      38 0.00097   14.3   3.6   42   74-117    59-101 (207)
410 cd06349 PBP1_ABC_ligand_bindin  30.2      38 0.00097   14.3   3.9   40   78-119    57-96  (340)
411 COG4378 Uncharacterized protei  30.1      38 0.00098   14.3   2.3   32   86-119    43-76  (103)
412 cd01833 XynB_like SGNH_hydrola  30.1      38 0.00098   14.3   6.5   21   75-95     64-84  (157)
413 cd06358 PBP1_NHase Type I peri  30.0      38 0.00098   14.3   4.0  155   77-256    56-218 (333)
414 cd06331 PBP1_AmiC_like Type I   29.9      39 0.00099   14.3   4.5   41   77-119    56-96  (333)
415 PRK13372 pcmA protocatechuate   29.7      26 0.00066   15.4   1.2   25   71-95    178-202 (444)
416 PRK05872 short chain dehydroge  29.7      39 0.00099   14.2   6.0   39    5-46     10-48  (296)
417 cd07023 S49_Sppa_N_C Signal pe  29.6      39   0.001   14.2   4.9   76   85-165    31-125 (208)
418 PRK09219 xanthine phosphoribos  29.6      39   0.001   14.2   4.6   45   73-120    35-79  (189)
419 pfam09293 RNaseH_C T4 RNase H,  29.4      39   0.001   14.2   3.8   69  311-381    18-92  (122)
420 PRK09191 two-component respons  29.1      40   0.001   14.2   3.2   94  251-344   137-252 (261)
421 PRK02472 murD UDP-N-acetylmura  29.0      15 0.00038   17.0  -0.1   33   86-122    70-104 (450)
422 COG4607 CeuA ABC-type enteroch  28.8      40   0.001   14.1   2.5  141   66-232    84-258 (320)
423 pfam04223 CitF Citrate lyase,   28.5      37 0.00094   14.4   1.8   61   55-118    40-100 (466)
424 PRK05647 purN phosphoribosylgl  28.5      41   0.001   14.1   3.2  129    1-166     1-141 (200)
425 cd07371 2A5CPDO_AB The alpha a  28.5      41   0.001   14.1   3.2   30   71-100    22-51  (268)
426 PRK11706 TDP-4-oxo-6-deoxy-D-g  28.5      16  0.0004   16.8  -0.1   58   86-149   117-177 (375)
427 COG1184 GCD2 Translation initi  28.4      41   0.001   14.1   6.6   58  240-298   161-236 (301)
428 PRK12827 short chain dehydroge  28.4      41   0.001   14.1   5.1   38    1-41      1-40  (251)
429 COG2039 Pcp Pyrrolidone-carbox  28.4      41   0.001   14.1   2.8   13  281-293   123-135 (207)
430 pfam10566 Glyco_hydro_97 Glyco  28.3      41   0.001   14.1   2.8  173    5-214   251-444 (643)
431 cd01544 PBP1_GalR Ligand-bindi  27.9      42  0.0011   14.0   5.2   28   88-119    52-79  (270)
432 cd00636 TroA-like Helical back  27.9      42  0.0011   14.0   5.0   35   82-120    55-89  (148)
433 PRK00300 gmk guanylate kinase;  27.8      42  0.0011   14.0   4.7   27  214-240   107-133 (208)
434 pfam04084 ORC2 Origin recognit  27.5      42  0.0011   14.0   6.1   95   31-126    54-181 (316)
435 PRK12384 sorbitol-6-phosphate   27.5      42  0.0011   14.0   5.3   39    5-46      3-41  (259)
436 PRK07660 consensus              27.4      29 0.00074   15.1   1.1   35    1-40      1-35  (283)
437 cd01822 Lysophospholipase_L1_l  27.3      43  0.0011   14.0   8.3   53   13-95     17-71  (177)
438 PRK10084 dTDP-glucose 4,6 dehy  27.2      43  0.0011   14.0   4.3   32    4-40      1-32  (352)
439 PRK13896 cobyrinic acid a,c-di  27.1      43  0.0011   14.0   3.4   26    4-29      1-29  (432)
440 PTZ00215 ribose 5-phosphate is  27.1      43  0.0011   13.9   4.1   16   95-110    44-59  (156)
441 pfam09370 TIM-br_sig_trns TIM-  27.0      43  0.0011   13.9   4.1   18   46-63     33-52  (268)
442 PRK13726 conjugal transfer pil  26.8      44  0.0011   13.9   4.8   55  317-371    60-126 (187)
443 cd06359 PBP1_Nba_like Type I p  26.8      44  0.0011   13.9   4.4   43   77-121    54-96  (333)
444 TIGR00515 accD acetyl-CoA carb  26.6      44  0.0011   13.9   3.0   39  323-368   250-290 (292)
445 TIGR02262 benz_CoA_lig benzoat  26.4      44  0.0011   13.9   2.7   12  116-127   262-273 (520)
446 PRK12556 tryptophanyl-tRNA syn  26.2      45  0.0011   13.8   2.5   27    1-28      1-27  (328)
447 cd04509 PBP1_ABC_transporter_G  26.1      45  0.0011   13.8   4.4   45   76-122    55-99  (299)
448 PRK12311 rpsB 30S ribosomal pr  26.1      45  0.0011   13.8   4.7   52   63-118    42-94  (332)
449 TIGR01290 nifB nitrogenase cof  26.1      24 0.00062   15.6   0.6   65   54-124    75-147 (461)
450 TIGR00683 nanA N-acetylneurami  26.1      45  0.0011   13.8   2.2   15  101-115    85-99  (294)
451 cd02065 B12-binding_like B12 b  26.0      45  0.0011   13.8   3.0   19    8-26      2-22  (125)
452 PRK01372 ddl D-alanine--D-alan  26.0      45  0.0012   13.8   8.7   32    3-35      4-40  (304)
453 COG2240 PdxK Pyridoxal/pyridox  26.0      45  0.0012   13.8   3.3   19  213-231    91-109 (281)
454 cd07359 PCA_45_Doxase_B_like S  25.9      45  0.0012   13.8   3.7   33   69-101    25-57  (271)
455 KOG2056 consensus               25.9      45  0.0012   13.8   4.5   97   33-151    31-140 (336)
456 pfam02056 Glyco_hydro_4 Family  25.8      45  0.0012   13.8   7.3   30  207-236   118-147 (183)
457 cd01750 GATase1_CobQ Type 1 gl  25.7      46  0.0012   13.8   2.9   48  156-222    20-70  (194)
458 pfam01041 DegT_DnrJ_EryC1 DegT  25.7      19 0.00048   16.3  -0.1   58   86-149   111-171 (363)
459 pfam08915 tRNA-Thr_ED Archaea-  25.7      25 0.00063   15.5   0.5   67   74-172    56-133 (137)
460 pfam02900 LigB Catalytic LigB   25.4      46  0.0012   13.8   3.2   31   71-101    24-54  (265)
461 PRK12921 2-dehydropantoate 2-r  25.4      46  0.0012   13.8   5.1   52    4-60      1-54  (306)
462 PRK07530 3-hydroxybutyryl-CoA   25.3      35  0.0009   14.5   1.2   33    5-42      6-38  (292)
463 LOAD_surE consensus             25.1      44  0.0011   13.9   1.7   23  271-293   103-127 (192)
464 cd06317 PBP1_ABC_sugar_binding  25.0      47  0.0012   13.7   4.3   84    6-120     2-87  (275)
465 cd06320 PBP1_allose_binding Pe  24.9      47  0.0012   13.7  11.4   40   78-120    47-88  (275)
466 KOG0136 consensus               24.9      47  0.0012   13.7   2.7   60  312-376   458-520 (670)
467 cd06345 PBP1_ABC_ligand_bindin  24.9      47  0.0012   13.7   4.5   44   76-121    55-98  (344)
468 TIGR00689 rpiB_lacA_lacB sugar  24.7      48  0.0012   13.7   3.8   18   94-111    38-55  (146)
469 TIGR01743 purR_Bsub pur operon  24.6      48  0.0012   13.7   3.9   51   65-118   105-155 (269)
470 cd07022 S49_Sppa_36K_type Sign  24.6      48  0.0012   13.7   4.5   79   81-164    35-131 (214)
471 TIGR01513 NAPRTase_put putativ  24.6      48  0.0012   13.7   3.2   27  262-288   163-192 (523)
472 TIGR03588 PseC UDP-4-keto-6-de  24.6      20 0.00052   16.1  -0.1   45   86-132   119-166 (380)
473 cd06336 PBP1_ABC_ligand_bindin  24.5      48  0.0012   13.6   4.1   30   80-110    63-92  (347)
474 PRK11697 putative two-componen  24.5      48  0.0012   13.6   7.8   75    4-119     2-79  (239)
475 PRK13557 histidine kinase; Pro  24.5      48  0.0012   13.6   3.1   95  252-347   414-534 (538)
476 COG3641 PfoR Predicted membran  24.4      20 0.00051   16.2  -0.2   51  274-324   209-261 (348)
477 KOG4184 consensus               24.2      49  0.0012   13.6   3.9   43   74-116   224-273 (478)
478 cd05781 DNA_polB_B3_exo The 3'  24.2      49  0.0012   13.6   3.7   41   74-116    49-90  (188)
479 cd06281 PBP1_LacI_like_5 Ligan  24.2      49  0.0012   13.6   3.3   41   78-120    45-85  (269)
480 cd01967 Nitrogenase_MoFe_alpha  24.1      49  0.0012   13.6  10.8  161   74-250    73-258 (406)
481 TIGR01815 TrpE-clade3 anthrani  24.1      42  0.0011   14.0   1.5   48   50-99    134-190 (726)
482 COG1121 ZnuC ABC-type Mn/Zn tr  24.0      49  0.0013   13.6   4.5   20  253-272   191-210 (254)
483 COG1922 WecG Teichoic acid bio  23.9      49  0.0013   13.6   5.1   61  163-233    81-141 (253)
484 cd01537 PBP1_Repressors_Sugar_  23.7      50  0.0013   13.5  13.5   85    5-120     1-85  (264)
485 COG0167 PyrD Dihydroorotate de  23.6      50  0.0013   13.5   3.0   12   55-66     65-76  (310)
486 COG2129 Predicted phosphoester  23.5      50  0.0013   13.5   2.9   39    1-44      1-41  (226)
487 pfam01513 NAD_kinase ATP-NAD k  23.5      50  0.0013   13.5   4.8   53   66-120    13-65  (243)
488 TIGR02120 GspF general secreti  23.4      20 0.00052   16.1  -0.3   16  341-356   306-321 (414)
489 PRK08507 prephenate dehydrogen  23.2      51  0.0013   13.5   8.4   80    4-110     1-80  (275)
490 TIGR02477 PFKA_PPi diphosphate  23.0      51  0.0013   13.5   7.9  118    2-168    73-204 (566)
491 TIGR01399 hrcV type III secret  23.0      51  0.0013   13.5   2.8   34  321-354   534-570 (709)
492 pfam06050 HGD-D 2-hydroxygluta  23.0      51  0.0013   13.5   4.0   59   75-134   270-337 (345)
493 cd05312 NAD_bind_1_malic_enz N  22.9      51  0.0013   13.4   6.5  118   15-133     5-161 (279)
494 cd06305 PBP1_methylthioribose_  22.9      52  0.0013   13.4   4.6   42   76-120    43-86  (273)
495 PRK05703 flhF flagellar biosyn  22.9      38 0.00097   14.3   1.0   43   61-103   253-302 (412)
496 cd06356 PBP1_Amide_Urea_BP_lik  22.9      52  0.0013   13.4   3.3   75   77-153   176-250 (334)
497 KOG1532 consensus               22.9      52  0.0013   13.4   3.6  125  129-293    29-153 (366)
498 PRK00871 glutathione-regulated  22.8      33 0.00085   14.7   0.7   39   97-145    39-83  (176)
499 KOG2091 consensus               22.8      52  0.0013   13.4   7.8  105   23-143   133-256 (392)
500 cd07366 3MGA_Dioxygenase Subun  22.8      52  0.0013   13.4   3.4   28   68-95     66-93  (328)

No 1  
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed
Probab=100.00  E-value=0  Score=878.30  Aligned_cols=376  Identities=36%  Similarity=0.639  Sum_probs=361.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      +|||||+|||+|||+|||+||++||++ .++++|+|+||++|+++|+++++|+++++||||+||+++++++++.++++++
T Consensus         1 ~mkifi~aGE~SGD~~ga~li~~Lk~~-~~~~~~~GiGG~~M~~~G~~~l~d~~~l~vmG~~evl~~~~~~~~~~~~~~~   79 (382)
T PRK00025          1 PLRIAIVAGEVSGDLLGAGLIRALKAQ-APNLEFVGIGGPRMEAAGFESLFDMEELAVMGLVEVLPRLPRLLKIRKELKR   79 (382)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHH-CCCCEEEEECCHHHHHCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             948999906841889999999999831-9896799988299997699544775783130199999779999999999999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCE
Q ss_conf             10012888689851177657999986630134631111002211003663557999998640156774223200255314
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPT  162 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~  162 (383)
                      .+++++||+||+|||||||+|+||++|+++++||++|||||||||||+||++++++++|+++||||||++||+++ |+++
T Consensus        80 ~i~~~~Pd~vi~ID~pgFnlrlak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~D~ll~ifPFE~~~f~~~-g~~~  158 (382)
T PRK00025         80 LLLAEPPDVFILIDAPDFNLRLAKKLKKALPGIPIIHYVSPSVWAWRPGRAKKIAKATDHVLAILPFEAAFYDKL-GVPV  158 (382)
T ss_pred             HHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHC-CCCC
T ss_conf             998649999999778306599999999716999889994715654064189999999987610876568999865-9981


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHH
Q ss_conf             763882112210013558889761876556505998538743012305111899987640273512620166336-8899
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLV  241 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~  241 (383)
                      +|||||++|.+....++...++++++++++++|++|||||+|||++++|+|+++++.+.+++|+++|++|.+++. ++.+
T Consensus       159 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~i~lLPGSR~~EI~~~lPi~l~a~~~l~~~~p~~~fvip~~~~~~~~~i  238 (382)
T PRK00025        159 TYVGHPLADEIPLEPDRAAARAELGLDPDARVLALLPGSRGSEIKRLLPTFLEAAQLLQQRYPDLRFVVPLANPKRREQF  238 (382)
T ss_pred             EECCCCHHHHCCCCCCHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
T ss_conf             35698156432235687999987399855661787058858999997899999999999878993999955887789999


Q ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-EECCCCCCEEEEHHHCCC
Q ss_conf             9999604888505520552035788763552331156688876275302540577410000-102467610230244078
Q gi|254780767|r  242 RCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-IFYIKTWTCALPNLIVDY  320 (383)
Q Consensus       242 ~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~~lik~~~i~LpNii~~~  320 (383)
                      +..+..++.+..+.+..++++++|++||+|++||||||||+|++|+||||+||+||+||++ +++++++|+||||||+|+
T Consensus       239 ~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~~~P~Vv~Yk~~~lt~~i~k~lvkv~~isL~Nii~~k  318 (382)
T PRK00025        239 EQLLAEYAPDLSVTLLDGQAREAMAAADAALAASGTVTLEAALLGVPMVVGYKVKPLTFWIAKRLVKVPYISLPNLLAGE  318 (382)
T ss_pred             HHHHHHCCCCCCEEEECCCCHHHHHHCCEEEECCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEHHHHHCCC
T ss_conf             99998479998389826841778873888765377799999997198589980789999999996569976524875499


Q ss_pred             CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             42612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  321 PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       321 ~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      +++|||+|++|||++|++++.++++|+++|++|+++++++++.|+ +| ++++||+.|+++|
T Consensus       319 ~ivPEllQ~~~~~~~i~~~~~~ll~d~~~~~~~~~~~~~lr~~L~-~g-as~raA~~Il~~l  378 (382)
T PRK00025        319 ELVPELLQEEATPEKLARALLELLADGARRQALLEGFTELHQYLR-CG-AAERAAQAVLELL  378 (382)
T ss_pred             CCCHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC-CC-HHHHHHHHHHHHH
T ss_conf             766134056699999999999996699999999999999999857-89-9999999999999


No 2  
>pfam02684 LpxB Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyse the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <= UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyse the fist disaccharide step in the synthesis of lipid-A-disaccharide.
Probab=100.00  E-value=0  Score=852.94  Aligned_cols=369  Identities=31%  Similarity=0.512  Sum_probs=344.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99997682147899999999997389983999971789994788065044453110136746645999999999986100
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIV   85 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~   85 (383)
                      |||+|||+|||+|||+||++||++ .++++|+|+||++|+++|+++++|+++++||||+||+++++++++.++++++.++
T Consensus         1 Ifi~aGE~SGD~~ga~Li~~Lk~~-~p~i~~~GvGG~~M~~~G~~~l~d~~~lsvmG~~evl~~l~~l~~~~~~~~~~i~   79 (373)
T pfam02684         1 IFLSAGEASGDILGGELIQNLKEH-YPNLRFIGVGGPKMEAEGFESLANMEEISVMGFIEVLGRLFKLLKIYQKVVKNIL   79 (373)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             989935851899999999999830-9894899988089997799534772784140199999899999999999999874


Q ss_pred             CCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEEC
Q ss_conf             12888689851177657999986630134631111002211003663557999998640156774223200255314763
Q gi|254780767|r   86 SSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFV  165 (383)
Q Consensus        86 ~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fV  165 (383)
                      +++||++|+|||||||+|+||++|+++.++|++|||||||||||+||++++++++|+|+||||||++||++. |++++||
T Consensus        80 ~~~PD~vIlID~pgFNlrlak~lkk~g~~ipvi~yV~PqvWAWr~~R~k~i~~~~D~ll~IfPFE~~~y~~~-gv~~~fV  158 (373)
T pfam02684        80 KKKPDTLILIDAPDFNLRLAKKLRKLGPKLKIIHYVSPSVWAWRPKRAKIIAKYTDLLLAILPFEKGFFQKF-GLDCRYV  158 (373)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCEEEECHHHHHHHHHHHHHHCCCCCCCHHHHHHH-CCCEEEC
T ss_conf             269988999717615599999999719998789996884221271589999999987312898878999860-9971575


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHHHHH
Q ss_conf             882112210013558889761876556505998538743012305111899987640273512620166336-8899999
Q gi|254780767|r  166 GHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLVRCI  244 (383)
Q Consensus       166 GHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~~~~  244 (383)
                      |||++|.+....+....++ ....+++++|++|||||+|||++++|+|+++++++.+++|+++|++|.+++. ++.++..
T Consensus       159 GHPl~d~~~~~~~~~~~~~-~~~~~~~~~i~lLPGSR~~EI~~~lPi~l~aa~~l~~~~~~~~~~ip~~~~~~~~~~~~~  237 (373)
T pfam02684       159 GHPLLDEIKLYKKRASAKE-LLIDHDEPILALLPGSRKGEIRRLLPPIQVAAQQLSSQFPNLKLLVPLVNKKYEEQIEDT  237 (373)
T ss_pred             CCCHHHHHCCCCCHHHHHH-HCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHH
T ss_conf             9811654013776589997-468987755776788869999999999999999999768991899965887899999999


Q ss_pred             HHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-EECCCCCCEEEEHHHCCCCCC
Q ss_conf             9604888505520552035788763552331156688876275302540577410000-102467610230244078426
Q gi|254780767|r  245 VSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-IFYIKTWTCALPNLIVDYPLV  323 (383)
Q Consensus       245 ~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~~lik~~~i~LpNii~~~~iv  323 (383)
                      ...+..+..+....++++++|++||+|++||||||||+|++|+||||+||+||+||++ +++++++|+||||||+|++++
T Consensus       238 ~~~~~~~~~i~~~~~~~~~~~~~sd~al~~SGTaTLE~al~~~P~vV~Yk~~~lty~i~k~lvkv~~isL~Nii~~k~iv  317 (373)
T pfam02684       238 LALENCDVSLLEISGERYEAMFAADAALAKSGTATLEAALAGTPMVVAYRVKPLTFFLAKRLVKIDYISLPNIILNREIV  317 (373)
T ss_pred             HHHCCCCCCEEECCCCHHHHHHHCCEEEECCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCEEEHHHHHCCCCCC
T ss_conf             98649998789805724999984865012167699999981999899995778999999999838954434886699867


Q ss_pred             CHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHH
Q ss_conf             12420548989999999998449899999999999999983899-9989999999
Q gi|254780767|r  324 PEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTK-KPAGHMAAEI  377 (383)
Q Consensus       324 PEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~-~~a~~~AA~~  377 (383)
                      |||+|++|||++|+.++.++|+|+++|++|++++++++++||.+ ++++++||.+
T Consensus       318 PEllQ~~~t~~~ia~~~~~lL~d~~~~~~~~~~~~~~~~~l~~g~~~~~~~aa~~  372 (373)
T pfam02684       318 PEFIQGECDAHLEAIALLLLLLNGLKAKKQKDRCRKFKQLLRFGQCNSDEQAALI  372 (373)
T ss_pred             HHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             3564751789999999999967999999999999999999856899988977753


No 3  
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=815.01  Aligned_cols=377  Identities=40%  Similarity=0.652  Sum_probs=360.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      .||||+||||+|||+||+.|+++||++++ +++|.|+||++|+++|++++||++++++|||+|||+++|++++.++++++
T Consensus         1 ~~ki~i~AGE~SGDllGa~LikaLk~~~~-~~efvGvgG~~m~aeG~~sl~~~~elsvmGf~EVL~~lp~llk~~~~~~~   79 (381)
T COG0763           1 MLKIALSAGEASGDLLGAGLIKALKARYP-DVEFVGVGGEKMEAEGLESLFDMEELSVMGFVEVLGRLPRLLKIRRELVR   79 (381)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCC-CEEEEEECCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             94599990444311468999999986389-83899817678886557655588998782299999988999999999999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCE
Q ss_conf             10012888689851177657999986630134631111002211003663557999998640156774223200255314
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPT  162 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~  162 (383)
                      .+..++||++|+|||||||+++||++|+.++++|+||||||||||||++|+.++.+++|+++||||||++||++. |++|
T Consensus        80 ~i~~~kpD~~i~IDsPdFnl~vak~lrk~~p~i~iihYV~PsVWAWr~~Ra~~i~~~~D~lLailPFE~~~y~k~-g~~~  158 (381)
T COG0763          80 YILANKPDVLILIDSPDFNLRVAKKLRKAGPKIKIIHYVSPSVWAWRPKRAVKIAKYVDHLLAILPFEPAFYDKF-GLPC  158 (381)
T ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCEEEEECCCEEEECHHHHHHHHHHHHHEEEECCCCHHHHHHC-CCCE
T ss_conf             998559988999678988649999999708999869997853056552168999997617214367788999855-9970


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHH
Q ss_conf             76388211221001355888976187655650599853874301230511189998764027351262016633688999
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVR  242 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~  242 (383)
                      +|||||++|.+....+++..+++++++.+.+++++|||||+|||++++|+|.++++.+++++|+++|++|+++...+.+.
T Consensus       159 ~yVGHpl~d~i~~~~~r~~ar~~l~~~~~~~~lalLPGSR~sEI~rl~~~f~~a~~~l~~~~~~~~~vlp~~~~~~~~~~  238 (381)
T COG0763         159 TYVGHPLADEIPLLPDREAAREKLGIDADEKTLALLPGSRRSEIRRLLPPFVQAAQELKARYPDLKFVLPLVNAKYRRII  238 (381)
T ss_pred             EEECCHHHHHCCCCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHH
T ss_conf             89678056423443457899998289977876998168858899987789999999998658996599956847889999


Q ss_pred             HHHHHCCC-CCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-EECCCCCCEEEEHHHCCC
Q ss_conf             99960488-8505520552035788763552331156688876275302540577410000-102467610230244078
Q gi|254780767|r  243 CIVSKWDI-SPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-IFYIKTWTCALPNLIVDY  320 (383)
Q Consensus       243 ~~~~~~~~-~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~~lik~~~i~LpNii~~~  320 (383)
                      ....++.. ..++++.+++++++|.+||+|++||||||||+|++|+||||.||++|+||++ ++++|++|+|||||++|+
T Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~a~~~aD~al~aSGT~tLE~aL~g~P~Vv~Yk~~~it~~iak~lvk~~yisLpNIi~~~  318 (381)
T COG0763         239 EEALKWEVAGLSLILIDGEKRKAFAAADAALAASGTATLEAALAGTPMVVAYKVKPITYFIAKRLVKLPYVSLPNILAGR  318 (381)
T ss_pred             HHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCHHHHCCC
T ss_conf             99862334576078407457899998418998446799999982999799994458899999986167724436886187


Q ss_pred             CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             42612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  321 PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       321 ~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      +++|||+|++|+|++|++++..++.|+..|+++.+.++++++.++.. +++++||+++++++
T Consensus       319 ~ivPEliq~~~~pe~la~~l~~ll~~~~~~~~~~~~~~~l~~~l~~~-~~~e~aA~~vl~~~  379 (381)
T COG0763         319 EIVPELIQEDCTPENLARALEELLLNGDRREALKEKFRELHQYLRED-PASEIAAQAVLELL  379 (381)
T ss_pred             CCCHHHHHHHCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHH
T ss_conf             30467775316999999999998348676999999999999997589-68899999999874


No 4  
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed
Probab=100.00  E-value=0  Score=805.15  Aligned_cols=372  Identities=26%  Similarity=0.462  Sum_probs=336.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999768214789999999999738998399997178999478806504445311013674664599999999998610
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELI   84 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i   84 (383)
                      ..||+|||+|||+|||+||++||++. ||++|.|+||++|+++|+++++||++++||||+||++|+|++++.++++++.+
T Consensus       228 ~~FI~AGE~SGD~lGa~Li~~Lk~~~-P~i~F~GVGGp~M~~eGl~slf~me~lsVMG~~EVL~~lp~L~~~~~~l~~~i  306 (607)
T PRK01021        228 SCFLSAGEASGDTLGGNLLKEIKALY-PDIRCFGVGGPQMRQEGLEPLFNMEEFQVSGFWEVLLSLFKLYYRYRKLYKTI  306 (607)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHC-CCCEEEECCHHHHHHCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             75799268625577999999998549-89889963779998768861244677101148999988999999999999999


Q ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEE
Q ss_conf             01288868985117765799998663013463111100221100366355799999864015677422320025531476
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTF  164 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~f  164 (383)
                      .+++||++|+|||||||+|+||++|+++.++|++|||||||||||++|+|++++++|+++||||||++||++ +|++++|
T Consensus       307 ~~~~PD~~I~ID~PdFNlrlak~lkk~gi~ik~vhYVsPsVWAWr~~R~k~i~~~vD~~l~lfPFE~~~~~~-~g~~~~y  385 (607)
T PRK01021        307 LKENPETVICIDFPDFHFLLIKKLRKCGYKGKIIHYVCPSIWAWRPKRKTILEKYLDLLLLILPFEQGLFKN-SPLRTVY  385 (607)
T ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHCCCCCCEEEEECCCEEEECCCHHHHHHHHHHHHEECCCCCHHHHHC-CCCCCEE
T ss_conf             861999999958998788999999972899986899788368866217999999886730526778899950-7998379


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC-CCHHHHHHH
Q ss_conf             3882112210013558889761876556505998538743012305111899987640273512620166-336889999
Q gi|254780767|r  165 VGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV-SSQENLVRC  243 (383)
Q Consensus       165 VGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~-~~~~~~~~~  243 (383)
                      ||||++|.+....+....++++ .++++++|++|||||+|||++++|+|.+++....... ..+++++.+ +...+.+.+
T Consensus       386 VGHPl~e~i~~~~~~~~~r~~l-~~~~k~IIALLPGSR~SEI~RlLPI~~~ai~~~~l~~-~~~~lV~~a~p~~~~~i~e  463 (607)
T PRK01021        386 LGHPLVETISNFQPCASWKEQL-LPSDKPIVAAFPGSRRGDILRNLTIQVQAFLASSLAQ-THQLLVSSANPKYDHLILD  463 (607)
T ss_pred             ECCCCHHHCCCCCCCHHHHHHC-CCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHCCC-CCEEEEECCCHHHHHHHHH
T ss_conf             7896012022347745699861-7788988999089978999987499999999872446-7649995687668899999


Q ss_pred             HHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEE-ECCCC--CCEEEEHHHCCC
Q ss_conf             996048885055205520357887635523311566888762753025405774100001-02467--610230244078
Q gi|254780767|r  244 IVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFI-FYIKT--WTCALPNLIVDY  320 (383)
Q Consensus       244 ~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~-~lik~--~~i~LpNii~~~  320 (383)
                      ..+.++.....++..+.++++|++||+|+++|||||||+|++++||||+||++++||+++ +++|+  +|+||||||+|+
T Consensus       464 ~l~~~~~~~~~II~~~~kyeam~aSDaALaASGTATLE~ALagvPmVVaYKlnpLTyfIAK~LvKI~lp~vsLPNILagr  543 (607)
T PRK01021        464 VLQQEGCLHSKIVPSQFRYELMRECDCALAKCGTIVLETALNQTPTIVTCQLRPFDTFLAKYIFKILLPAYSLPNIILGS  543 (607)
T ss_pred             HHHHCCCCCCEECCCHHHHHHHHHCCEEEECCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCHHHCCC
T ss_conf             99864898845717325899998588998887789999998388989999678279999999997257512113011699


Q ss_pred             CCCCHHH--CCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             4261242--054898999999999844989999999999999998389999899999999986
Q gi|254780767|r  321 PLVPEYF--NSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQV  381 (383)
Q Consensus       321 ~ivPEli--Q~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~  381 (383)
                      +||||||  |+|||||+|+.++ .+|+|++.|++|+++|+++.+-+.++..+++-.-+.|.+.
T Consensus       544 ~VVPElI~gQ~D~~PE~iAaAl-~lL~~p~~~ekq~~~c~~~~~~~~~~~~~~~e~~~~~~~~  605 (607)
T PRK01021        544 VIFPEFIGGKKDFHPEEVAAAL-DILKTSQSKEKQKEACRDLYKAMTTSAITSKECLKRIFET  605 (607)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHH-HHHHCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             8666636776658989999999-9871915679999999999999871788789999999863


No 5  
>TIGR00215 lpxB lipid-A-disaccharide synthase; InterPro: IPR003835   The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (2.4.1.- from EC) and related proteins into distinct sequence based families has been described . This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site . The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.   These enzymes belong to the glycosyltransferase family 19 GT19 from CAZY. Lipid-A-disaccharide synthetase 2.4.1.182 from EC is involved with acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase 2.3.1.129 from EC and tetraacyldisaccharide 4'-kinase 2.7.1.130 from EC in the biosynthesis of the phosphorylated glycolipid, lipid A, in the outer membrane of Escherichia coli and other bacteria. These enzymes catalyse the first disaccharide step in the synthesis of lipid-A-disaccharide.; GO: 0008915 lipid-A-disaccharide synthase activity, 0009245 lipid A biosynthetic process.
Probab=100.00  E-value=0  Score=390.71  Aligned_cols=375  Identities=31%  Similarity=0.494  Sum_probs=341.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      +..+.+++||.|||++++.+.+.+++.. ++.++.|++|++|.++|++.+++..+++++|+.|++.+++.+.+...++.+
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~g~~g~~~~~~g~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~   84 (393)
T TIGR00215         6 PLTIALVAGELSGDLLGGGLRRQLPEHY-PNARFVGLGGPRLAAEGCELLYDPEELGVLGLTEVLGRLGPLLKIRKELVQ   84 (393)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0123221200001467889988645321-220100023313454124555203566554378888777888888889998


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCC--CCCHHHHHHHHHHHCCCCCCCHHHHHCCCCC
Q ss_conf             10012888689851177657999986630134631111002211003--6635579999986401567742232002553
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWR--EGRARKMCAYINQVISILPFEKEVMQRLGGP  160 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr--~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~  160 (383)
                      .....+||+.+.+|+|+||+.++..+++..+++|++||++|++|+|+  +||++++.+++|.++.++|||..||++. +.
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~w~w~p~~~~~~~~~~~~~~~~~~~p~~~~~~~~~-~~  163 (393)
T TIGR00215        85 LLKQAPPDLLVGIDAPDFNLTLANELKKKDPGLKTLYYVSPSVWAWRPTKWRAKKLGKATDLLLAFLPFEKGFYDKK-GL  163 (393)
T ss_pred             HHHHCCCEEEEECCCCCCCCHHHHHHHHCCCCCCEEEEECCCHHCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHH-CC
T ss_conf             75304630255403467650123232200477514444333001025026788888887767765401034454420-67


Q ss_pred             CEEECCCCCCCCCCCC-CCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHH
Q ss_conf             1476388211221001-355888976187655650599853874301230511189998764027351262016633688
Q gi|254780767|r  161 PTTFVGHPLSSSPSIL-EVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQEN  239 (383)
Q Consensus       161 ~~~fVGHPl~d~~~~~-~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~  239 (383)
                      ++.|+|||+.|.+... .+....++..+++.+...+.++||||.+|+....|.++.++..+.+..|+.+++++.......
T Consensus       164 ~~~~~g~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  243 (393)
T TIGR00215       164 PCRFVGHPLLDAIPLEKPDRGSAREKLGIDHNGETLALLPGSRGSELEYLLPLFLKAAQLLEEQLPDLKLLLPLPNKKRG  243 (393)
T ss_pred             CEEECCCHHHHHHHHCCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHH
T ss_conf             50220422454432103312334565168866636888306412578887688766888876414752122220001221


Q ss_pred             -HHHHHHHHCCCCCEEEEECCCCHH-HHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEE-ECCCCC--CEEEE
Q ss_conf             -999999604888505520552035-7887635523311566888762753025405774100001-024676--10230
Q gi|254780767|r  240 -LVRCIVSKWDISPEIIIDKEQKKQ-VFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFI-FYIKTW--TCALP  314 (383)
Q Consensus       240 -~~~~~~~~~~~~~~i~~~~~~~~~-~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~-~lik~~--~i~Lp  314 (383)
                       .+......+.-+..+....++... .+..+|+++.+|||+++|++++++|+++.|+..++++++. ++++..  |++++
T Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~p~~~~~  323 (393)
T TIGR00215       244 LQFERLKAEFGPDLTLHLLDGDARLTALVAADLALLASGTAALEAALLGTPFVLGYRVKPLTFLLARRLVKLDLPYVSLP  323 (393)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             35788888634663135422420234565543455421224566766337411010111578999888875226633213


Q ss_pred             HHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCH----HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             244078426124205489899999999984498----999999999999999838999989999999998
Q gi|254780767|r  315 NLIVDYPLVPEYFNSMIRSEALVRWIERLSQDT----LQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       315 Nii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~----~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      |++.++.+.||.+|++|+++.++.....++.+.    +.+......+.+++..++.++...+. +..+++
T Consensus       324 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  392 (393)
T TIGR00215       324 NLLANRGLVPELLQEECTPEPLAEALLLLLLNGLKAYKESHKLAQDFEELRERLGCPGDCERA-AQAVLE  392 (393)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH-HHHHHC
T ss_conf             566532200123211223567888878876312556667788888888898875056303567-777632


No 6  
>TIGR03492 conserved hypothetical protein. This protein family is restricted to the Cyanobacteria, in one or two copies, save for instances in the genus Deinococcus. This protein shows some sequence similarity, especially toward the C-terminus, to lipid-A-disaccharide synthase (TIGR00215 or pfam02684). The function is unknown.
Probab=100.00  E-value=0  Score=338.83  Aligned_cols=339  Identities=20%  Similarity=0.216  Sum_probs=258.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE----CCHHHHHCCCEEEECHHHCCEEEHH---------HHHHHHHHH
Q ss_conf             999768214789999999999738998399997----1789994788065044453110136---------746645999
Q gi|254780767|r    7 AVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV----GGPSLQKEGLVSLFDFSELSVIGIM---------QVVRHLPQF   73 (383)
Q Consensus         7 ~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi----GG~~m~~~G~~~~~~~~~l~v~G~~---------evl~~~~~~   73 (383)
                      |||-|.-. |+||++++++|++. .|+.++.++    +|..|+++|+..+.+.+++++.||+         |+..-+..+
T Consensus         2 ~lSNGhGE-Dl~a~~i~~~L~~~-~p~~~v~alPLVG~G~ay~~~gi~iig~~~~lpSGGf~~~~~~~l~~Dl~~Gl~~~   79 (396)
T TIGR03492         2 FLSNGHGE-DLIAARIAKALLQL-SPDLNLEALPLVGEGRAYQNLGIPIIGPTKELPSGGFSYQSLRGLLRDLRAGLVGL   79 (396)
T ss_pred             CCCCCCHH-HHHHHHHHHHHHHH-CCCCCEEEECCCCCCHHHHHCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             40676358-89999999999962-99996698513478499997899487466435774622436778999997036999


Q ss_pred             -HHHHHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECC---CCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             -9999999861001288868985-1177657999986630134631111002---2110036635579999986401567
Q gi|254780767|r   74 -IFRINQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCP---SVWAWREGRARKMCAYINQVISILP  148 (383)
Q Consensus        74 -~~~~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~P---qvWAWr~~R~k~~~~~~d~~~~ifp  148 (383)
                       ++....+.++  ..+.|.++.| |.  +.+.+|...     |.|.++|..|   .+|+|+++|...........-+.+|
T Consensus        80 ~~~q~~~~~~~--~~~~~~ilavGD~--~pl~~A~~s-----g~p~~~~~~~~S~yy~~~~~~~~~~~~~~~~~g~~~~P  150 (396)
T TIGR03492        80 TLGQWRALRKW--AKKGDLIVAVGDI--VPLLFAWLS-----GKPYAFVGTAKSDYYWESGPRRSPSDEYHRLEGSLYLP  150 (396)
T ss_pred             HHHHHHHHHHH--CCCCCEEEEECCH--HHHHHHHHC-----CCCCEEEEECCCCEEEECCCCCCCHHHHHCCCEEECCH
T ss_conf             99999999985--4458879996671--888999981-----89816997045323660687753012332155178167


Q ss_pred             CCHH-------------------HHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHH
Q ss_conf             7422-------------------320025531476388211221001355888976187655650599853874301230
Q gi|254780767|r  149 FEKE-------------------VMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKI  209 (383)
Q Consensus       149 FE~~-------------------~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~  209 (383)
                      ||..                   .+++ +|++++|+|||++|......       ...+.++.+.|+||||||.+|+.+|
T Consensus       151 we~~lm~~~rc~~Vf~RD~lTA~~L~~-~gi~a~f~GnPmMD~l~~~~-------~~~~~~~~~~I~LLPGSR~pEa~~n  222 (396)
T TIGR03492       151 WERWLMRSRRCLAVFVRDRLTARDLRR-QGVRASYLGNPMMDGLEPPE-------RKPLLTGRFRIALLPGSRPPEAYRN  222 (396)
T ss_pred             HHHHHHCCCCCCEEECCCHHHHHHHHH-CCCCEEEECCCHHCCCCCCC-------CCCCCCCCCEEEEECCCCHHHHHHH
T ss_conf             799974096652995055887999997-79964960873413788888-------7667887867999589885999987


Q ss_pred             CCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHHHHHHHHCC----------------CCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             5111899987640273512620166336-889999996048----------------88505520552035788763552
Q gi|254780767|r  210 LPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLVRCIVSKWD----------------ISPEIIIDKEQKKQVFMTCNAAM  272 (383)
Q Consensus       210 lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~~~~~~~~~----------------~~~~i~~~~~~~~~~l~~sd~ai  272 (383)
                      +|.|++++..+.+..| ++|.++.+++. ...+...+...+                .+..+.+..+..+++++.||++|
T Consensus       223 l~~~L~a~~~l~~~~~-~~f~~alap~l~~~~l~~~l~~~Gw~~~~~~~~~~~~~~~~~~~v~~~~~~f~~~l~~adl~i  301 (396)
T TIGR03492       223 LKLLLRALEALPDSQP-FVFLAAIVPSLSLEKLQAILEDLGWQLEGSSEDQTSLFQKGTLEVLLGRGAFAEILHWADLGI  301 (396)
T ss_pred             HHHHHHHHHHHCCCCC-EEEEEEECCCCCHHHHHHHHHHCCCEECCCCCCCCHHEECCCEEEEEECCCHHHHHHHCHHHH
T ss_conf             9999999996341488-699998689999899999999659700578654200010487689997384899998551144


Q ss_pred             CCCHHHHHHHHHHCCCEEEECCCCC-CEEEEEE-CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHH
Q ss_conf             3311566888762753025405774-1000010-2467610230244078426124205489899999999984498999
Q gi|254780767|r  273 AASGTVILELALCGIPVVSIYKSEW-IVNFFIF-YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQR  350 (383)
Q Consensus       273 ~~SGTaTLE~al~g~P~IV~Yk~~~-lt~~i~~-lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r  350 (383)
                      ++|||||+|++.+|+|+|++|..++ +|+.+++ -.+         ++|..+.+    .+.+|+++++.+..++.|++++
T Consensus       302 a~AGTAteQ~vgLG~Pvv~l~g~GPQfT~~fA~~Q~R---------LLG~sv~~----~~~~p~~ia~~~~~lL~d~~~~  368 (396)
T TIGR03492       302 AMAGTATEQAVGLGKPVIQLPGKGPQFTYGFAEAQSR---------LLGGSVFL----ASKNPEQAAQVVRQLLADPELL  368 (396)
T ss_pred             HCCCCHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH---------HCCCEEEE----CCCCHHHHHHHHHHHHCCHHHH
T ss_conf             4377099999871898799727872777999999998---------62753352----6899999999999985499999


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             99999999999983899998999999999861
Q gi|254780767|r  351 RAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       351 ~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      +++.   ++.+++||.+|++ +++|+.|++.|
T Consensus       369 ~~~~---~~gr~RlG~~Gas-~RiA~~il~~L  396 (396)
T TIGR03492       369 ERCR---RNGQERMGPPGAS-ARIAESILKQL  396 (396)
T ss_pred             HHHH---HHHHHHCCCCCHH-HHHHHHHHHHC
T ss_conf             9999---9999855886588-99999999519


No 7  
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional
Probab=99.96  E-value=2.2e-26  Score=194.07  Aligned_cols=340  Identities=15%  Similarity=0.205  Sum_probs=229.9

Q ss_pred             EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHH-HHHCCCE-EEECHHHCCEEEH-----HHHHHHHHHHHHH
Q ss_conf             5999976821478999-99999997389983999971789-9947880-6504445311013-----6746645999999
Q gi|254780767|r    5 KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPS-LQKEGLV-SLFDFSELSVIGI-----MQVVRHLPQFIFR   76 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~-m~~~G~~-~~~~~~~l~v~G~-----~evl~~~~~~~~~   76 (383)
                      ||+|++|.+.|+++.| .+.++|+++   +.++..+|..+ |++.-+. .-+++..+.+.|+     +.-++...++.+.
T Consensus         3 kI~i~~GGTGGHi~Palala~~L~~~---g~ev~~ig~~~g~E~~~v~~~~~~~~~i~~~~~~~~~~~~~~~~~~~l~~~   79 (359)
T PRK00726          3 KILLAGGGTGGHVFPALALAEELKKR---GWEVLWLGTKRGMEARLVPKAGIEFHFIPIGGLRRKGSLANLKAPFKLLKG   79 (359)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHC---CCEEEEEECCCHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             89999588689999999999999838---798999978826865404414983899777888987879999999999999


Q ss_pred             HHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCH-HHHHHHHHHHCCCCCCCHHHH
Q ss_conf             9999861001288868985-11776579999866301346311110022110036635-579999986401567742232
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRA-RKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~-k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      +.+....+++++||+||+. .|+.|=.-+|.++.    ++|++-.= ...   -.||+ |.+.++.|.+++-||--..+|
T Consensus        80 ~~~~~~il~~~kPd~Vig~GGY~s~P~~laA~l~----~iP~iiHE-qN~---v~G~aNr~l~~~a~~i~~~f~~~~~~~  151 (359)
T PRK00726         80 VLQARKILKRFKPDVVVGFGGYVSGPAGLAARLL----GIPLVIHE-QNA---VPGLANKLLARFAKKVATAFEETPKAF  151 (359)
T ss_pred             HHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHC----CCCEEEEC-CCC---CCCCCHHHHHHHCCEEEECCHHHHHCC
T ss_conf             9999999997499999978974128999999982----99869974-542---356233788885097899775554037


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      .+   .++.++|+|+..++....... .   ....++.++|+++.||..++.-+  ..+.+++..+.++ .+++++..+.
T Consensus       152 ~~---~k~~~~G~PvR~~~~~~~~~~-~---~~~~~~~~~iLV~GGSqGa~~~N--~~v~~~l~~l~~~-~~~~i~~~~G  221 (359)
T PRK00726        152 PK---AKAVVTGNPVREEILALPAPA-F---RLAGRGPPTLLVVGGSQGARVLN--EAVPEALALLPEE-LRIQVIHQTG  221 (359)
T ss_pred             CC---CCEEEECCCCCHHHHCCCHHH-H---HHCCCCCCEEEEECCCCHHHHHH--HHHHHHHHHHHHC-CCEEEEEECC
T ss_conf             62---455996784027766143333-3---21047885799976852047899--9999999987652-5908999828


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEE-CCC--CCCEEEEEE-CCCCC
Q ss_conf             3368899999960488850552055203578876355233115668-887627530254-057--741000010-24676
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSI-YKS--EWIVNFFIF-YIKTW  309 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~-Yk~--~~lt~~i~~-lik~~  309 (383)
                      +...+.++..+.+.+.+..+.-..++..++|+.||++|+.||..|+ |++.+|+|+|++ |.-  .--.+.-++ +.+..
T Consensus       222 ~~~~~~~~~~~~~~~~~~~v~~f~~~m~~~~~~aDlvIsRaGa~Ti~E~~~~g~P~IlIP~p~a~~~HQ~~NA~~l~~~g  301 (359)
T PRK00726        222 KKDLEEVRAAYAELGVNAEVVPFIDDMAAAYAAADLVICRAGASTVAELAAAGLPAILVPLPHAADDHQTANARALVDAG  301 (359)
T ss_pred             CCHHHHHHHHHHHCCCCEEECCCCCHHHHHHHCCCEEEECCCCCHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             40399999999865997697575231899874088999889832699999828986998368777538999999999789


Q ss_pred             CEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             1023024407842612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  310 TCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       310 ~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      . +        .++   -|++++++.+.+.+.++++|++.+++|.++.+    .++.+.++.+ -++.|.++.
T Consensus       302 a-a--------~~i---~e~~~~~~~L~~~i~~ll~d~~~l~~m~~~~~----~~~~~~a~~~-i~~~i~~~~  357 (359)
T PRK00726        302 A-A--------KLI---PQSDLTPERLAEALLELLSDRERLEAMAEAAR----ALGIPDAAER-LADLIEKLA  357 (359)
T ss_pred             C-E--------EEE---ECCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH----CCCCCCHHHH-HHHHHHHHH
T ss_conf             9-9--------995---31469999999999999869999999999997----2489789999-999999985


No 8  
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology.  The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
Probab=99.94  E-value=9e-25  Score=183.42  Aligned_cols=333  Identities=16%  Similarity=0.213  Sum_probs=219.8

Q ss_pred             EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHH-HHHCCCEEE-ECHHHCCEEE-----HHHHHHHHHHHHHH
Q ss_conf             5999976821478999-99999997389983999971789-994788065-0444531101-----36746645999999
Q gi|254780767|r    5 KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPS-LQKEGLVSL-FDFSELSVIG-----IMQVVRHLPQFIFR   76 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~-m~~~G~~~~-~~~~~l~v~G-----~~evl~~~~~~~~~   76 (383)
                      ||+|+||.+.|+++.+ .+.++|+++ +.  ++..+|.++ |+..-+... +++..+...|     .+.-+..+.++...
T Consensus         1 ki~i~~GGTGGHi~Palala~~L~~~-g~--~V~~i~~~~g~e~~~~~~~g~~~~~i~~~~~~~~~~~~~~~~~~~~~~~   77 (350)
T cd03785           1 RILIAGGGTGGHIFPALALAEELRER-GA--EVLFLGTKRGLEARLVPKAGIPLHTIPVGGLRRKGSLKKLKAPFKLLKG   77 (350)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHC-CC--EEEEEECCCHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             98999478589999999999999978-79--8999987836864234413994899768887888739999999999999


Q ss_pred             HHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCH-HHHHHHHHHHCCCCCCCHHHH
Q ss_conf             9999861001288868985-11776579999866301346311110022110036635-579999986401567742232
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRA-RKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~-k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      ..+....+++++||+||+. -|+.|=.-+|.++.    +||++-. -...+   .+|+ |.+.++.|.+++-||-..+++
T Consensus        78 ~~~~~~~l~~~kPd~vi~~GGY~s~P~~laA~~~----~iP~~ih-EqN~v---~G~anr~l~~~a~~i~~~f~~~~~~~  149 (350)
T cd03785          78 VLQARKILKKFKPDVVVGFGGYVSGPVGLAAKLL----GIPLVIH-EQNAV---PGLANRLLARFADRVALSFPETAKYF  149 (350)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHC----CCCCEEE-CCCCC---CCHHHHHHCCCCCEEEECCHHHHHCC
T ss_conf             9999999996499999988981038999999972----9985565-67722---57132332100398998575654124


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      .   +-++.|||+|+.+++....   ......+.+++.++|+++.||..+..-+  ..+.+++..+.+  .+++++..+.
T Consensus       150 ~---~~k~~~vG~PvR~~~~~~~---~~~~~~~~~~~~~~iLv~GGSqGa~~ln--~~v~~~~~~l~~--~~~~ii~~~G  219 (350)
T cd03785         150 P---KDKAVVTGNPVREEILALD---RERARLGLRPGKPTLLVFGGSQGARAIN--EAVPEALAELLR--KRLQVIHQTG  219 (350)
T ss_pred             C---CCCEEEECCCCCHHHHCCC---HHHHHCCCCCCCEEEEEECCCCHHHHHH--HHHHHHHHHHHH--CCCEEEEECC
T ss_conf             6---6777996885226664143---4467527898973999984872047899--999999998764--4968999838


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEE-CCCC--CCEEEEEE-CCCCC
Q ss_conf             3368899999960488850552055203578876355233115668-887627530254-0577--41000010-24676
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSI-YKSE--WIVNFFIF-YIKTW  309 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~-Yk~~--~lt~~i~~-lik~~  309 (383)
                      +...+.++..+...+.+..+.-..++..++|+.||++|+.||..|+ |++.+|+|+|++ |..+  --.+.-+. +.+..
T Consensus       220 ~~~~~~~~~~~~~~~~~~~v~~f~~~m~~~l~~aDlvIsraGa~Ti~E~~~~g~P~IlIP~p~a~d~hQ~~NA~~l~~~g  299 (350)
T cd03785         220 KGDLEEVKKAYEELGVNYEVFPFIDDMAAAYAAADLVISRAGASTVAELAALGLPAILIPLPYAADDHQTANARALVKAG  299 (350)
T ss_pred             CCHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHCCEEEECCCCCHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             40089999999866998899251889999986198899779842599999819986998458777665999999999889


Q ss_pred             CEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             10230244078426124205489899999999984498999999999999999838999989999
Q gi|254780767|r  310 TCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMA  374 (383)
Q Consensus       310 ~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~A  374 (383)
                      ..         .++.   |++++++.+.+.+.++++|++.+++|.++.++    ++.+.++.+++
T Consensus       300 ~a---------~~i~---e~~~~~~~L~~~i~~ll~d~~~l~~m~~~~~~----~~~~~a~~~i~  348 (350)
T cd03785         300 AA---------VLIP---QEELTPERLAAALLELLSDPERLKAMAEAARS----LARPDAAERIA  348 (350)
T ss_pred             CE---------EEEE---CCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHC----CCCCCHHHHHH
T ss_conf             99---------9950---02499999999999998799999999999874----58979999984


No 9  
>PRK12446 N-acetylglucosaminyl transferase; Reviewed
Probab=99.94  E-value=1.9e-24  Score=181.28  Aligned_cols=333  Identities=11%  Similarity=0.123  Sum_probs=215.1

Q ss_pred             EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHH-HHHCCCE-EEECHHHCCEEEH-----HHHHHHHHHHHHH
Q ss_conf             5999976821478999-99999997389983999971789-9947880-6504445311013-----6746645999999
Q gi|254780767|r    5 KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPS-LQKEGLV-SLFDFSELSVIGI-----MQVVRHLPQFIFR   76 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~-m~~~G~~-~~~~~~~l~v~G~-----~evl~~~~~~~~~   76 (383)
                      ||+++||.+.|+++.| .+.++|+++ +.++.  .+|.++ |++.-+. .-+++..+...|+     +.-++...++.+.
T Consensus         3 kIii~~GGTGGHi~Palala~~L~~~-~~~v~--~ig~~~g~e~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~l~~~   79 (352)
T PRK12446          3 KIVFTGGGSAGHVTPNLAIIPKLIED-NWDIS--YIGSHQGIEKTIIEKENIPYYSISSGKLRRYFDLKNIKDPFLVMKG   79 (352)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHC-CCEEE--EEECCCHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             79999587588899999999999848-99599--9988960543044504996899544772785529999999999999


Q ss_pred             HHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCH-HHHHHHHHHHCCCCCCCHHHH
Q ss_conf             9999861001288868985-11776579999866301346311110022110036635-579999986401567742232
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRA-RKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~-k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      +-+....+++.+||+||+. -|+.|=.-+|.++.    ++|++-+=. ...   .||+ |.+.++.+.+++-||--.++|
T Consensus        80 ~~~s~~il~~~kPd~Vig~GGY~S~P~~lAA~ll----~iP~~ihEq-Nav---~G~aNr~l~~~a~~i~~~f~~~~~~~  151 (352)
T PRK12446         80 VMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLN----RVPVLLHES-DMT---PGLANKIALRFASKIFVTFEEAAKHL  151 (352)
T ss_pred             HHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHC----CCCEEEECC-CHH---HHHHHHHHHHHHCCEEECCHHHHHCC
T ss_conf             9999999996399999974987779999999985----999699887-467---77899999987071289962455208


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      .+   -++.++|+|+.+++... +..+.+...++++++++|+++.||..++.-+  ..+.+++..+.+   +++++..+.
T Consensus       152 ~~---~k~~~tGnPvR~~i~~~-~~~~~~~~~~~~~~~~~iLV~GGSqGA~~iN--~~v~~~l~~l~~---~~~iih~~g  222 (352)
T PRK12446        152 PK---EKVIYTGSPVREEVLKG-NREKGLAFLGFSRKKPVITIMGGSLGAKKIN--ETVREALPELLL---KYQIVHLCG  222 (352)
T ss_pred             CC---CCEEECCCCCCHHHHCC-CHHHHHHHCCCCCCCCEEEEECCCHHHHHHH--HHHHHHHHHHHH---CCEEEEECC
T ss_conf             86---73687488620765403-5566787548887785799973751179999--999999999851---977999928


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEEC-CCCC---CEEEEEE-CCCC
Q ss_conf             3368899999960488850552055203578876355233115668-8876275302540-5774---1000010-2467
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIY-KSEW---IVNFFIF-YIKT  308 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Y-k~~~---lt~~i~~-lik~  308 (383)
                      ....+   ...........+....++..++|+.||++|+.||..|+ |++..|+|+|.+- ..+-   -.+.-++ +.+.
T Consensus       223 ~~~~~---~~~~~~~~~~~~~~~~~~m~~~~~~aDlvIsRAGAsTiaEl~~~g~PsIlIP~p~~a~~nHQ~~NA~~l~~~  299 (352)
T PRK12446        223 KGNLD---DSLQNKEGYRQFEYVHGELPDILAMTDFVISRAGSNAIFEFLTLQKPMLLIPLSKFASRGDQILNAESFERQ  299 (352)
T ss_pred             CCCHH---HHHHCCCCCEECCCHHHHHHHHHHHCCEEEECCCCHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHC
T ss_conf             77156---898501360765724554999998498899778702899999829988996289877757599999999977


Q ss_pred             CCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             610230244078426124205489899999999984498999999999999999838999989999999998
Q gi|254780767|r  309 WTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       309 ~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      ...         .+++   |+++|++.+.+.+.++++|++..       ++...+++.+.++.++ ++.|.|
T Consensus       300 gaa---------~vi~---e~~l~~~~L~~~i~~l~~n~~~~-------~~~~kk~~~p~aa~~I-~d~i~e  351 (352)
T PRK12446        300 GYA---------SVLY---EEDVTVNSLIKHVEELSHNNEKY-------KTALKKYNGKEAIQTI-IDHISE  351 (352)
T ss_pred             CCE---------EEEE---CCCCCHHHHHHHHHHHHHCHHHH-------HHHHHHCCCCCHHHHH-HHHHHC
T ss_conf             988---------9964---14699999999999998499999-------9999850795599999-999851


No 10 
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]
Probab=99.93  E-value=5.3e-23  Score=171.73  Aligned_cols=335  Identities=16%  Similarity=0.215  Sum_probs=230.9

Q ss_pred             CEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEEC-CHHHHHCCCEEE------ECHHHCCEEEHHHHHHHHHHHHH
Q ss_conf             45999976821478999-99999997389983999971-789994788065------04445311013674664599999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVG-GPSLQKEGLVSL------FDFSELSVIGIMQVVRHLPQFIF   75 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giG-G~~m~~~G~~~~------~~~~~l~v~G~~evl~~~~~~~~   75 (383)
                      |+|++.+|-+.|+++.| .+.++|+++ +.+ ++..+| +.+|+..=....      .+...+--.+.+..++...++++
T Consensus         1 ~~ivl~~gGTGGHv~pAlAl~~~l~~~-g~~-~v~~~~~~~~~e~~l~~~~~~~~~~I~~~~~~~~~~~~~~~~~~~~~~   78 (357)
T COG0707           1 KKIVLTAGGTGGHVFPALALAEELAKR-GWE-QVIVLGTGDGLEAFLVKQYGIEFELIPSGGLRRKGSLKLLKAPFKLLK   78 (357)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHC-CCC-EEEEECCCCHHHHHCCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             939999667766577999999999960-971-799944663444320545670799986465565650667886999999


Q ss_pred             HHHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCE-E---EECCCCCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             99999861001288868985-11776579999866301346311-1---1002211003663557999998640156774
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPII-N---YVCPSVWAWREGRARKMCAYINQVISILPFE  150 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi-~---yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE  150 (383)
                      ...+..+.+++.+||+|++. -||-+---+|...    .+||++ |   +++=..|-       .+.++.+.+++-||-.
T Consensus        79 ~~~~a~~il~~~kPd~vig~Ggyvs~P~~~Aa~~----~~iPv~ihEqn~~~G~ank-------~~~~~a~~V~~~f~~~  147 (357)
T COG0707          79 GVLQARKILKKLKPDVVIGTGGYVSGPVGIAAKL----LGIPVIIHEQNAVPGLANK-------ILSKFAKKVASAFPKL  147 (357)
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHH----CCCCEEEEEECCCCCHHHH-------HHHHHEEEEEECCCHH
T ss_conf             9999999999709989995798634649999861----6998799973466426564-------5323012577125112


Q ss_pred             HHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCC-CCEE
Q ss_conf             223200255314763882112210013558889761876556505998538743012305111899987640273-5126
Q gi|254780767|r  151 KEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNP-FFRF  229 (383)
Q Consensus       151 ~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~-~~~~  229 (383)
                      ..++.+   .++.++|+|+...+.. ......+...+.  ++++|+++.||+....      +.+++......-. ++++
T Consensus       148 ~~~~~~---~~~~~tG~Pvr~~~~~-~~~~~~~~~~~~--~~~~ilV~GGS~Ga~~------ln~~v~~~~~~l~~~~~v  215 (357)
T COG0707         148 EAGVKP---ENVVVTGIPVRPEFEE-LPAAEVRKDGRL--DKKTILVTGGSQGAKA------LNDLVPEALAKLANRIQV  215 (357)
T ss_pred             HCCCCC---CCEEEECCCCCHHHHC-CCHHHHHHHCCC--CCCEEEEECCCHHHHH------HHHHHHHHHHHHCCCEEE
T ss_conf             115786---6437857846366521-635544320378--9848999888242799------999999998721216699


Q ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEECCCCCC---EEEEE-E
Q ss_conf             201663368899999960488850552055203578876355233115668-887627530254057741---00001-0
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIYKSEWI---VNFFI-F  304 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Yk~~~l---t~~i~-~  304 (383)
                      +..+.+...+..+..+.+... ..+.-..++...+|+.||++|+.||..|+ |++.+|+|+|.+.--+..   .+.-+ .
T Consensus       216 ~~~~G~~~~~~~~~~~~~~~~-~~v~~f~~dm~~~~~~ADLvIsRaGa~Ti~E~~a~g~P~IliP~p~~~~~~Q~~NA~~  294 (357)
T COG0707         216 IHQTGKNDLEELKSAYNELGV-VRVLPFIDDMAALLAAADLVISRAGALTIAELLALGVPAILVPYPPGADGHQEYNAKF  294 (357)
T ss_pred             EEECCCCHHHHHHHHHHCCCC-EEEEEHHHHHHHHHHHCCEEEECCCHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHH
T ss_conf             997697369999998720681-8997667539999986458986786649999999589889965898764418999999


Q ss_pred             CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             24676102302440784261242054898999999999844989999999999999998389999899999999986
Q gi|254780767|r  305 YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQV  381 (383)
Q Consensus       305 lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~  381 (383)
                      +.+....-         +   +-|++.|++++.+.+.+++++++..++|.++.++    ++.+.++.+.+ +.+...
T Consensus       295 l~~~gaa~---------~---i~~~~lt~~~l~~~i~~l~~~~~~l~~m~~~a~~----~~~p~aa~~i~-~~~~~~  354 (357)
T COG0707         295 LEKAGAAL---------V---IRQSELTPEKLAELILRLLSNPEKLKAMAENAKK----LGKPDAAERIA-DLLLAL  354 (357)
T ss_pred             HHHCCCEE---------E---ECCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH----HCCCCHHHHHH-HHHHHH
T ss_conf             99679769---------9---4255479999999999996598999999999987----17987899999-999998


No 11 
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; InterPro: IPR006009    The murG gene of Escherichia coli encodes the N-acetylglucosaminyltransferase, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, responsible for the final step in the formation of the lipid-linked disaccharide-pentapeptide subunit of peptidoglycan. The enzyme is peripherally associated with the inner face of the cytoplasmic membrane. Therefore, the peptidoglycan subunit is completely assembled before it traverses the cytoplasmic membrane .; GO: 0050511 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase activity, 0019277 UDP-N-acetylgalactosamine biosynthetic process, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=99.90  E-value=1.8e-21  Score=161.57  Aligned_cols=337  Identities=18%  Similarity=0.241  Sum_probs=231.9

Q ss_pred             CCC-CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEE-E--ECHHHCCEEEH-----HHHHHHHH
Q ss_conf             987-459999768214789999999999738998399997178999478806-5--04445311013-----67466459
Q gi|254780767|r    1 MNS-LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVS-L--FDFSELSVIGI-----MQVVRHLP   71 (383)
Q Consensus         1 m~~-mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~-~--~~~~~l~v~G~-----~evl~~~~   71 (383)
                      |++ |||++.+|.+.|=.=|=.+.++|+++ ++++++.-+|..+-.+..+.. -  ..+.++++-|+     ..-++...
T Consensus         2 ~~~~~~~~~~gGGTGG~fPAlA~a~~l~~~-~~~~~v~~lG~~~g~e~~lv~~~~~~~~~~i~~~gl~~~~~~~~~~~~~   80 (368)
T TIGR01133         2 MNKMKKVALAGGGTGGIFPALAVAEELIKR-GPEVEVVWLGTKRGLEERLVPSKEGIEFLTIPVGGLRRKGSKKLLKLPL   80 (368)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHH-CCCEEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCHHHHHHHH
T ss_conf             988228999727830268999999999974-8936999850677500003432157417777401003655101467889


Q ss_pred             -HHHHHHHHHHHHCCCCCCCEEEEECHHHHH-HH--HHHHHHHHCCC-CCCEEEECCCCCCCCCCCH-HHHHHHHHHHCC
Q ss_conf             -999999999861001288868985117765-79--99986630134-6311110022110036635-579999986401
Q gi|254780767|r   72 -QFIFRINQTVELIVSSKPDVLLIVDNPDFT-HR--VAKRVRKKMPN-LPIINYVCPSVWAWREGRA-RKMCAYINQVIS  145 (383)
Q Consensus        72 -~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn-l~--lak~lkk~~~~-ipvi~yv~PqvWAWr~~R~-k~~~~~~d~~~~  145 (383)
                       ++.+...+..+.|++++||+||+  +-||- ++  +|-.+    +| ||++.=   |  =-.+|-+ |.+.++.|++++
T Consensus        81 ~~~~~~~~~a~~~l~~~~p~~v~G--~GGY~s~P~~~AA~l----~g~iP~~~E---Q--N~~pG~~Nk~ls~~A~~V~~  149 (368)
T TIGR01133        81 LKLLKAVLQARRILKKFKPDVVVG--FGGYVSGPAGLAAKL----LGRIPLILE---Q--NAVPGLTNKLLSRFAKRVLV  149 (368)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE--CCCHHHHHHHHHHHH----CCCCCEEEE---E--CCHHHHHHHHHHHHHCEEEE
T ss_conf             999999999999986008747987--473678999999876----679948986---1--54125788887887443111


Q ss_pred             CCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCH-HHHCCCHHHHHHHHHHCC
Q ss_conf             5677422320025531476388211221001355888976187655650599853874301-230511189998764027
Q gi|254780767|r  146 ILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEI-YKILPFFESAVASLVKRN  224 (383)
Q Consensus       146 ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI-~~~lP~~l~~~~~l~~~~  224 (383)
                      -||-=.++|+.  .-++.++|+|...++...+.. ..+.+....+++.+|+++.||..+++ ++.+|   +++..|.++.
T Consensus       150 ~f~~~~~~~~~--~~~~~~~g~pvr~~~~~~~~~-~~~~~~~~~~~~~~ilv~GGSQGA~~lN~~vp---~~~~~L~~~~  223 (368)
T TIGR01133       150 SFPGAKKFFPA--AEKVVVVGNPVREEIRSLPAA-RARKRFKLRPGKLRILVLGGSQGAKILNELVP---KALAKLAEKG  223 (368)
T ss_pred             ECHHHHCCCCC--CCCEEEECCHHHHHHHCCCCH-HHHHHHCCCCCCCEEEEECCCHHHHHHHHHHH---HHHHHHHHCC
T ss_conf             05133226766--675687014134543037825-68886216899827999627376899999999---9998864016


Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHCC-CCCEEEEECC--CCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEE-CCCCC--
Q ss_conf             3512620166336889999996048-8850552055--203578876355233115668-887627530254-05774--
Q gi|254780767|r  225 PFFRFSLVTVSSQENLVRCIVSKWD-ISPEIIIDKE--QKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSI-YKSEW--  297 (383)
Q Consensus       225 ~~~~~~i~~~~~~~~~~~~~~~~~~-~~~~i~~~~~--~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~-Yk~~~--  297 (383)
                      . +..++.......+.....+.+.+ ....+....+  +.-++|+.||++|+.||+.|+ |++..|+|+|.+ |.-.-  
T Consensus       224 ~-~~~~~~~g~~~~~~~~~~y~~~~l~~~~~~~f~~~~dm~~~y~~ADLvIsRAGA~T~~El~a~G~PaIliPyP~a~~r  302 (368)
T TIGR01133       224 L-ILVIIQGGKGDLEKVKNVYSELGLVAAKITPFIDNEDMAAAYAAADLVISRAGASTVAELAAAGVPAILIPYPYAAKR  302 (368)
T ss_pred             C-EEEEEECCHHHHHHHHHHHHHCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCH
T ss_conf             5-258887663779999998521371022210377875799999874040023337899999971777376258754681


Q ss_pred             -CEEEEEE-CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             -1000010-24676102302440784261242054898999999999844989999999999999998389999899
Q gi|254780767|r  298 -IVNFFIF-YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGH  372 (383)
Q Consensus       298 -lt~~i~~-lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~  372 (383)
                       =.+.-+. +.+...         ..+   +-|++.++++|...+..++.|+..+++|.++    .++++.++++.+
T Consensus       303 ~~Q~~NA~~l~~~ga---------g~~---~~q~~~~~e~l~~~~~~l~~~~~~~~~~~~~----~~~~~~~~a~~~  363 (368)
T TIGR01133       303 DDQYYNAKFLEDAGA---------GIV---IEQKELLTEKLVSALLKLLKDPARLEEMAEA----ARKLAKPDAAKR  363 (368)
T ss_pred             HHHHHHHHHHHHCCC---------CEE---EHHHCCCHHHHHHHHHHHCCHHHHHHHHHHH----HHHHHCCCHHHH
T ss_conf             789999999973446---------546---4022047689999987416108999999999----998615727799


No 12 
>PRK13609 diacylglycerol glucosyltransferase; Provisional
Probab=99.88  E-value=1.4e-19  Score=149.26  Aligned_cols=338  Identities=14%  Similarity=0.189  Sum_probs=208.1

Q ss_pred             CCEEEEEECCCC-HHHHHH-HHHHHHHHHCCCCEEE---EEECCHHHHHCCCEEEECHHHCCEE-EHHHH---------H
Q ss_conf             745999976821-478999-9999999738998399---9971789994788065044453110-13674---------6
Q gi|254780767|r    3 SLKIAVIAGEIS-GDLLAG-DLIKSLKEMVSYPINL---VGVGGPSLQKEGLVSLFDFSELSVI-GIMQV---------V   67 (383)
Q Consensus         3 ~mki~i~aGE~S-GD~~~a-~li~~Lk~~~~~~~~~---~giGG~~m~~~G~~~~~~~~~l~v~-G~~ev---------l   67 (383)
                      +.||+|.++... |+..+| .|.+++++....++.+   ++..++.+........  +..++.. .++..         -
T Consensus         4 ~kKVLILtas~G~GH~~AA~AL~e~l~~~~~~~v~v~D~~~~~~p~~~~~~~~~Y--l~~~~~~p~l~~~~Y~~~~~~~~   81 (388)
T PRK13609          4 NPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGESHPVITDITKYLY--LKSYTIGKELYRLFYYGVEKIYD   81 (388)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHHHHHHHH--HHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9979999788882789999999999983599819998514302704888998888--88855358899999964322221


Q ss_pred             HHHHHH--HHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE----CCCCCCCCCCCHHHHHHHHH
Q ss_conf             645999--999999986100128886898511776579999866301346311110----02211003663557999998
Q gi|254780767|r   68 RHLPQF--IFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV----CPSVWAWREGRARKMCAYIN  141 (383)
Q Consensus        68 ~~~~~~--~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv----~PqvWAWr~~R~k~~~~~~d  141 (383)
                      +....+  ....+++.+.|.+++||+||.. +|-+.+...  .++....+|++-.|    +=+.|.+         ..+|
T Consensus        82 ~~~~~~~~~~~~~~l~~li~~~kPDvII~T-~P~~~l~~l--k~~~~~~iP~~tViTD~~~H~~Wi~---------~~~D  149 (388)
T PRK13609         82 KKIASWYANFGRKRLKLLLQAEKPDIVINT-FPIIAVPEL--KKQTGISIPVYNVLTDFCVHKIWIH---------REVD  149 (388)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEC-CCHHHHHHH--HHHCCCCCCEEEEECCCCCHHHHCC---------CCCC
T ss_conf             567899999979999999998295999988-878999999--9845999988999478520464557---------8999


Q ss_pred             HHCCCCCCCHHHHHCCCCC---CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHH
Q ss_conf             6401567742232002553---1476388211221001355888976187655650599853874301230511189998
Q gi|254780767|r  142 QVISILPFEKEVMQRLGGP---PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVA  218 (383)
Q Consensus       142 ~~~~ifpFE~~~f~k~~~~---~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~  218 (383)
                      +.+|--+.-++...+. |+   ++...|-|+...+....++...++++|++++.++++++.||...     +..+.+.+.
T Consensus       150 ~y~Vase~~k~~l~~~-Gv~~~kI~vtGiPVr~~F~~~~~k~~~r~~lgL~~d~~~vLimgGg~G~-----~g~i~~l~~  223 (388)
T PRK13609        150 RYFVATDHVKEVMVDI-GVPAEQIVETGIPIRSSFELKINPDIIYNKYQLCKNKKILLIVAGAHGV-----LGNVKELCQ  223 (388)
T ss_pred             EEEECCHHHHHHHHHH-CCCHHHEEEECCCCCHHHCCCCCHHHHHHHHCCCCCCCEEEEECCHHHH-----HHHHHHHHH
T ss_conf             7993989999999980-9988899988984387872758878999982899878479997660121-----147999999


Q ss_pred             HHHHCCCCCEEEECCCCCH--HHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEECCC
Q ss_conf             7640273512620166336--8899999960488850552055203578876355233115668-887627530254057
Q gi|254780767|r  219 SLVKRNPFFRFSLVTVSSQ--ENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIYKS  295 (383)
Q Consensus       219 ~l~~~~~~~~~~i~~~~~~--~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Yk~  295 (383)
                      .|.. .+++++++.+..+.  .+.++......+....+.-..++..++|.+||+.|+.+|..|+ |+..+|+|+|+..-.
T Consensus       224 ~L~~-~~~~qiiVVcGrN~~L~~~L~~~~~~~~~~v~vlGf~~~~~~~~~~~d~~i~k~Gg~t~~E~~~~~~P~i~~~~~  302 (388)
T PRK13609        224 SFMS-VPDLQVVVVCGKNEALKQDLVGLQETNPDALKVFGYVENIDELFRVTSCMITKPGGITLSEAAALQVPVILYKPV  302 (388)
T ss_pred             HHHC-CCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHCCEEEECCCHHHHHHHHHHCCCEEECCCC
T ss_conf             9745-899249999089989999999887507994699504520999998575999578645899999948998970689


Q ss_pred             CCCEEEEEE-CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             741000010-2467610230244078426124205489899999999984498999999999999999838999989999
Q gi|254780767|r  296 EWIVNFFIF-YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMA  374 (383)
Q Consensus       296 ~~lt~~i~~-lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~A  374 (383)
                      ..-...-.+ +++.- .         .++   +   -+++++.+.+..+++|+++.++|.++.    .+++.+.++.++|
T Consensus       303 pgqe~~N~~~~~~~g-~---------~~~---~---~~~~~~~~~~~~ll~~~~~l~~m~~~~----~~~~~p~aa~~I~  362 (388)
T PRK13609        303 PGQENENAMYFERKG-A---------AVV---I---RDDSEVFAKTEALLQDDMKLLQMKEAM----KSIYLPEPADHIV  362 (388)
T ss_pred             CCHHHHHHHHHHHCC-C---------EEE---E---CCHHHHHHHHHHHHCCHHHHHHHHHHH----HHCCCCCHHHHHH
T ss_conf             961677799999789-8---------799---7---999999999999976999999999999----8627985899999


Q ss_pred             HHHHHHH
Q ss_conf             9999986
Q gi|254780767|r  375 AEIVLQV  381 (383)
Q Consensus       375 A~~I~~~  381 (383)
                      ..++-+.
T Consensus       363 ~~il~~~  369 (388)
T PRK13609        363 DTILAEN  369 (388)
T ss_pred             HHHHHHH
T ss_conf             9999863


No 13 
>PRK13608 diacylglycerol glucosyltransferase; Provisional
Probab=99.87  E-value=9e-19  Score=143.84  Aligned_cols=334  Identities=13%  Similarity=0.188  Sum_probs=213.3

Q ss_pred             CCEEEEEECCCC-HHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHH-----
Q ss_conf             745999976821-478999-9999999738998399997178999478806504445311013674664599999-----
Q gi|254780767|r    3 SLKIAVIAGEIS-GDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIF-----   75 (383)
Q Consensus         3 ~mki~i~aGE~S-GD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~-----   75 (383)
                      +.||+|.++... |+..|| .|.+++++....+.++.-.  +.+.... ..   +..+..-+....+++.|.+++     
T Consensus         5 ~KKVLILtas~G~GH~~AA~AL~~~l~~~~~~~~~v~~~--D~~~~~~-p~---~~~~~~~~Yl~~~k~~p~ly~~~Y~~   78 (391)
T PRK13608          5 NKKILIITGSFGNGHMQVTQSIVNQLNDMNLDHLSVIEH--DLFMEAH-PI---LTSICKKWYINSFKYFRNMYKGFYYS   78 (391)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEE--CHHHHCC-CH---HHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             887999968988379999999999998509996699991--3787648-41---88889999999999999999989854


Q ss_pred             -------------HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHH-CCCCCCEEEEC----CCCCCCCCCCHHHHH
Q ss_conf             -------------999998610012888689851177657999986630-13463111100----221100366355799
Q gi|254780767|r   76 -------------RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKK-MPNLPIINYVC----PSVWAWREGRARKMC  137 (383)
Q Consensus        76 -------------~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~-~~~ipvi~yv~----PqvWAWr~~R~k~~~  137 (383)
                                   ..+++.+.+.+++||++|+. +|-   .+.-.+|++ +.++|++-.+.    =..|..         
T Consensus        79 ~~~~~~~~~~~~~~~~kl~~~L~~~kPDvII~T-~P~---~~~s~lk~~~~~~iP~~tViTD~~~H~~W~~---------  145 (391)
T PRK13608         79 RPDKLDKCFYKYYGLNKLINLLIKEKPDLILLT-FPT---PVMSVLTEQFNINIPVATVMTDYRLHKNWIT---------  145 (391)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEC-CHH---HHHHHHHHHCCCCCCEEEEECCHHHHHHHCC---------
T ss_conf             840677999999889999999998492999999-828---9999999824999988999587133230368---------


Q ss_pred             HHHHHHCCCCCCCHHHHHCCCCCC---EEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHH
Q ss_conf             999864015677422320025531---47638821122100135588897618765565059985387430123051118
Q gi|254780767|r  138 AYINQVISILPFEKEVMQRLGGPP---TTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFE  214 (383)
Q Consensus       138 ~~~d~~~~ifpFE~~~f~k~~~~~---~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l  214 (383)
                      ..+|+.+|--+.-.+.+.+. |++   +..+|=|+...+....++.+.++++++++++++|+++.||-.-     .+.+.
T Consensus       146 ~~~D~y~Va~~~~~~~l~~~-Gi~~~kI~vtGIPV~~~F~~~~~~~~~~~~~~l~~~~~~iLv~gG~~G~-----~~~~~  219 (391)
T PRK13608        146 PYSTRYYVATKETKQDFIDV-GIDPSTVKVTGIPIDNKFETPINQKQWLIDNNLDPDKQTILMSAGAFGV-----SKGFD  219 (391)
T ss_pred             CCCCEEEECCHHHHHHHHHC-CCCHHHEEEEEEECCHHHCCCCCHHHHHHHCCCCCCCCEEEEECCCCCH-----HHHHH
T ss_conf             99997996999999999984-9997688998343586773755678999971899777689996886310-----24699


Q ss_pred             HHHHHHHHCCCCCEEEECCCCCHH--HHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEE
Q ss_conf             999876402735126201663368--899999960488850552055203578876355233115668-88762753025
Q gi|254780767|r  215 SAVASLVKRNPFFRFSLVTVSSQE--NLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVS  291 (383)
Q Consensus       215 ~~~~~l~~~~~~~~~~i~~~~~~~--~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV  291 (383)
                      .++..+....++.++++.+..+.+  ..++......+ +..+.=..++..++|.+||+.|+.+|-.|. |+...++||++
T Consensus       220 ~~i~~ll~~~~~~qivvvcGrN~~L~~~L~~~~~~~~-~v~vlG~t~~m~~lM~asDllITKpGGlT~sEAla~~lPmii  298 (391)
T PRK13608        220 TMITDILAKSANAQVVMICGKSKELKRSLTAKFKSNE-NVLILGYTKHMNEWMASSQLMITKPGGITITEGFARCIPMIF  298 (391)
T ss_pred             HHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCC-CEEEECCCCCHHHHHHHCCEEEECCCHHHHHHHHHHCCCEEE
T ss_conf             9999997159996599990899999999997624599-769970705199999865299967866799999995899897


Q ss_pred             ECCCCCCEEEEEE-CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             4057741000010-246761023024407842612420548989999999998449899999999999999983899998
Q gi|254780767|r  292 IYKSEWIVNFFIF-YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPA  370 (383)
Q Consensus       292 ~Yk~~~lt~~i~~-lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a  370 (383)
                      .-....-...-.. +++.-..-.                --+++++.+.+..+++|++..++|.+++++    ++.+.++
T Consensus       299 ~~piPGQEe~Na~~l~~~G~a~~----------------~~~~~~~~~~v~~l~~~~~~l~~m~~~~~~----~~~p~a~  358 (391)
T PRK13608        299 LNPAPGQELENALYFEEKGFGKI----------------ADTPEEAIKIVASLTNGNEQLTNMISTMEQ----DKIKYAT  358 (391)
T ss_pred             CCCCCCCHHHHHHHHHHCCCEEE----------------ECCHHHHHHHHHHHHCCHHHHHHHHHHHHH----HCCCCHH
T ss_conf             57999744667999996897688----------------599999999999985599999999999997----1799629


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999998619
Q gi|254780767|r  371 GHMAAEIVLQVLG  383 (383)
Q Consensus       371 ~~~AA~~I~~~Lg  383 (383)
                      .+++ +-+++++|
T Consensus       359 ~~I~-~~~~~l~~  370 (391)
T PRK13608        359 QTIC-RDLLDLIG  370 (391)
T ss_pred             HHHH-HHHHHHHH
T ss_conf             9999-99999872


No 14 
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=99.73  E-value=2.4e-16  Score=127.78  Aligned_cols=345  Identities=17%  Similarity=0.171  Sum_probs=197.5

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEE----EC-CHHHHHCCCEEEECHHHCCEEEHH-----H----HH-
Q ss_conf             745999976821478999999999973899839999----71-789994788065044453110136-----7----46-
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVG----VG-GPSLQKEGLVSLFDFSELSVIGIM-----Q----VV-   67 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~g----iG-G~~m~~~G~~~~~~~~~l~v~G~~-----e----vl-   67 (383)
                      .|||+++.-.+.-|+.|+.++++|+++.+|+ +++.    || |..-+..++..+-+..++..-||.     +    +- 
T Consensus         6 ~~kiLllSNGHgEDlia~~i~qal~rra~p~-eila~LPLVGeG~aYq~l~i~ligpv~~mPSGGf~y~~~~~l~rDvrg   84 (412)
T COG4370           6 APKILLLSNGHGEDLIAVAIAQALRRRAPPD-EILAALPLVGEGGAYQNLNIELIGPVLTMPSGGFIYMDLRNLWRDVRG   84 (412)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHHHCCCC-CEEECCCCCCCCHHHCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHC
T ss_conf             3104786068527789999999999637986-604216422574121256850000354478888234559999999752


Q ss_pred             ----HHHHHHHHHHHHHHHHCCC--CCCCEEEEECHHHHHHHHHHHH-HHH-CCCC---CCEEEECCCCCCCCCCCHH--
Q ss_conf             ----6459999999999861001--2888689851177657999986-630-1346---3111100221100366355--
Q gi|254780767|r   68 ----RHLPQFIFRINQTVELIVS--SKPDVLLIVDNPDFTHRVAKRV-RKK-MPNL---PIINYVCPSVWAWREGRAR--  134 (383)
Q Consensus        68 ----~~~~~~~~~~~~~~~~i~~--~~Pd~vi~iD~pgFnl~lak~l-kk~-~~~i---pvi~yv~PqvWAWr~~R~k--  134 (383)
                          +.+..+.-..++.-. .++  .+-|++-.=|-    ..+|... -.. ..-.   +.-|||.--+-+|=+.-..  
T Consensus        85 GLvqlT~~Qi~alrkq~~q-~~~~g~~~~ilAvGdi----vpla~a~lg~~~y~~v~~a~seyyvr~~~g~~l~~t~a~r  159 (412)
T COG4370          85 GLVQLTLGQILALRKQGPQ-LERVGVVGDILAVGDI----VPLAFAILGGLAYAFVGTAKSEYYVRVEYGLGLPLTGALR  159 (412)
T ss_pred             CHHHHHHHHHHHHHHHHHH-HHHCCCCCCEEEECCH----HHHHHHHHCCCCCCCEEECCCCEEEEECCCCCCCCCHHHH
T ss_conf             1788529999999874316-5533555535885112----5889986167764303321440566201234776400445


Q ss_pred             ------------HHHHHHHHHCCCCC---CCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEE
Q ss_conf             ------------79999986401567---742232002553147638821122100135588897618765565059985
Q gi|254780767|r  135 ------------KMCAYINQVISILP---FEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLP  199 (383)
Q Consensus       135 ------------~~~~~~d~~~~ifp---FE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llP  199 (383)
                                  .+-. -.+....||   +-.+-..+. |+++.|||+|++|-....+.....     +-...++|+|||
T Consensus       160 wen~lg~~y~pwwlm~-~rrc~~vf~rD~~Taq~L~~r-gvna~~vGnpmmD~L~p~~~~~q~-----l~~g~~viaLLP  232 (412)
T COG4370         160 WENALGAVYMPWWLML-RRRCWAVFPRDALTAQHLANR-GVNAAYVGNPMMDGLPPPERDPQL-----LLTGVPVIALLP  232 (412)
T ss_pred             HHHHCCCCHHHHHHHH-CCCCEEEECCCCCCHHHHHHC-CCCHHHCCCHHHCCCCCCCCCCHH-----HCCCCCEEEECC
T ss_conf             5430254010589871-552025505553157889746-976665067143069976678134-----226872588668


Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHH-HH--HHHC--------CCCCEEEEECCCCHHHHHHH
Q ss_conf             3874301230511189998764027351262016633688999-99--9604--------88850552055203578876
Q gi|254780767|r  200 GSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVR-CI--VSKW--------DISPEIIIDKEQKKQVFMTC  268 (383)
Q Consensus       200 GSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~-~~--~~~~--------~~~~~i~~~~~~~~~~l~~s  268 (383)
                      |||..|...++++++.++.-+......+.|.-..+++..-... ..  -..|        +.+..+........++++++
T Consensus       233 GsR~pea~~nl~~il~slcal~~~~a~vvfw~ai~~~lpl~~l~~l~e~~gWq~~ad~~~kdnc~l~lsqqsfadiLH~a  312 (412)
T COG4370         233 GSRVPEAQTNLAVILGSLCALPAMFALVVFWAAIAPELPLLLLWTLEERQGWQPLADRFGKDNCSLWLSQQSFADILHAA  312 (412)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHCCCCEEEEEEHHHHHHHHHHH
T ss_conf             98881787639999999864277778889876037679878999999853862256664667638997588899999889


Q ss_pred             HHHHCCCHHHHHHHHHHCCCEEEECCCCCC-EEEEE----ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHH
Q ss_conf             355233115668887627530254057741-00001----0246761023024407842612420548989999999998
Q gi|254780767|r  269 NAAMAASGTVILELALCGIPVVSIYKSEWI-VNFFI----FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERL  343 (383)
Q Consensus       269 d~ai~~SGTaTLE~al~g~P~IV~Yk~~~l-t~~i~----~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~l  343 (383)
                      |+||.+.||+|-+++-+|+|.|-+---.+- ++.|+    +++-.   ||.  +.+         +  +++.=.....++
T Consensus       313 daalgmAGTAtEQavGLGkPvi~fPg~GPQy~pgFA~rQ~rLLG~---slt--lv~---------~--~aq~a~~~~q~l  376 (412)
T COG4370         313 DAALGMAGTATEQAVGLGKPVIGFPGQGPQYNPGFAERQQRLLGA---SLT--LVR---------P--EAQAAAQAVQEL  376 (412)
T ss_pred             HHHHHHCCCHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHCC---EEE--ECC---------C--CHHHHHHHHHHH
T ss_conf             999875441677763369862436898987581799999998525---345--417---------7--545689999998


Q ss_pred             HCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             4498999999999999999838999989999999998
Q gi|254780767|r  344 SQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       344 l~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      +.|+++.+.++.   +-.+++|++|++.++|+ ...+
T Consensus       377 l~dp~r~~air~---nGqrRiGqaGaa~rIAe-~l~e  409 (412)
T COG4370         377 LGDPQRLTAIRH---NGQRRIGQAGAARRIAE-ELGE  409 (412)
T ss_pred             HCCHHHHHHHHH---CCHHHCCCCCHHHHHHH-HHHH
T ss_conf             448177788875---34433167623789999-9987


No 15 
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
Probab=99.71  E-value=1.6e-14  Score=115.71  Aligned_cols=329  Identities=19%  Similarity=0.235  Sum_probs=196.4

Q ss_pred             EEEEEECC----CCH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHH-HHHHHHHHHHHHHH
Q ss_conf             59999768----214-7899999999997389983999971789994788065044453110136-74664599999999
Q gi|254780767|r    5 KIAVIAGE----ISG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIM-QVVRHLPQFIFRIN   78 (383)
Q Consensus         5 ki~i~aGE----~SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~-evl~~~~~~~~~~~   78 (383)
                      ||.+++.+    .+| ..+..+|.++|.++ +.++.+..-.-+.-...     .+.......... ..............
T Consensus         1 kIaivt~~y~P~~GG~~~~~~~La~~L~~~-GheV~Vit~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (374)
T cd03817           1 KIGIFTDTYLPQVNGVATSIRRLAEELEKR-GHEVYVVAPSYPGAPEE-----EEVVVVRPFRVPTFKYPDFRLPLPIPR   74 (374)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCC-----CCCCEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             989995898999980999999999999977-99899997279887754-----357628984367776521345555799


Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE---CCCCC----------CCC--CCCHHHHHHHHHHH
Q ss_conf             9986100128886898511776579999866301346311110---02211----------003--66355799999864
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV---CPSVW----------AWR--EGRARKMCAYINQV  143 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv---~PqvW----------AWr--~~R~k~~~~~~d~~  143 (383)
                      .+...+++.+||+|.. -+|-+--.++.++.++ .++|+++-.   .++.+          .|.  .+-.+.+-+.+|.+
T Consensus        75 ~~~~~~~~~~~DvIh~-~~~~~~~~~a~~~~~~-~~ip~V~t~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~i  152 (374)
T cd03817          75 ALIIILKELGPDIVHT-HTPFSLGLLGLRVARK-LGIPVVATYHTMYEDYTHYVPLGRLLARAVVRRKLSRRFYNRCDAV  152 (374)
T ss_pred             HHHHHHHHCCCCEEEE-CCHHHHHHHHHHHHHH-CCCCEEEEECCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCEE
T ss_conf             9999998669999998-7825889999999997-4995999955777998876311101356789999999999859999


Q ss_pred             CCCCCCCHHHHHCCCCC--CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHH
Q ss_conf             01567742232002553--1476388211221001355888976187655650599853874301230511189998764
Q gi|254780767|r  144 ISILPFEKEVMQRLGGP--PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLV  221 (383)
Q Consensus       144 ~~ifpFE~~~f~k~~~~--~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~  221 (383)
                      +|.-++..+++.++ +.  ++..+-|++-...-........+++.+..+++.+ .++.| |-.+ .+.+..+++++.++.
T Consensus       153 i~~S~~~~~~l~~~-~~~~~i~vI~ngvd~~~f~~~~~~~~~~~~~~~~~~~~-i~~~G-rl~~-~Kg~~~li~a~~~l~  228 (374)
T cd03817         153 IAPSEKIADLLREY-GVKRPIEVIPTGIDLDRFEPVDGDDERRKLGIPEDEPV-LLYVG-RLAK-EKNIDFLIRAFARLL  228 (374)
T ss_pred             EECHHHHHHHHHHC-CCCCCEEEECCCCCHHHCCCCCHHHHHHHHCCCCCCEE-EEEEE-CCCC-CCHHHHHHHHHHHHH
T ss_conf             97809999999970-89998899869606664398641789998189999849-99970-5754-210789999999887


Q ss_pred             HCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEE
Q ss_conf             027351262016633688999999604888505520----552035788763552331-----15668887627530254
Q gi|254780767|r  222 KRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSI  292 (383)
Q Consensus       222 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~  292 (383)
                      ++.+++++++......++.++......++..+|...    .++..++++.||+.+..|     |.+.+|++++|+|.|+ 
T Consensus       229 ~~~~~~~l~ivG~G~~~~~l~~~~~~~~l~~~V~f~G~v~~~~~~~~l~~adi~v~pS~~E~fg~~~~EAma~G~PvI~-  307 (374)
T cd03817         229 KEEPDVKLVIVGDGPEREELEELARELGLADRVIFTGFVPREELPDYYKAADLFVFASTTETQGLVLLEAMAAGLPVVA-  307 (374)
T ss_pred             HCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEE-
T ss_conf             4189848999877447655678888742466244358875667787644247544777665775999999981998999-


Q ss_pred             CCCCCCEEEEEECCCCCCEEEEHHHCCC---CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             0577410000102467610230244078---42612420548989999999998449899999999999999983899
Q gi|254780767|r  293 YKSEWIVNFFIFYIKTWTCALPNLIVDY---PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTK  367 (383)
Q Consensus       293 Yk~~~lt~~i~~lik~~~i~LpNii~~~---~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~  367 (383)
                      ...+               +++.++-+.   -++|+      +.+.+++++..+++|++.|++|-++.++..++...+
T Consensus       308 s~~g---------------g~~e~i~~g~~G~l~~~------~~~~l~~~i~~l~~~~~~~~~~~~~a~~~a~~f~~~  364 (374)
T cd03817         308 VDAP---------------GLPDLVADGENGFLFPP------GDEALAEALLRLLQDPELRRRLSKNAEESAEKFSFA  364 (374)
T ss_pred             ECCC---------------CHHHHHHCCCEEEEECC------CHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCHH
T ss_conf             1799---------------75999647985999697------869999999999759999999999999999978999


No 16 
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria. amsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor.
Probab=99.69  E-value=7e-14  Score=111.55  Aligned_cols=321  Identities=18%  Similarity=0.184  Sum_probs=189.0

Q ss_pred             EEEEEECCCC--HHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5999976821--47899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    5 KIAVIAGEIS--GDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         5 ki~i~aGE~S--GD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      ||.+++..-.  |+.+--+++++|.++ +.++.++...++.-      ...+..+-....-......-.........+.+
T Consensus         1 ki~~v~~~~P~~~etfv~~la~~L~~~-GHeV~v~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   73 (355)
T cd03799           1 KIAYLVKEFPRLSETFILREILALEAA-GHEVEIFSLRPPED------TLVHPEDRAELARTRYLARSLALLAQALVLAR   73 (355)
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHC-CCEEEEEECCCCCC------CCCCCCCCCEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             989998989899617999999999967-98499995348877------73064302121552154777999999999999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCC-CCHHHHHHHHHHHCCCCCCCHHHHHCCCCC
Q ss_conf             100128886898511776579999866301346311110-022110036-635579999986401567742232002553
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWRE-GRARKMCAYINQVISILPFEKEVMQRLGGP  160 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~-~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~  160 (383)
                      .+++++||+|-.= ++-....++..+++ ..++|+++-+ .+.+|--.. ++.+..-+..|++++.=.+..+...+..++
T Consensus        74 ~i~~~~~DiIH~H-~~~~~~~~~~~~~~-~~~ip~v~t~Hg~d~~~~~~~~~l~~~~~~ad~ii~vS~~~~~~l~~~~~~  151 (355)
T cd03799          74 ELRRLGIDHIHAH-FGTTPATVAMLASR-LGGIPYSFTAHGKDIFRSPDAIDLDEKLARADFVVAISEYNRQQLIRLLGC  151 (355)
T ss_pred             HHHHCCCCEEEEC-CCCHHHHHHHHHHH-HCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCEEEECCHHHHHHHHHHCCC
T ss_conf             9977799899976-88337999999999-749999999816765567368999999983999999899999999986099


Q ss_pred             ---CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH
Q ss_conf             ---14763882112210013558889761876556505998538743012305111899987640273512620166336
Q gi|254780767|r  161 ---PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ  237 (383)
Q Consensus       161 ---~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~  237 (383)
                         ++..+.|.+ |.       ..+........+++...++.| |-.+ .+.++.+++++.++.++.|++++++......
T Consensus       152 ~~~ki~vi~ngv-d~-------~~f~~~~~~~~~~~~~il~vG-rl~~-~Kg~~~li~A~~~l~~~~~~~~l~ivG~G~~  221 (355)
T cd03799         152 DPDKIHVVHCGV-DL-------ERFPPRPPPPPGEPLRILSVG-RLVE-KKGLDYLLEALALLKDRGIDFRLDIVGDGPL  221 (355)
T ss_pred             CHHHEEEECCCC-CH-------HHCCCCCCCCCCCCEEEEEEE-CCCH-HCCCHHHHHHHHHHHHHCCCEEEEEECCCHH
T ss_conf             914689989964-88-------887998755778986999981-5802-1190999999999986499979999667604


Q ss_pred             HHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----------HHHHHHHHHHCCCEEEECCCCCCEEEE
Q ss_conf             88999999604888505520----552035788763552331-----------156688876275302540577410000
Q gi|254780767|r  238 ENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----------GTVILELALCGIPVVSIYKSEWIVNFF  302 (383)
Q Consensus       238 ~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----------GTaTLE~al~g~P~IV~Yk~~~lt~~i  302 (383)
                      .+.++...++.++...|...    .++..+.++.||+.+.+|           |.+.||++.+|+|. |+.+.+.+    
T Consensus       222 ~~~l~~~~~~l~l~~~V~f~G~v~~~~l~~~~~~adv~v~pS~~~~~~~~Eg~p~~~lEAma~G~Pv-Vas~~~g~----  296 (355)
T cd03799         222 RDELEALIAELGLEDRVTLLGAKSQEEVRELLRAADLFVLPSVTAADGDREGLPVVLMEAMAMGLPV-ISTDVSGI----  296 (355)
T ss_pred             HHHHHHHHHHCCCCCCEEECCCCCCHHHHHHHHHCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCE-EECCCCCC----
T ss_conf             8899999997499855076444464767999974989998452335677668777999999669989-99179985----


Q ss_pred             EECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             1024676102302440784---26124205489899999999984498999999999999-999838
Q gi|254780767|r  303 IFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       303 ~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
                                 +-++.+.+   ++|     .-+++.+++++..+++|++.|++|-++.++ +.++..
T Consensus       297 -----------~e~v~~g~~G~l~~-----~~d~~~la~~i~~ll~d~~~~~~~~~~ar~~v~~~fs  347 (355)
T cd03799         297 -----------PELVEDGETGLLVP-----PGDPEALADAIERLLDDPELRREMGEAGRARVEEEFD  347 (355)
T ss_pred             -----------HHHHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             -----------76622898589979-----9999999999999987999999999999999998699


No 17 
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=99.69  E-value=6.9e-14  Score=111.61  Aligned_cols=333  Identities=15%  Similarity=0.178  Sum_probs=196.4

Q ss_pred             CEEEEEECCC---CHHHHHHHHHHHHHHHCCCCEEEEEECCHH-HHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             4599997682---147899999999997389983999971789-994788065044453110136746645999999999
Q gi|254780767|r    4 LKIAVIAGEI---SGDLLAGDLIKSLKEMVSYPINLVGVGGPS-LQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         4 mki~i~aGE~---SGD~~~a~li~~Lk~~~~~~~~~~giGG~~-m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      |||.++| .+   ....+...|.++|.++ +.++.+...+.+. +....-...++--......+   .+.-+.......+
T Consensus         1 MkI~i~~-~P~~GG~e~~v~~La~~L~~~-GHeV~vit~~~~~~~~~~~~~~~~~~v~~~~~~~---~~~~~~~~~~~~~   75 (371)
T cd04962           1 MKIGIVC-YPTYGGSGVVATELGKALARR-GHEVHFITSSRPFRLDEYSPNIFFHEVEVPQYPL---FQYPPYDLALASK   75 (371)
T ss_pred             CEEEEEC-CCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCEEEEEECCCCCCC---CCCCCCHHHHHHH
T ss_conf             9799989-999986999999999999975-9999999568987655568973799846877653---4467213789999


Q ss_pred             HHHHCCCCCCCEEEEE-CHH-HHHHHHHHHHHHHCCCCCCEEEEC-CCCCCCCCCCH-----HHHHHHHHHHCCCCCCCH
Q ss_conf             9861001288868985-117-765799998663013463111100-22110036635-----579999986401567742
Q gi|254780767|r   80 TVELIVSSKPDVLLIV-DNP-DFTHRVAKRVRKKMPNLPIINYVC-PSVWAWREGRA-----RKMCAYINQVISILPFEK  151 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~i-D~p-gFnl~lak~lkk~~~~ipvi~yv~-PqvWAWr~~R~-----k~~~~~~d~~~~ifpFE~  151 (383)
                      +.+.++.++||+|-.= ..| .+..-++..+.+ ..++|+++.+- ..+|.++..+.     +...+..|.+.++-++..
T Consensus        76 l~~~~~~~~~DvvH~h~~~p~~~~~~l~~~~~~-~~~~~~v~t~H~~~~~~~~~~~~~~~~~~~~~~~a~~vi~~S~~~~  154 (371)
T cd04962          76 IAEVAKRYKLDLLHVHYAVPHAVAAYLAREILG-KKDLPVVTTLHGTDITLVGQDPSFQPATRFSIEKSDGVTAVSESLR  154 (371)
T ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH-CCCCCEEEEECCCCHHHHCCCHHHHHHHHHHHHHCCEEEECCHHHH
T ss_conf             999999739988997255426799999999864-4799789993798556421474566899999975898998999999


Q ss_pred             HHHHCCCC--CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEE
Q ss_conf             23200255--3147638821122100135588897618765565059985387430123051118999876402735126
Q gi|254780767|r  152 EVMQRLGG--PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRF  229 (383)
Q Consensus       152 ~~f~k~~~--~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~  229 (383)
                      +...+..+  -+...+.|++-...-........+...+...+.++|+.+ | |-.. .+.++.+++++..+.+..+ .++
T Consensus       155 ~~~~~~~~~~~~i~vI~Ngvd~~~f~~~~~~~~~~~~~~~~~~~~i~~v-g-rl~~-~Kg~~~ll~a~~~l~~~~~-~~l  230 (371)
T cd04962         155 QETYELFDITKEIEVIPNFVDEDRFRPKPDEALKRRLGAPEGEKVLIHI-S-NFRP-VKRIDDVIRIFAKVRKEVP-ARL  230 (371)
T ss_pred             HHHHHHCCCCCCEEEECCCCCHHHCCCCCCHHHHHHHCCCCCCEEEEEE-C-CCCH-HCCHHHHHHHHHHHHHCCC-EEE
T ss_conf             9999960999888998797573214888507899970999898599994-2-6502-1496999999998630576-599


Q ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEEEC--CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEE
Q ss_conf             20166336889999996048885055205--52035788763552331-----156688876275302540577410000
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDISPEIIIDK--EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFF  302 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~~~~i~~~~--~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i  302 (383)
                      ++..........+...++.+....+....  ++..+.++.||+.+..|     |.+.+|++.+|+|.| +...+.+    
T Consensus       231 ~ivG~G~~~~~~~~~~~~~~l~~~V~f~G~~~~~~~~~~~adi~v~pS~~E~fg~vilEAma~G~PvI-at~~gg~----  305 (371)
T cd04962         231 LLVGDGPERSPAERLARELGLQDDVLFLGKQDHVEELLSIADLFLLPSEKESFGLAALEAMACGVPVV-ASNAGGI----  305 (371)
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEE-ECCCCCH----
T ss_conf             99826403778888887621031366327365599999855111387324432025999995699499-8689983----


Q ss_pred             EECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH-HHHHHHCCC
Q ss_conf             1024676102302440784---2612420548989999999998449899999999999-999983899
Q gi|254780767|r  303 IFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFE-NLWDRMNTK  367 (383)
Q Consensus       303 ~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~-~~~~~Lg~~  367 (383)
                                 +.++-+..   ++|     .-+++.+++.+..+++|++.|++|-++.+ .+.+....+
T Consensus       306 -----------~e~v~~g~~G~l~~-----~~d~~~la~~i~~ll~~~~~~~~~~~~a~~~~~~~fs~~  358 (371)
T cd04962         306 -----------PEVVKHGETGFLVD-----VGDVEAMAEYALSLLEDDELWQEFSRAARNRAAERFDSE  358 (371)
T ss_pred             -----------HHHHCCCCEEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             -----------89970897189978-----999999999999997699999999999999999868999


No 18 
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. 
Probab=99.68  E-value=1.5e-13  Score=109.44  Aligned_cols=329  Identities=19%  Similarity=0.228  Sum_probs=194.6

Q ss_pred             EEEEEECC----C-CHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH----CCCEEEECHHHCCEEEHHHHHHHHHHHHH
Q ss_conf             59999768----2-147899999999997389983999971789994----78806504445311013674664599999
Q gi|254780767|r    5 KIAVIAGE----I-SGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQK----EGLVSLFDFSELSVIGIMQVVRHLPQFIF   75 (383)
Q Consensus         5 ki~i~aGE----~-SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~----~G~~~~~~~~~l~v~G~~evl~~~~~~~~   75 (383)
                      ||.+++..    . ....+..+|+++|.++ +.++.+...+......    .+...... ..      ............
T Consensus         1 kIlii~~~~~P~~GG~e~~~~~la~~L~~~-G~~V~vit~~~~~~~~~~~~~~~~~~~~-~~------~~~~~~~~~~~~   72 (374)
T cd03801           1 KILLVTPEYPPSVGGAERHVLELARALAAR-GHEVTVLTPGDGGLPDEEEVGGIVVVRP-PP------LLRVRRLLLLLL   72 (374)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHCCCCEEEEC-CC------CCCCCHHHHHHH
T ss_conf             989994877999881999999999999977-9989999607988750342377169956-76------654200245678


Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE---CCCCCCCCCCCH--------HHHHHHHHHHC
Q ss_conf             9999986100128886898511776579999866301346311110---022110036635--------57999998640
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV---CPSVWAWREGRA--------RKMCAYINQVI  144 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv---~PqvWAWr~~R~--------k~~~~~~d~~~  144 (383)
                      ........++..+||+++.-+...+-  .+..+++. .++|+++.+   .+..+.+..+..        +.+-+..|+++
T Consensus        73 ~~~~~~~~~~~~~~Dii~~~~~~~~~--~~~~~~~~-~~~~~i~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~ii  149 (374)
T cd03801          73 LALRLRRLLRRERFDVVHAHDWLALL--AAALAARL-LGIPLVLTVHGLEFGRPGNELGLLLKLARALERRALRRADRII  149 (374)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCHHHH--HHHHHHHH-CCCCEEEEECCCCHHCCCCCHHHHHHHHHHHHHHHHHHCCEEE
T ss_conf             99999999985599899978831789--99999986-6997899967862100221002568999999999998389999


Q ss_pred             CCCCCCHHHHHCCCC---CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHH
Q ss_conf             156774223200255---31476388211221001355888976187655650599853874301230511189998764
Q gi|254780767|r  145 SILPFEKEVMQRLGG---PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLV  221 (383)
Q Consensus       145 ~ifpFE~~~f~k~~~---~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~  221 (383)
                      |+=++..+.+.+..+   -++..+.|++ |...........+++.+..+++++| ++.| |-.+ .+....+++++..+.
T Consensus       150 ~~S~~~~~~l~~~~~~~~~ki~vI~ngi-d~~~~~~~~~~~~~~~~~~~~~~~i-l~vG-rl~~-~Kg~~~li~a~~~l~  225 (374)
T cd03801         150 AVSEATREELRELGGVPPEKITVIPNGV-DTERFRPAPRAARRRLGIPEDEPVI-LFVG-RLVP-RKGVDLLLEALAKLR  225 (374)
T ss_pred             ECCHHHHHHHHHHCCCCHHHEEEECCCC-CHHHCCCCCHHHHHHHCCCCCCEEE-EEEE-ECCC-CCCCHHHHHHHHHHH
T ss_conf             9899999999986199856899988976-7554175417789871899998299-9995-3320-028357899999998


Q ss_pred             HCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEE
Q ss_conf             027351262016633688999999604888505520----552035788763552331-----15668887627530254
Q gi|254780767|r  222 KRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSI  292 (383)
Q Consensus       222 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~  292 (383)
                      ++.+++++++.......+.++....+.++..+|...    .++..+.++.||+.+.+|     |.+.+|++.+|+|.| +
T Consensus       226 ~~~~~~~l~ivG~g~~~~~~~~~~~~~~l~~~v~f~g~v~~~~~~~~~~~adi~v~pS~~E~~~~~~lEAma~G~PvI-~  304 (374)
T cd03801         226 KEYPDVRLVIVGDGPLREELEALAAELGLGDRVTFLGFVPDEDLPALYAAADVFVLPSLYEGFGLVLLEAMAAGLPVV-A  304 (374)
T ss_pred             HHCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEE-E
T ss_conf             528872999956881366999999973998559975864211377887654036587355432158999997699899-9


Q ss_pred             CCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHCC
Q ss_conf             0577410000102467610230244078426124205489899999999984498999999999999-9998389
Q gi|254780767|r  293 YKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMNT  366 (383)
Q Consensus       293 Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg~  366 (383)
                      ...+.+               +.+|.+.+-  =++-+.-+++.+++.+.++++|++.|+++-++.++ +.+....
T Consensus       305 t~~gg~---------------~e~i~~~~~--G~l~~~~d~~~l~~~i~~l~~~~~~~~~~~~~~~~~~~~~fs~  362 (374)
T cd03801         305 SDVGGI---------------PEVVEDGET--GLLVPPGDPEALAEAILRLLDDPELRRRLGEAARERVAERFSW  362 (374)
T ss_pred             CCCCCH---------------HHHHCCCCE--EEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCH
T ss_conf             789975---------------888518971--8997899999999999999779999999999999999986899


No 19 
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.
Probab=99.67  E-value=5.1e-13  Score=105.86  Aligned_cols=332  Identities=16%  Similarity=0.129  Sum_probs=186.7

Q ss_pred             EEEEEECCC-----CHHHHHHHHHHHHHHHCCCCEEEEEEC--CHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHH
Q ss_conf             599997682-----147899999999997389983999971--7899947880650444531101367466459999999
Q gi|254780767|r    5 KIAVIAGEI-----SGDLLAGDLIKSLKEMVSYPINLVGVG--GPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRI   77 (383)
Q Consensus         5 ki~i~aGE~-----SGD~~~a~li~~Lk~~~~~~~~~~giG--G~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~   77 (383)
                      ||++++.+=     ....+..+|.++|.++ +.++.++..+  ++.........................   .......
T Consensus         1 KIl~i~~~~~P~~GG~e~~~~~la~~L~~~-Gh~V~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~   76 (375)
T cd03821           1 KILHVIPSFDPKYGGPVRVVLNLSKALAKL-GHEVTVATTDAGGDPLLVALNGVPVKLFSINVAYGLNLA---RYLFPPS   76 (375)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCCEEEECCCCCCCCCHHH---HHHHHHH
T ss_conf             989995988999998999999999999977-998999970798764310246751674166555420133---3222068


Q ss_pred             HHHHHHCCCCCCCEEEEECHHH-HHHHHHHHHHHHCCCCCCEEEECC--CCCCCCCCCHHH----------HHHHHHHHC
Q ss_conf             9998610012888689851177-657999986630134631111002--211003663557----------999998640
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPD-FTHRVAKRVRKKMPNLPIINYVCP--SVWAWREGRARK----------MCAYINQVI  144 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pg-Fnl~lak~lkk~~~~ipvi~yv~P--qvWAWr~~R~k~----------~~~~~d~~~  144 (383)
                      ..........+||++.+-+... +++..++.+++  .++|+++.+-=  .-|.+.....++          ..+..+.+.
T Consensus        77 ~~~~~~~~~~~~Dvi~~~~~~~~~~~~~~~~~~~--~~~p~i~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  154 (375)
T cd03821          77 LLAWLRLNIREADIVHVHGLWSYPSLAAARAARK--YGIPYVVSPHGMLDPWALPHKALKKRLAWFLFERRLLQAAAAVH  154 (375)
T ss_pred             HHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
T ss_conf             9999998548999999868625669999999998--49969999799860344443467888999999999874086999


Q ss_pred             CCCCCCHHHHHC-CCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHC
Q ss_conf             156774223200-2553147638821122100135588897618765565059985387430123051118999876402
Q gi|254780767|r  145 SILPFEKEVMQR-LGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKR  223 (383)
Q Consensus       145 ~ifpFE~~~f~k-~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~  223 (383)
                      +.-..+...... ..+-+++.+.|.+-...-...+....++..+..++++ +.++.| |-.+ .+....+++++..+.++
T Consensus       155 ~~s~~~~~~~~~~~~~~k~~vI~ngid~~~~~~~~~~~~~~~~~~~~~~~-~il~vG-Rl~~-~Kg~~~li~a~~~l~~~  231 (375)
T cd03821         155 ATSEQEAAEIRRLGLKAPIAVIPNGVDIPPFAALPSRGRRRKFPILPDKR-IILFLG-RLHP-KKGLDLLIEAFAKLAER  231 (375)
T ss_pred             ECCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHHHHCCCCCCCC-EEEEEE-ECCC-CHHHHHHHHHHHHHHHH
T ss_conf             76579999999628988889986972720148862378898548998983-899987-1343-21477899999999976


Q ss_pred             CCCCEEEECCCC--CHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEE
Q ss_conf             735126201663--3688999999604888505520----552035788763552331-----15668887627530254
Q gi|254780767|r  224 NPFFRFSLVTVS--SQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSI  292 (383)
Q Consensus       224 ~~~~~~~i~~~~--~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~  292 (383)
                      .+++++++....  ..+..++....++++..+|...    ..+....++.||+.+.+|     |.+.+|++.+|+|.| +
T Consensus       232 ~~~~~l~ivG~g~~~~~~~~~~~~~~~~l~~~V~f~G~~~~~~~~~~~~~adi~v~pS~~Egf~~~~lEAma~G~PvI-a  310 (375)
T cd03821         232 FPDWHLVIAGPDEGGYRAELKQIAAALGLEDRVTFTGMLYGEDKAAALADADLFVLPSHSENFGIVVAEALACGTPVV-T  310 (375)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCEECCCCHHHHHHHHHHHHHHCCCCEE-E
T ss_conf             798599999789826789999999982678558534776831109898515001468477664589999998599999-9


Q ss_pred             CCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHH-HHHC
Q ss_conf             057741000010246761023024407842612420548989999999998449899999999999999-9838
Q gi|254780767|r  293 YKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLW-DRMN  365 (383)
Q Consensus       293 Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~-~~Lg  365 (383)
                      ...+.+...               +.+..   -++..+ +++.+++++.++++|++.|+++-++.++.. ++..
T Consensus       311 s~~gg~~ei---------------i~~~~---g~~~~~-~~~~l~~~i~~l~~d~~~~~~~~~~ar~~~~~~fs  365 (375)
T cd03821         311 TDKVPWQEL---------------IEYGC---GWVVDD-DVDALAAALRRALELPQRLKAMGENGRALVEERFS  365 (375)
T ss_pred             CCCCCCHHE---------------EECCC---EEEECC-CHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             279980772---------------87884---899492-99999999999976999999999999999999589


No 20 
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
Probab=99.65  E-value=4.6e-12  Score=99.59  Aligned_cols=300  Identities=12%  Similarity=0.097  Sum_probs=172.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCH------HHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             4789999999999738998399997178------9994788065044453110136746645999999999986100128
Q gi|254780767|r   15 GDLLAGDLIKSLKEMVSYPINLVGVGGP------SLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSK   88 (383)
Q Consensus        15 GD~~~a~li~~Lk~~~~~~~~~~giGG~------~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~   88 (383)
                      ...+..+|+++|.+. +.++.+...+++      ..++.|.+...-..         ..   ....+.+..+.+.+++.+
T Consensus        14 aE~~~~~L~~~L~~~-g~~v~v~~~~~~~~~~~~~~~~~g~~v~~~~~---------~~---~~~~~~~~~l~~~i~~~~   80 (358)
T cd03812          14 IETFIMNYYRNLDRS-KIQFDFLVTSKEEGDYDDEIEKLGGKIYYIPA---------RK---KNPLKYFKKLYKLIKKNK   80 (358)
T ss_pred             HHHHHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHHHHCCCEEEECCC---------CC---CCHHHHHHHHHHHHHHCC
T ss_conf             899999999999876-99899999879876368999975997999389---------76---428999999999999839


Q ss_pred             CCEEEEE-CHHHHHHHHHHHHHHHCCCCCC-EEEE-C---CCCCCCCCCCH----HHHHHHHHHHCCCCCCCHH-HHHCC
Q ss_conf             8868985-1177657999986630134631-1110-0---22110036635----5799999864015677422-32002
Q gi|254780767|r   89 PDVLLIV-DNPDFTHRVAKRVRKKMPNLPI-INYV-C---PSVWAWREGRA----RKMCAYINQVISILPFEKE-VMQRL  157 (383)
Q Consensus        89 Pd~vi~i-D~pgFnl~lak~lkk~~~~ipv-i~yv-~---PqvWAWr~~R~----k~~~~~~d~~~~ifpFE~~-~f~k~  157 (383)
                      ||+|.+- .++.+-..++.++    .++|+ ++.. .   +.-+.|+....    +.+.+..|+.++.-....+ .|...
T Consensus        81 ~DiIh~h~~~~~~~~~~~~~~----~~~~~~I~h~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iavS~~~~~~l~~~~  156 (358)
T cd03812          81 YDIVHVHGSSASGFILLAAKK----AGVKVRIAHSHNTSDSHDKKKKILKYKVLRKLINRLATDYLACSEEAGKWLFGKV  156 (358)
T ss_pred             CCEEEECCCCHHHHHHHHHHH----CCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHC
T ss_conf             999998575068999999998----5999899985787445431678999999999999869999995889999997316


Q ss_pred             CCCCEEECCCCCC-CCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             5531476388211-221001355888976187655650599853874301230511189998764027351262016633
Q gi|254780767|r  158 GGPPTTFVGHPLS-SSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSS  236 (383)
Q Consensus       158 ~~~~~~fVGHPl~-d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~  236 (383)
                      ..-+++.+-|++- +.+.......+.+++.+..+++. +.+.-| |-.+. +..+.+++++..+.+++|++++++.....
T Consensus       157 ~~~ki~vI~NgId~~~~~~~~~~~~~~~~~~~~~~~~-vi~~vG-Rl~~~-Kg~~~Li~A~~~l~~~~~~~~l~ivG~G~  233 (358)
T cd03812         157 KNKKFKVIPNGIDLEKFIFNEEIRKKRRELGILEDKF-VIGHVG-RFSEQ-KNHEFLIEIFAELLKKNPNAKLLLVGDGE  233 (358)
T ss_pred             CCCCEEEECCCCCHHHCCCCHHHHHHHHHHCCCCCCE-EEEEEC-CCHHH-HCCHHHHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             8787899869807442387546689999838998986-999960-47665-17188999999865108882399962752


Q ss_pred             HHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCC
Q ss_conf             688999999604888505520--552035788763552331-----1566888762753025405774100001024676
Q gi|254780767|r  237 QENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTW  309 (383)
Q Consensus       237 ~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~  309 (383)
                      .++.++....+.++..+|...  .++..+.++.||+.+.+|     |.+.+|++.+|+| ||+..+......        
T Consensus       234 ~~~~l~~~i~~~~l~~~V~f~G~~~~~~~~~~~aDi~v~pS~~Egf~~v~lEAma~G~P-VVasd~gg~~~i--------  304 (358)
T cd03812         234 LEEEIKKKVKELGLEDKVIFLGVRNDVPELLQAMDVFLFPSLYEGLPLVLIEAQASGLP-CILSDTITKEVD--------  304 (358)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCEEEECCCCCCCCHHHHHHHHHCCC-EEEECCCCCCEE--------
T ss_conf             78789999998298724997467013789997398999748767884799999994998-999659997469--------


Q ss_pred             CEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             102302440784261242054898999999999844989999999
Q gi|254780767|r  310 TCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAML  354 (383)
Q Consensus       310 ~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~  354 (383)
                             +-+. +  .++-.+-+|+.+++++.++++|++ |+++-
T Consensus       305 -------i~~~-~--~~l~~~~~~~~~a~~I~~l~~~~~-~~~~~  338 (358)
T cd03812         305 -------LTDL-V--KFLSLDESPEIWAEEILKLKSEDR-RERSS  338 (358)
T ss_pred             -------EECC-C--CEEECCCCHHHHHHHHHHHHCCHH-HHHHH
T ss_conf             -------7299-5--579689999999999999865836-79999


No 21 
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
Probab=99.64  E-value=5.1e-13  Score=105.86  Aligned_cols=317  Identities=17%  Similarity=0.164  Sum_probs=182.5

Q ss_pred             EEEEEECCC--CH-HHHHHHHHHHHHHHCCCCEEEEEECCH--HHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             599997682--14-789999999999738998399997178--9994788065044453110136746645999999999
Q gi|254780767|r    5 KIAVIAGEI--SG-DLLAGDLIKSLKEMVSYPINLVGVGGP--SLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         5 ki~i~aGE~--SG-D~~~a~li~~Lk~~~~~~~~~~giGG~--~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      ||+++.+.-  .| ..+..+|+++|.++ +.++.+....+.  .-....       .............+..........
T Consensus         1 KIl~v~~~~~~GG~e~~~~~la~~L~~~-G~~V~vi~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~   72 (353)
T cd03811           1 KILFVIPSLGGGGAERVLLNLANGLDKR-GYDVTLVVLRDEGDYLELLP-------SNVKLIPVRVLKLKSLRDLLAILR   72 (353)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCHHHCC-------CCCEEEEECCCCCCCHHHHHHHHH
T ss_conf             9899969999915999999999999977-99799999779985133305-------673388613556553325999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCC----CCCC--CCCCHHHHHHHHHHHCCCCCCCHHH
Q ss_conf             986100128886898511776579999866301346311110022----1100--3663557999998640156774223
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPS----VWAW--REGRARKMCAYINQVISILPFEKEV  153 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pq----vWAW--r~~R~k~~~~~~d~~~~ifpFE~~~  153 (383)
                      +.+.+++.+||+++.-..+...+ .+...++  .++|+++++--.    .+.+  .....+...+.+|+++|+=++-.+.
T Consensus        73 l~~~i~~~~~DiI~~~~~~~~~~-~~~~~~~--~~~~~i~~~h~~~~~~~~~~~~~~~~~~~~~~~~d~ii~~S~~~~~~  149 (353)
T cd03811          73 LRRLLRKEKPDVVISHLTTTPNV-LALLAAR--LGTKLIVWEHNSLSLELKRKLRLLLLIRKLYRRADKIVAVSEGVKED  149 (353)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHH-HHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHH
T ss_conf             99999974998999988627899-9999974--79978999798704432334669999999998689999959999999


Q ss_pred             HHCCCCC---CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEE
Q ss_conf             2002553---1476388211221001355888976187655650599853874301230511189998764027351262
Q gi|254780767|r  154 MQRLGGP---PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFS  230 (383)
Q Consensus       154 f~k~~~~---~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~  230 (383)
                      +.+.-+.   +++.+-||+ |. .........+...+.+.+.. ..++.| |-... +....++++++.+.+++++++++
T Consensus       150 ~~~~~~~~~~~i~vI~Ngv-d~-~~~~~~~~~~~~~~~~~~~~-~il~vG-rl~~~-Kg~~~li~a~~~l~~~~~~~~l~  224 (353)
T cd03811         150 LLKLLGIPPDKIEVIYNPI-DI-EEIRALAEEPLELGIPPDGP-VILAVG-RLSPQ-KGFDTLIRAFALLRKEGPDARLV  224 (353)
T ss_pred             HHHHCCCCHHHEEEECCCC-CH-HHHCHHHHHHHHHCCCCCCE-EEEEEE-ECCCC-CCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             9986199856899976756-86-76232456545306889986-999982-07664-22999999999766418737999


Q ss_pred             ECCCCCHHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEE
Q ss_conf             016633688999999604888505520--552035788763552331-----1566888762753025405774100001
Q gi|254780767|r  231 LVTVSSQENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFI  303 (383)
Q Consensus       231 i~~~~~~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~  303 (383)
                      +......++.++....+.++...|...  .++..+.++.||+.+.+|     |-+.+|++.+|+|.| +...+.      
T Consensus       225 ivG~G~~~~~l~~~~~~~~l~~~V~~~G~~~d~~~~~~~~di~v~pS~~Egfg~~~lEAma~G~pvI-~s~~gg------  297 (353)
T cd03811         225 ILGDGPLREELEALAKELGLADRVHFLGFQSNPYPYLKAADLFVLSSRYEGFPNVLLEAMALGTPVV-ATDCPG------  297 (353)
T ss_pred             ECCCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCEEECCCCCCCCCHHHHHHHHCCCCEE-ECCCCC------
T ss_conf             7478603999997788659860687548664302324208688715434688538999998099899-948998------


Q ss_pred             ECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHH---HHHCCHHHHHHHHHHHH
Q ss_conf             024676102302440784---26124205489899999999---98449899999999999
Q gi|254780767|r  304 FYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIE---RLSQDTLQRRAMLHGFE  358 (383)
Q Consensus       304 ~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~---~ll~d~~~r~~~~~~~~  358 (383)
                               ++.++-+..   ++|     .-+++.+++.+.   ++++|++.|++|-++.+
T Consensus       298 ---------~~e~i~~g~~G~l~~-----~~d~~~la~~i~~l~~l~~~~~~~~~~g~~~~  344 (353)
T cd03811         298 ---------PREILEDGENGLLVP-----VGDEAALAAAALALLDLLLDPELRERLAAAAR  344 (353)
T ss_pred             ---------HHHHHCCCCCEEEEC-----CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             ---------489844898389978-----99999999999999851499999999999999


No 22 
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of  galactose alpha-1,6 linkages in amylovoran.
Probab=99.64  E-value=1e-13  Score=110.46  Aligned_cols=318  Identities=19%  Similarity=0.251  Sum_probs=185.3

Q ss_pred             EEEEEECC---CCH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHH-HHHHHHHHHHHHH
Q ss_conf             59999768---214-789999999999738998399997178999478806504445311013674-6645999999999
Q gi|254780767|r    5 KIAVIAGE---ISG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQV-VRHLPQFIFRINQ   79 (383)
Q Consensus         5 ki~i~aGE---~SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~ev-l~~~~~~~~~~~~   79 (383)
                      ||.++...   ..| ..+...|+++|.++ +.++.+....++.-.....     ...+.+..+... .......+.....
T Consensus         1 KIl~v~~~l~~~GG~e~~~~~la~~L~~~-G~~V~vit~~~~~~~~~~~-----~~~i~~~~~~~~~~~~~~~~~~~~~~   74 (348)
T cd03820           1 KILFVIPSLGNAGGAERVLSNLANALAEK-GHEVTIISLDKGEPPFYEL-----DPKIKVIDLGDKRDSKLLARFKKLRR   74 (348)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCCCCC-----CCCEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             98999797999987899999999999877-9989999966999864405-----89749998887654205678999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC--CCCCCCCCCC---HHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             9861001288868985117765799998663013463111100--2211003663---5579999986401567742232
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC--PSVWAWREGR---ARKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~--PqvWAWr~~R---~k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      +.+.++..+||+++.-......+ ++ .++.+  ++|+++..-  +..+-+...+   .+...+..|.+.++-.+....+
T Consensus        75 l~~~~~~~~~Dvi~~~~~~~~~~-~~-~~~~~--~~~~i~~~H~~~~~~~~~~~~~~~~~~~~~~~~~ii~~S~~~~~~~  150 (348)
T cd03820          75 LRKLLKNNKPDVVISFLTSLLTF-LA-SLGLK--IVKLIVSEHNSPDAYKKRLRRLLLRRLLYRRADAVVVLTEEDRALY  150 (348)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHH-HH-HHHCC--CCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHH
T ss_conf             99999975999999989636999-99-99759--9828999757856630136799999999986899999699999987


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      ....+-++..+-||+-....          ......+.+ +.++.| |-.+- +....+++++..+.++.|++++++...
T Consensus       151 ~~~~~~k~~vI~N~v~~~~~----------~~~~~~~~~-~il~vG-Rl~~~-Kg~~~li~a~~~l~~~~~~~~l~ivG~  217 (348)
T cd03820         151 YKKFNKNVVVIPNPLPFPPE----------EPSSDLKSK-RILAVG-RLVPQ-KGFDLLIEAWAKIAKKHPDWKLRIVGD  217 (348)
T ss_pred             HHCCCCCEEEECCCCCHHHC----------CCCCCCCCC-EEEEEE-CCCCC-CCHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             52378898998899882322----------654466798-899993-78632-494999888898886489859999946


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCC
Q ss_conf             33688999999604888505520--552035788763552331-----15668887627530254057741000010246
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIK  307 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik  307 (383)
                      ...++.++...++.++...+...  .++..+.++.||+.+.+|     |.+.+|++++|+|.| ++...           
T Consensus       218 G~~~~~l~~~i~~~~l~~~v~~~G~~~~~~~~~~~adv~v~pS~~Egfgl~~lEAma~G~PvI-as~~~-----------  285 (348)
T cd03820         218 GPEREALEALIKELGLEDRVILLGFTKNIEEYYAKASIFVLTSRFEGFPMVLLEAMAFGLPVI-SFDCP-----------  285 (348)
T ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEE-EECCC-----------
T ss_conf             875320156777633577364247522223322135753146412458708999998699999-96799-----------


Q ss_pred             CCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             76102302440784---26124205489899999999984498999999999999999838
Q gi|254780767|r  308 TWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       308 ~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
                         .+++.++.+..   ++|     .-+++.+++++..+++|++.++++.++.++..++..
T Consensus       286 ---gg~~e~v~~~~~G~l~~-----~~d~~~la~~i~~ll~~~~~~~~~~~~a~~~~~~fs  338 (348)
T cd03820         286 ---TGPSEIIEDGVNGLLVP-----NGDVEALAEALLRLMEDEELRKRMGANARESAERFS  338 (348)
T ss_pred             ---CCHHHHHCCCCEEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             ---88499953896299988-----999999999999997799999999999999999699


No 23 
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases. cap1E in Streptococcus pneumoniae is required for the synthesis of type 1 capsular polysaccharides.
Probab=99.63  E-value=4.2e-12  Score=99.81  Aligned_cols=320  Identities=18%  Similarity=0.213  Sum_probs=180.4

Q ss_pred             EEEEEECCCCH--HHHHHHHHHHHHHHCCCCEEEEEECCHH---HHHCCCEEE-ECHHHCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             59999768214--7899999999997389983999971789---994788065-04445311013674664599999999
Q gi|254780767|r    5 KIAVIAGEISG--DLLAGDLIKSLKEMVSYPINLVGVGGPS---LQKEGLVSL-FDFSELSVIGIMQVVRHLPQFIFRIN   78 (383)
Q Consensus         5 ki~i~aGE~SG--D~~~a~li~~Lk~~~~~~~~~~giGG~~---m~~~G~~~~-~~~~~l~v~G~~evl~~~~~~~~~~~   78 (383)
                      ||+.++- .+|  ..+...|+++|.++ +.++.+..-+++.   ..+.|++.. .+...-   ++     ...+.++.+.
T Consensus         1 kil~i~~-~~GG~e~~~~~La~~L~~~-Gh~V~vit~~~~~~~~~~~~gv~~~~~~~~~~---~~-----~~~~~~~~~~   70 (359)
T cd03808           1 KILHIVT-VDGGLYSFRLPLIKALRAA-GYEVHVVAPPGDELEELEALGVKVIPIPLDRR---GI-----NPFKDLKALL   70 (359)
T ss_pred             CEEEEEC-CCCHHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHCCCEEEEECCCCC---CC-----CHHHHHHHHH
T ss_conf             9899975-8765999999999999976-99999997079874336757988999278777---78-----8699999999


Q ss_pred             HHHHHCCCCCCCEEEEECH-HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCC-----CHH----HHHHHHHHHCCCCC
Q ss_conf             9986100128886898511-7765799998663013463111100221100366-----355----79999986401567
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDN-PDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREG-----RAR----KMCAYINQVISILP  148 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~-pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~-----R~k----~~~~~~d~~~~ifp  148 (383)
                      ++.+.+++.+||++.+-+. |++--.+|.++.+   ..|++|.+-=--|....+     ..+    ...+..|+++|+-+
T Consensus        71 ~l~~~i~~~~pDvIh~~~~~~~~~~~la~~~~~---~~~~v~~~h~~~~~~~~~~~~~~~~~~~~k~~~~~~~~ii~~S~  147 (359)
T cd03808          71 RLYRLLRKERPDIVHTHTPKPGILGRLAARLAG---VPKVIYTVHGLGFVFTSGGLKRRLYLLLERLALRFTDKVIFQNE  147 (359)
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCC---CCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             999999984998999906513578999998649---98699995677401245477899999999999964999999498


Q ss_pred             CCHHHHHCCC----CCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCC
Q ss_conf             7422320025----531476388211221001355888976187655650599853874301230511189998764027
Q gi|254780767|r  149 FEKEVMQRLG----GPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRN  224 (383)
Q Consensus       149 FE~~~f~k~~----~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~  224 (383)
                      ...+.+.+..    ...+.+.+++. |. ....     .......+ ++.+.++-| |-.+ .+....++++++.+.+++
T Consensus       148 ~~~~~~~~~~~~~~~~~~~i~~~gv-d~-~~~~-----~~~~~~~~-~~~~i~~vG-rl~~-~Kg~~~li~a~~~l~~~~  217 (359)
T cd03808         148 DDRDLALKLGIIKKKKTVLIPGSGV-DL-DRFS-----PSPEPIPE-DDPVFLFVA-RLLK-DKGIDELLEAARILKAKG  217 (359)
T ss_pred             HHHHHHHHHCCCCCCCEEEECCCCC-CH-HHCC-----CCCCCCCC-CCEEEEEEC-CCCH-HCCHHHHHHHHHHHHHHC
T ss_conf             9999999837997460899779976-86-6538-----66546898-984999980-4632-207399999999998639


Q ss_pred             CCCEEEECCCCCH-HHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCC
Q ss_conf             3512620166336-88999999604888505520--552035788763552331-----156688876275302540577
Q gi|254780767|r  225 PFFRFSLVTVSSQ-ENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       225 ~~~~~~i~~~~~~-~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~  296 (383)
                      +++++++...... .........+......+...  .++..+.++.||+.+.+|     |.+.+|++.+|+|.| +...+
T Consensus       218 ~~~~l~ivG~g~~~~~~~~~~~~~~~~~~~v~f~G~~~~~~~~~~~~di~v~pS~~Egf~~~~lEAma~G~PvI-~s~~g  296 (359)
T cd03808         218 PNVRLLLVGDGDEENPAAILEIEKLGLEGRVEFLGFRDDVPELLAAADVFVLPSYREGLPRVLLEAMAMGRPVI-ATDVP  296 (359)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHCCCCEE-ECCCC
T ss_conf             98089997688725899999999718898699807577899999960215787521357842899986699899-94899


Q ss_pred             CCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             410000102467610230244078426124205489899999999984498999999999999-999838
Q gi|254780767|r  297 WIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       297 ~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
                      ..               +.++.+.+-  =++-+.-+++.+++++..+++|++.++++-++..+ +.++..
T Consensus       297 g~---------------~e~i~~~~~--G~l~~~~d~~~la~~i~~ll~~~~~~~~~~~~a~~~~~~~fs  349 (359)
T cd03808         297 GC---------------REAVIDGVN--GFLVPPGDAEALADAIERLIEDPELRARMGQAARKRAEEEFD  349 (359)
T ss_pred             CH---------------HHHHHCCCC--EEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             72---------------888607981--899899999999999999988999999999999999998779


No 24 
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have
Probab=99.62  E-value=6.5e-12  Score=98.58  Aligned_cols=322  Identities=13%  Similarity=0.149  Sum_probs=186.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             47899999999997389983999971789994788065044453110136746645999999999986100128886898
Q gi|254780767|r   15 GDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI   94 (383)
Q Consensus        15 GD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~   94 (383)
                      ...+...|+++|.++ +.++.+...+|+.-...       ..+..........++...+.....++.+.+++++||++..
T Consensus        14 ~e~~~~~la~~L~~~-G~~V~v~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~pDvIh~   85 (360)
T cd04951          14 AEKQVVDLADQFVAK-GHQVAIISLTGESEVKP-------PIDATIILNLNMSKNPLSFLLALWKLRKILRQFKPDVVHA   85 (360)
T ss_pred             HHHHHHHHHHHHHHC-CCEEEEEEECCCCCCCC-------CCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             799999999999976-99899998179854443-------3457337863766676789999999999999829999998


Q ss_pred             EC-HHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHH-----HHHHHHHHCCCCCCCHHHHHCCC---CCCEEEC
Q ss_conf             51-177657999986630134631111002211003663557-----99999864015677422320025---5314763
Q gi|254780767|r   95 VD-NPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARK-----MCAYINQVISILPFEKEVMQRLG---GPPTTFV  165 (383)
Q Consensus        95 iD-~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~-----~~~~~d~~~~ifpFE~~~f~k~~---~~~~~fV  165 (383)
                      -. +++.-.++++..   ..+.|++...--.- .  .++.+.     ..+..|...++-....+.|-+..   .-++..+
T Consensus        86 h~~~~~~~~~~~~~~---~~~~~~i~t~h~~~-~--~~~~~~~~~~~~~~~~~~~~~vs~~~~~~~~~~~~~~~~ki~vI  159 (360)
T cd04951          86 HMFHANIFARLLRLF---LPSPPLICTAHSKN-E--GGRLRMLAYRLTDFLSDLTTNVSKEALDYFIASKAFNANKSFVV  159 (360)
T ss_pred             CCCCHHHHHHHHHHH---CCCCCEEEEECCCC-C--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEE
T ss_conf             663078999999985---79981999858887-5--41799999999988878652333999999998558884448996


Q ss_pred             CCCCC-CCCC-CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHH
Q ss_conf             88211-2210-013558889761876556505998538743012305111899987640273512620166336889999
Q gi|254780767|r  166 GHPLS-SSPS-ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRC  243 (383)
Q Consensus       166 GHPl~-d~~~-~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~  243 (383)
                      -|++- +.+. ........+.+++++++..+ .+..| |-.+ .+..+.+++++..+.++++++++++......++.++.
T Consensus       160 ~ngvd~~~f~~~~~~~~~~r~~~~~~~~~~~-il~vg-Rl~~-~Kg~~~li~a~~~l~~~~~~~~l~ivG~G~~~~~l~~  236 (360)
T cd04951         160 YNGIDTDRFRKDPARRLKIRNALGVKNDTFV-ILAVG-RLVE-AKDYPNLLKAFAKLLSDYLDIKLLIAGDGPLRATLER  236 (360)
T ss_pred             CCCCCHHHCCCCHHHHHHHHHHCCCCCCCEE-EEEEE-CCCC-CCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
T ss_conf             6873444218761567889986199989879-99984-0663-3115789999999986489979999678256788876


Q ss_pred             HHHHCCCCCEEEEEC--CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHH
Q ss_conf             996048885055205--52035788763552331-----15668887627530254057741000010246761023024
Q gi|254780767|r  244 IVSKWDISPEIIIDK--EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNL  316 (383)
Q Consensus       244 ~~~~~~~~~~i~~~~--~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNi  316 (383)
                      ..++.++..++....  ++..+.++.||+.+.+|     |.+.||++.+|+| ||++..+.+...+.   ..        
T Consensus       237 ~~~~~~l~~~v~f~G~~~d~~~~~~~adi~v~pS~~Egfg~~~lEAma~G~P-vI~s~~gg~~eii~---~~--------  304 (360)
T cd04951         237 LIKALGLSNRVKLLGLRDDIAAYYNAADLFVLSSAWEGFGLVVAEAMACELP-VVATDAGGVREVVG---DS--------  304 (360)
T ss_pred             HHHHHCCCCCEEECCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCC-EEECCCCCHHHEEC---CC--------
T ss_conf             6776177761542475102689876214255886557887089999985999-99878997265574---86--------


Q ss_pred             HCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH-HHHHHHCCCCCHHHHHHHH
Q ss_conf             407842612420548989999999998449899999999999-9999838999989999999
Q gi|254780767|r  317 IVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFE-NLWDRMNTKKPAGHMAAEI  377 (383)
Q Consensus       317 i~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~-~~~~~Lg~~~~a~~~AA~~  377 (383)
                        | -++|     .-+++.+++.+.++++|++.++++..+.. .+.++..    .++++.+.
T Consensus       305 --G-~lv~-----~~d~~~la~~i~~ll~~~~~~~~~~~~~~~~v~~~fs----~~~~~~~~  354 (360)
T cd04951         305 --G-LIVP-----ISDPEALANKIDEILKMSGEERDIIGARRERIVKKFS----INSIVQQW  354 (360)
T ss_pred             --E-EEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC----HHHHHHHH
T ss_conf             --4-9983-----9999999999999987919999999999999998699----99999999


No 25 
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.
Probab=99.61  E-value=1.9e-12  Score=102.04  Aligned_cols=313  Identities=14%  Similarity=0.108  Sum_probs=186.9

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC--C---HHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7899999999997389983999971--7---8999478806504445311013674664599999999998610012888
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVG--G---PSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPD   90 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giG--G---~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd   90 (383)
                      ..+...|+++|.+. +....+..+.  |   ++..+.|++... +..-.       ..    ....+.++.+.+++.+||
T Consensus        17 E~~~~~l~~~l~~~-~~~~~vi~~~~~~~~~~~~~~~~v~~~~-l~~~~-------~~----~~~~~~~l~~li~~~kpD   83 (374)
T TIGR03088        17 ENGLVNLINHLPAD-RYRHAVVALTEVSAFRKRIQRPDVAFYA-LHKQP-------GK----DVAVYPQLYRLLRQLRPD   83 (374)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEEECCCCHHHHHHHHCCCEEEE-CCCCC-------CC----CHHHHHHHHHHHHHHCCC
T ss_conf             99999999978875-9939999978984578999868988999-07887-------64----799999999999983984


Q ss_pred             EEEEECHHHHHHHHHHHHHHHCCCCCC-EEE------ECCCCCCCCCCCHHH-HHHHHHHHCCCCCCCHHHHHCCCCC--
Q ss_conf             689851177657999986630134631-111------002211003663557-9999986401567742232002553--
Q gi|254780767|r   91 VLLIVDNPDFTHRVAKRVRKKMPNLPI-INY------VCPSVWAWREGRARK-MCAYINQVISILPFEKEVMQRLGGP--  160 (383)
Q Consensus        91 ~vi~iD~pgFnl~lak~lkk~~~~ipv-i~y------v~PqvWAWr~~R~k~-~~~~~d~~~~ifpFE~~~f~k~~~~--  160 (383)
                      +|-.-+++.+...++..+.    ++|+ +|-      -.|.-+.|+....++ +..+.|+++|+-....+++.+.-++  
T Consensus        84 iIh~~~~~~~~~~~~~~~~----~~~~~i~~~h~~~~~~~~~~~~~~~~~~k~~~~~~~~~i~vs~~~~~~~~~~~~~~~  159 (374)
T TIGR03088        84 IVHTRNLAALEAQLPAALA----GVPARIHGEHGRDVFDLDGSNWKYRWLRRLYRPLIHHYVAVSRDLEDWLRGPVKVPP  159 (374)
T ss_pred             EEEECCHHHHHHHHHHHHC----CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHCCCH
T ss_conf             8986361169999999984----998899960787543743105899999999998568899915899999998709987


Q ss_pred             -CEEECCCCCC-CCC-CCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCC----CCEEEECC
Q ss_conf             -1476388211-221-0013558889761876556505998538743012305111899987640273----51262016
Q gi|254780767|r  161 -PTTFVGHPLS-SSP-SILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNP----FFRFSLVT  233 (383)
Q Consensus       161 -~~~fVGHPl~-d~~-~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~----~~~~~i~~  233 (383)
                       ++..+-|++- +.. +...++.+.+...+..++ +.+.+..| |-.+. +..+.++++...+.++.|    ++++++..
T Consensus       160 ~ki~~I~Ngid~~~f~~~~~~~~~~~~~~~~~~~-~~~i~~vg-Rl~~~-Kg~~~li~a~~~l~~~~~~~~~~~~l~i~G  236 (374)
T TIGR03088       160 AKIHQIYNGVDTERFHPSRGDRSPILPPDFFADE-SVVVGTVG-RLQAV-KDQPTLVRAFALLVRQLPEGAERLRLVIVG  236 (374)
T ss_pred             HHEEEECCCCCHHHCCCCCCCHHHHHHHCCCCCC-CEEEEEEE-ECEEE-CCHHHHHHHHHHHHHHCCCCCCCEEEEEEC
T ss_conf             8989966877652158773106776543158987-76999966-34030-787999999999998677766888999981


Q ss_pred             CCCHHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECC
Q ss_conf             633688999999604888505520--552035788763552331-----1566888762753025405774100001024
Q gi|254780767|r  234 VSSQENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYI  306 (383)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~li  306 (383)
                      ....+..+++...+.++...+.+.  ..+..+.++.||+.+.+|     |.+-+|++.+|+| ||++..+.         
T Consensus       237 ~G~~~~~l~~~i~~~~l~~~v~f~G~~~~~~~~~~~~Di~v~~S~~EGf~~~llEAma~g~P-vIasdvgg---------  306 (374)
T TIGR03088       237 DGPARGACEQMVRAAGLAHLVWLPGERDDVPALMQALDLFVLPSLAEGISNTILEAMASGLP-VIATAVGG---------  306 (374)
T ss_pred             CCCCHHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHCCCEEECCCCCCCCHHHHHHHHCCCC-EEECCCCC---------
T ss_conf             77659999999997187775853787468999999639003134434467799999975997-99918998---------


Q ss_pred             CCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHCC
Q ss_conf             67610230244078426124205489899999999984498999999999999-9998389
Q gi|254780767|r  307 KTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMNT  366 (383)
Q Consensus       307 k~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg~  366 (383)
                            .++++-+..- - ++-..-+++.+++++.++++|++.|+++-+..++ +.++...
T Consensus       307 ------~~eii~~~~~-G-~l~~~~d~~~la~~i~~ll~~~~~~~~~~~~a~~~v~~~Fs~  359 (374)
T TIGR03088       307 ------NPELVQHGVT-G-ALVPPGDAVALARALQPYVSDPAARRAHGAAGRARAEQQFSI  359 (374)
T ss_pred             ------HHHHHCCCCC-E-EEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCH
T ss_conf             ------1898617986-8-997899999999999999779999999999999999987899


No 26 
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
Probab=99.61  E-value=3.1e-12  Score=100.66  Aligned_cols=323  Identities=17%  Similarity=0.172  Sum_probs=187.8

Q ss_pred             EEEEEEC--CCC-HHHHHHHHHHHHHHHCCCCEEEEEEC--C---HHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHH
Q ss_conf             5999976--821-47899999999997389983999971--7---89994788065044453110136746645999999
Q gi|254780767|r    5 KIAVIAG--EIS-GDLLAGDLIKSLKEMVSYPINLVGVG--G---PSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFR   76 (383)
Q Consensus         5 ki~i~aG--E~S-GD~~~a~li~~Lk~~~~~~~~~~giG--G---~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~   76 (383)
                      ||+.+..  +.. +..+...|+++|.++ +.++.+....  |   +.....|++...    ++.-..   ...+    ..
T Consensus         1 KIl~v~~~l~~GG~e~~~~~la~~L~~~-g~~v~vi~~~~~~~~~~~~~~~~i~v~~----l~~~~~---~~~~----~~   68 (365)
T cd03807           1 KVLHVITGLDVGGAERMLVRLLKGLDRD-RFEHVVISLTDRGELGEELEEAGVPVYC----LGKRPG---RPDP----GA   68 (365)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCCCHHHHHHHCCCEEEE----CCCCCC---CCCH----HH
T ss_conf             9899969899941899999999999977-9949999957998557898748956999----278766---5688----99


Q ss_pred             HHHHHHHCCCCCCCEEEEEC-HHHHHHHHHHHHHHHCCCCCCEEEEC---CCCCCCCCCCHH----HHHHHHHHHCCCCC
Q ss_conf             99998610012888689851-17765799998663013463111100---221100366355----79999986401567
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVD-NPDFTHRVAKRVRKKMPNLPIINYVC---PSVWAWREGRAR----KMCAYINQVISILP  148 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD-~pgFnl~lak~lkk~~~~ipvi~yv~---PqvWAWr~~R~k----~~~~~~d~~~~ifp  148 (383)
                      +.++.+.+++.+||++.+-. .+.+--.++..+.+   .+|++|.+-   ...+.|.....+    .+.+..|+++|+-+
T Consensus        69 ~~~l~~~i~~~~~DiIh~~~~~~~~~~~l~~~~~~---~~~~i~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~S~  145 (365)
T cd03807          69 LLRLYKLIRRLRPDVVHTWMYHADLYGGLAARLAG---VPPVIWGIRHSDLDLGKKSTRLVARLRRLLSSFIPLIVANSA  145 (365)
T ss_pred             HHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHCC---CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             99999999983999999877426799999999759---982899956885321010579999999999842999999499


Q ss_pred             CCHHHHHCCC--CCCEEECCCCCC-CCC-CCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCC
Q ss_conf             7422320025--531476388211-221-001355888976187655650599853874301230511189998764027
Q gi|254780767|r  149 FEKEVMQRLG--GPPTTFVGHPLS-SSP-SILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRN  224 (383)
Q Consensus       149 FE~~~f~k~~--~~~~~fVGHPl~-d~~-~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~  224 (383)
                      ...+++.++.  .-++..+-|++- +.+ .........+++.+++++.. +.++.| |-.+ .+....+++++..+.+++
T Consensus       146 ~~~~~~~~~~~~~~~~~vI~ngid~~~~~~~~~~~~~~~~~~~~~~~~~-~i~~vG-rl~~-~Kg~~~li~a~~~l~~~~  222 (365)
T cd03807         146 AAAEYHQAIGYPPKKIVVIPNGVDTERFSPDLDARARLREELGLPEDTF-LIGIVA-RLHP-QKDHATLLRAAALLLKKF  222 (365)
T ss_pred             HHHHHHHHHCCCHHHEEEECCCCCHHHCCCCHHHHHHHHHHHCCCCCCE-EEEEEE-CCCC-CCHHHHHHHHHHHHHHHC
T ss_conf             9999999819984568998998678866987036799999829998886-999950-4653-101567889999988758


Q ss_pred             CCCEEEECCCCCHHH-HHHHHHHHCCCCCEEEEEC--CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCC
Q ss_conf             351262016633688-9999996048885055205--52035788763552331-----156688876275302540577
Q gi|254780767|r  225 PFFRFSLVTVSSQEN-LVRCIVSKWDISPEIIIDK--EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       225 ~~~~~~i~~~~~~~~-~~~~~~~~~~~~~~i~~~~--~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~  296 (383)
                      +++++++......+. ......+..++...+....  ++..+.++.||+.+.+|     |.+.+|++.+|+| ||+...+
T Consensus       223 ~~~~l~i~G~g~~~~~~~~~~~~~~~l~~~v~f~G~~~d~~~~~~~adi~v~pS~~Egf~~~~lEAma~G~P-vI~s~~g  301 (365)
T cd03807         223 PNARLLLVGDGPDRANLELLALKELGLEDKVILLGERSDVPALLNALDVFVLSSLSEGFPNVLLEAMACGLP-VVATDVG  301 (365)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCC-EEECCCC
T ss_conf             882799983785588999989997599873999366331899998716033887000533279999985999-9986799


Q ss_pred             CCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             410000102467610230244078426124205489899999999984498999999999999-999838
Q gi|254780767|r  297 WIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       297 ~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
                      .....               +-+..    ++-+.-+++.+++++.++++|++.+++|.++..+ +.++..
T Consensus       302 g~~ei---------------i~~~G----~l~~~~d~~~l~~~i~~l~~~~~~~~~~~~~a~~~~~~~fs  352 (365)
T cd03807         302 DNAEL---------------VGDTG----FLVPPGDPEALAEAIEALLADPALRQALGEAARERIEENFS  352 (365)
T ss_pred             CCHHE---------------ECCCE----EEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             84114---------------51767----99779999999999999977999999999999999998689


No 27 
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases. Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder.
Probab=99.60  E-value=1.4e-12  Score=102.95  Aligned_cols=313  Identities=13%  Similarity=0.143  Sum_probs=179.7

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC--CH---HHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7899999999997389983999971--78---999478806504445311013674664599999999998610012888
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVG--GP---SLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPD   90 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giG--G~---~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd   90 (383)
                      ..|...|.++|.++ +.++.+..-.  +.   +....|++..+-    ....+.. -..++.+...+..+.+.+..++||
T Consensus        17 e~~v~~La~~L~~~-Gh~V~Vit~~~~~~~~~~~~~~g~~V~~~----p~~~~~~-~~~~~~~~~~~~~~r~~~~~~~~D   90 (398)
T cd03796          17 ETHIYQLSQCLIKR-GHKVVVITHAYGNRVGIRYLTNGLKVYYL----PFVVFYN-QSTLPTFFGTFPLLRNILIRERIT   90 (398)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCEEECCCCEEEEC----CCCCCCC-CCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999976-99899996899988774685388469975----6633456-311677988899999999767998


Q ss_pred             EEEEECH-HHHHHHHHHHHHHHCCCCCCEEEECCCCCCC-------CCCCHHHHHHHHHHHCCCCCCCHHHH-HCC--CC
Q ss_conf             6898511-7765799998663013463111100221100-------36635579999986401567742232-002--55
Q gi|254780767|r   91 VLLIVDN-PDFTHRVAKRVRKKMPNLPIINYVCPSVWAW-------REGRARKMCAYINQVISILPFEKEVM-QRL--GG  159 (383)
Q Consensus        91 ~vi~iD~-pgFnl~lak~lkk~~~~ipvi~yv~PqvWAW-------r~~R~k~~~~~~d~~~~ifpFE~~~f-~k~--~~  159 (383)
                      +|-.=+. +.+.  ....+.++..|+|+++-. -+.|.+       ..+-.+...+..|+++|+-.+..+.+ .+.  ..
T Consensus        91 IIH~H~~~~~l~--~~~~~~ar~~g~~~V~T~-H~~~~~~~~~~~~~~~~~~~~l~~~d~vIavS~~~~e~~~~~~~~~~  167 (398)
T cd03796          91 IVHGHQAFSALA--HEALLHARTMGLKTVFTD-HSLFGFADASSIHTNKLLRFSLADVDHVICVSHTSKENTVLRASLDP  167 (398)
T ss_pred             EEEECCHHHHHH--HHHHHHHHHCCCCEEEEE-CCCCCCCCHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHCCCC
T ss_conf             899896268899--999999875599789983-44324463149999999999998579999997799999999848994


Q ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHH
Q ss_conf             31476388211221001355888976187655650599853874301230511189998764027351262016633688
Q gi|254780767|r  160 PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQEN  239 (383)
Q Consensus       160 ~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~  239 (383)
                      -+++.+-|.+ |.... .+..      .....++.+.++.| |-.+ .+.+..+++++..+.+++|+.++++.......+
T Consensus       168 ~ki~vIpNGV-d~~~f-~p~~------~~~~~~~~~il~vG-RL~~-~KG~d~Li~A~~~l~~~~p~~~lvIvGdGp~~~  237 (398)
T cd03796         168 ERVSVIPNAV-DSSDF-TPDP------SKRDNDKITIVVIS-RLVY-RKGIDLLVGIIPEICKKHPNVRFIIGGDGPKRI  237 (398)
T ss_pred             CCEEEECCCC-CHHHC-CCCC------CCCCCCCEEEEEEC-CCCC-HHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHH
T ss_conf             1099988957-47644-8872------21588986999970-6750-300999999999999658995999937871189


Q ss_pred             HHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCC
Q ss_conf             999999604888505520----552035788763552331-----15668887627530254057741000010246761
Q gi|254780767|r  240 LVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWT  310 (383)
Q Consensus       240 ~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~  310 (383)
                      .+++..++.++...|.+.    .++..++++.||+.+.+|     |.+.||++.+|+| ||+.+++.+...+        
T Consensus       238 ~L~~l~~~~~l~~~V~flG~v~~~~l~~~~~~aDvfv~PS~~Egfglv~lEAmA~G~P-VVat~vgG~~Evv--------  308 (398)
T cd03796         238 LLEEMREKYNLQDRVELLGAVPHERVRDVLVQGHIFLNTSLTEAFCIAIVEAASCGLL-VVSTRVGGIPEVL--------  308 (398)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHEEECCCCCCCCCHHHHHHHHCCCC-EEECCCCCCCCEE--------
T ss_conf             9999998723367289758885677788887744212765424666799999983998-9988899861134--------


Q ss_pred             EEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHCCC
Q ss_conf             0230244078426124205489899999999984498999999999999-99983899
Q gi|254780767|r  311 CALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMNTK  367 (383)
Q Consensus       311 i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg~~  367 (383)
                             -+...   ++- .-+++.+++++..+++|++.++++-++.++ +.++...+
T Consensus       309 -------~~~~~---~~~-~~d~~~la~~l~~ll~~~~~~~~~~~~~r~~v~~~fsw~  355 (398)
T cd03796         309 -------PPDMI---LLA-EPDVESIVRKLEEAISILRTGKHDPWSFHNRVKKMYSWE  355 (398)
T ss_pred             -------ECCCE---EEC-CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             -------18936---874-899999999999997699999999999999999969999


No 28 
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
Probab=99.58  E-value=6.2e-12  Score=98.70  Aligned_cols=305  Identities=16%  Similarity=0.178  Sum_probs=181.7

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCHH---HHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             7899999999997389983999971789---9947880650444531101367466459999999999861001288868
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVGGPS---LQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVL   92 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giGG~~---m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~v   92 (383)
                      ..+...|.++|.++ +.++.+..-+|+.   .+..|.+..         .+.-.-++.+...+.+..+.+.+++++||+|
T Consensus        13 E~~~~~La~~L~~~-Gh~V~vi~~~~~~~~~~~~~g~~~~---------~~~~~~~~~~~~~~~~~~l~~~l~~~~~Div   82 (355)
T cd03819          13 ERGTLELARALVER-GHRSLVASAGGRLVAELEAEGSRHI---------KLPFISKNPLRILLNVARLRRLIREEKVDIV   82 (355)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCHHHHHCCCEEE---------EECCCCCCCHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             99999999999987-9989999689987155663496699---------9178778828999999999999999699899


Q ss_pred             EEEC-HHHHHHHHHHHHHHHCCCCCCEEEEC---CCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCC---CEEEC
Q ss_conf             9851-17765799998663013463111100---22110036635579999986401567742232002553---14763
Q gi|254780767|r   93 LIVD-NPDFTHRVAKRVRKKMPNLPIINYVC---PSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGP---PTTFV  165 (383)
Q Consensus        93 i~iD-~pgFnl~lak~lkk~~~~ipvi~yv~---PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~---~~~fV  165 (383)
                      .+-. .|+|...+|.+.    .++|+++.+-   +.-|.|     +.+....|.++++-.+-.+.+.+..++   +++.|
T Consensus        83 h~h~~~~~~~~~~a~~~----~~~~~i~t~H~~~~~~~~~-----~~~~~~~~~~i~~S~~~~~~~~~~~~~~~~ki~vI  153 (355)
T cd03819          83 HARSRAPAWSAYLAARR----TRPPFVTTVHGFYSVNFRY-----NAIMARGDRVIAVSNFIADHIRENYGVDPDRIRVI  153 (355)
T ss_pred             EECCCCHHHHHHHHHHH----CCCCEEEEECCCCCHHHHH-----HHHHHHCCEEEEECHHHHHHHHHHHCCCHHHEEEE
T ss_conf             97786449999999985----3997899967877406799-----99997279899945899999999739987899997


Q ss_pred             CCCCCC-CCCC----CCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCC----
Q ss_conf             882112-2100----1355888976187655650599853874301230511189998764027351262016633----
Q gi|254780767|r  166 GHPLSS-SPSI----LEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSS----  236 (383)
Q Consensus       166 GHPl~d-~~~~----~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~----  236 (383)
                      -|++-. .+..    .......+.+.+..++.+ +.++-| |-.+ .+....+++++..+.++.|+.++++.....    
T Consensus       154 ~ngid~~~f~~~~~~~~~~~~~~~~~~~~~~~~-~i~~vG-Rl~~-~Kg~~~li~a~~~l~~~~~~~~l~i~G~g~~~~~  230 (355)
T cd03819         154 PRGVDLDRFDPGAVPPERILALAREWPLPKGKP-VILLPG-RLTR-WKGQEVFIEALARLKKDDPDVHLLIVGDAQGRRF  230 (355)
T ss_pred             CCCCCHHHCCCCCCCHHHHHHHHHHCCCCCCCE-EEEEEC-CCCC-CCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCHH
T ss_conf             887565423877787788999998628999987-999961-6654-4576999999999986489979999707864168


Q ss_pred             HHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCC------HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCC
Q ss_conf             688999999604888505520--552035788763552331------156688876275302540577410000102467
Q gi|254780767|r  237 QENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAAS------GTVILELALCGIPVVSIYKSEWIVNFFIFYIKT  308 (383)
Q Consensus       237 ~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~S------GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~  308 (383)
                      ....+.......++...|...  .++..++++.||+.+.+|      |.+.+|++.+|+| ||++..+.+          
T Consensus       231 ~~~~~~~~~~~~~l~~~v~f~G~~~d~~~~~~~adi~v~pS~~~Egf~~vllEAma~G~P-vV~s~~gg~----------  299 (355)
T cd03819         231 YYAELLELIKRLGLQDRVTFVGHCSDMPAAYALADIVVSASTEPEAFGRTAVEAQAMGRP-VIASDHGGA----------  299 (355)
T ss_pred             HHHHHHHHHHHCCCCCCEEECCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCC-EEEECCCCC----------
T ss_conf             999999999981997628865762146899874032558877710000789999986998-999089994----------


Q ss_pred             CCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHC-CHHHHHHHHHHHHHH
Q ss_conf             6102302440784261242054898999999999844-989999999999999
Q gi|254780767|r  309 WTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQ-DTLQRRAMLHGFENL  360 (383)
Q Consensus       309 ~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~-d~~~r~~~~~~~~~~  360 (383)
                           +.++.+.+ .- ++-+..+++.+++.+.++++ |++.|+++-++.++-
T Consensus       300 -----~eii~~~~-~G-~l~~~~d~~~l~~~i~~~l~~~~~~r~~~~~~ar~~  345 (355)
T cd03819         300 -----RETVRPGE-TG-LLVPPGDAEALAQALDQILSLLPEGRAKMFAKARMC  345 (355)
T ss_pred             -----HHHCCCCC-CE-EEECCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             -----76615899-78-998899999999999999869999999999999999


No 29 
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
Probab=99.58  E-value=1.6e-11  Score=95.94  Aligned_cols=319  Identities=17%  Similarity=0.160  Sum_probs=180.8

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC--CHH--HH--HCCCEEE-ECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC--CC
Q ss_conf             7899999999997389983999971--789--99--4788065-04445311013674664599999999998610--01
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVG--GPS--LQ--KEGLVSL-FDFSELSVIGIMQVVRHLPQFIFRINQTVELI--VS   86 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giG--G~~--m~--~~G~~~~-~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i--~~   86 (383)
                      ..|...|.++|.++ +.++.++.-.  +..  ..  ..|+..+ .+......+.--+...++..+   ...+.+.+  ..
T Consensus        24 e~~v~~La~~L~~~-GH~V~V~t~~~~~~~~~~~~~~~gv~v~rl~~~~~~~~~~~~l~~~l~~~---~~~~~~~~~~~~   99 (398)
T cd03800          24 NVYVLELARALARL-GHEVDIFTRRIDDALPPIVELAPGVRVVRVPAGPAEYLPKEELWPYLDEF---ADDLLRFLRREG   99 (398)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCEEEECCCEEEEEECCCCCCCCCHHHHHHHHHHH---HHHHHHHHHHHC
T ss_conf             99999999999986-99699997247778888068249869999557885433277778789999---999999999838


Q ss_pred             CCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC--------CCCCCCCC---CCH---HHHHHHHHHHCCCCCCCHH
Q ss_conf             288868985117765799998663013463111100--------22110036---635---5799999864015677422
Q gi|254780767|r   87 SKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC--------PSVWAWRE---GRA---RKMCAYINQVISILPFEKE  152 (383)
Q Consensus        87 ~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~--------PqvWAWr~---~R~---k~~~~~~d~~~~ifpFE~~  152 (383)
                      .+||+|..=++.+ ++ ++..+++. .++|+++-.=        ...+.|..   .|.   +..-+.+|++++.-+++.+
T Consensus       100 ~~pDvIH~h~~~~-~~-~~~~~~~~-~~ip~V~t~H~l~~~~~~~~~~~~~~~~~~r~~~e~~~~~~ad~via~S~~~~~  176 (398)
T cd03800         100 GRPDLIHAHYWDS-GL-VALLLARR-LGIPLVHTFHSLGAVKRRHLGAADTYEPARRIEAEERLLRAADRVIASTPQEAE  176 (398)
T ss_pred             CCCCEEEECCCCH-HH-HHHHHHHH-HCCCEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCEEEECCHHHHH
T ss_conf             9988899888407-89-99999997-199999963751144433202355423478999999999849999987999999


Q ss_pred             HHHCCCCC---CEEECCCCC-CCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             32002553---147638821-12210013558889761876556505998538743012305111899987640273512
Q gi|254780767|r  153 VMQRLGGP---PTTFVGHPL-SSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       153 ~f~k~~~~---~~~fVGHPl-~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
                      ...+..+.   +++.+-|-+ .+.+.+.......+.+.+..+++++|+ +-| |-. -.+.++.+++++..+.+.+++.+
T Consensus       177 ~~~~~~~~~~~~i~vI~nGvd~~~f~p~~~~~~~~~~~~~~~~~~~i~-~vG-Rl~-~~Kg~~~li~A~~~l~~~~~~~~  253 (398)
T cd03800         177 ELYSLYGAYPRRIRVVPPGVDLERFTPYGRAEARRARLLRDPDKPRIL-AVG-RLD-PRKGIDTLIRAYAELPELRERAN  253 (398)
T ss_pred             HHHHHHCCCCCCEEEECCCCCHHHCCCCCCHHHHHHHHCCCCCCCEEE-EEC-CCC-HHCCHHHHHHHHHHHHHHCCCCE
T ss_conf             999972999022899769867744388980589998608998994899-982-896-02098999999999887789968


Q ss_pred             EEECCCCC------HHHHHHHHHHHCCCCCEEEEEC----CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEEC
Q ss_conf             62016633------6889999996048885055205----52035788763552331-----156688876275302540
Q gi|254780767|r  229 FSLVTVSS------QENLVRCIVSKWDISPEIIIDK----EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIY  293 (383)
Q Consensus       229 ~~i~~~~~------~~~~~~~~~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Y  293 (383)
                      +++...+.      .....+...+..+....+.+..    ++..++|+.||+.+..|     |.+.||++.+|+| ||++
T Consensus       254 l~ivGg~~~~~~~~~~~~~~~~~~~~~l~~~V~f~G~~~~~~~~~~~~~adv~v~pS~~E~fgl~~lEAma~G~P-vIas  332 (398)
T cd03800         254 LVIVGGPRDDILAMDEEELRELARELGVIDRVDFPGRVSREDLPALYRAADVFVNPALYEPFGLTALEAMACGLP-VVAT  332 (398)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHCCCC-EEEC
T ss_conf             999968876531345999999999759987499889899899999998578887545133221489999982999-9993


Q ss_pred             CCCCCEEEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHC
Q ss_conf             5774100001024676102302440784---26124205489899999999984498999999999999-999838
Q gi|254780767|r  294 KSEWIVNFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMN  365 (383)
Q Consensus       294 k~~~lt~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg  365 (383)
                      ..+.+...               +.+.+   ++|     .-+++.+++.+.++++|++.++++-++.++ +.++..
T Consensus       333 ~~gg~~e~---------------v~~g~~G~l~~-----~~d~~~la~ai~~ll~d~~~~~~~g~~ar~~~~~~fs  388 (398)
T cd03800         333 AVGGPRDI---------------VVDGVTGLLVD-----PRDPEALAAALRRLLTDPALRRRLSRAGLRRARARYT  388 (398)
T ss_pred             CCCCCHHH---------------HCCCCEEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             89980777---------------41797189978-----9999999999999977999999999999999998689


No 30 
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=99.58  E-value=4.5e-13  Score=106.25  Aligned_cols=322  Identities=17%  Similarity=0.158  Sum_probs=179.1

Q ss_pred             EEEEEECC----C-CHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             59999768----2-147899999999997389983999971789994788065044453110136746645999999999
Q gi|254780767|r    5 KIAVIAGE----I-SGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         5 ki~i~aGE----~-SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      ||.+++.+    . ....+..+|.++|.++ +.++.+..-++..-...... .........-.    ...+.........
T Consensus         1 kIl~i~~~f~P~~GG~e~~~~~la~~L~~~-Gh~V~v~t~~~~~~~~~~~~-~~~~~~~~~~~----~~~~~~~~~~~~~   74 (364)
T cd03814           1 RIAIVTDTFLPQVNGVVRTLQRLVEHLRAR-GHEVLVIAPGPFRESEGPAR-VVPVPSVPLPG----YPEIRLALPPRRR   74 (364)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCC-EEEEEEEECCC----CCCCEECCCHHHH
T ss_conf             989993888999884999999999999977-99899997899765555663-46786674688----8763002032999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC---CCCCCC--CCCC-------HHHHHHHHHHHCCCC
Q ss_conf             9861001288868985117765799998663013463111100---221100--3663-------557999998640156
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC---PSVWAW--REGR-------ARKMCAYINQVISIL  147 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~---PqvWAW--r~~R-------~k~~~~~~d~~~~if  147 (383)
                      +.+.+++.+||+|.+-+ |++--..|..+.+. .++|++...-   |+.+..  +.+.       .+.+-+.+|.+++.=
T Consensus        75 ~~~~~~~~~pDiIh~~~-~~~~~~~a~~~~~~-~~ip~i~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~S  152 (364)
T cd03814          75 VRRLLDAFAPDVVHIAT-PGPLGLAALRAARR-LGIPVVTSYHTDFPEYLRYYGLGPLSWLAWAYLRWFHNRADRVLVPS  152 (364)
T ss_pred             HHHHHHHCCCCEEEECC-CCHHHHHHHHHHHH-CCCCEEEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             99999865999999878-41678999999997-59978999747648887760320568999999999985079999899


Q ss_pred             CCCHHHHHCCCCCCEEECCCCC-CCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCC
Q ss_conf             7742232002553147638821-122100135588897618765565059985387430123051118999876402735
Q gi|254780767|r  148 PFEKEVMQRLGGPPTTFVGHPL-SSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPF  226 (383)
Q Consensus       148 pFE~~~f~k~~~~~~~fVGHPl-~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~  226 (383)
                      ++..+...+...-++..+.|.+ .+.+.+.......++..+ . +.+.+.++-| |-.. .+.+..+++++..+.+ .++
T Consensus       153 ~~~~~~~~~~~~~~~~vi~nGvd~~~f~p~~~~~~~~~~~~-~-~~~~~i~~vG-rl~~-~Kg~~~ll~a~~~l~~-~~~  227 (364)
T cd03814         153 PSLADELRARGFRRVRLWPRGVDTELFHPRRRDEALRARLG-P-PDRPVLLYVG-RLAP-EKNLEALLDADLPLRR-RPP  227 (364)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHCCCCCCCHHHHHHCC-C-CCCCEEEEEE-CCCC-CCCHHHHHHHHHHHHC-CCC
T ss_conf             99999998509988899689616988487543266653026-8-9983899964-5755-5789999999997300-588


Q ss_pred             CEEEECCCCCHHHHHHHHHHHCCCCCEEEE----ECCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCC
Q ss_conf             126201663368899999960488850552----0552035788763552331-----1566888762753025405774
Q gi|254780767|r  227 FRFSLVTVSSQENLVRCIVSKWDISPEIII----DKEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEW  297 (383)
Q Consensus       227 ~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~----~~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~  297 (383)
                      +++++......++.++.    ...  ++.+    ..++..+.++.||+.+.+|     |.+.+|++.+|+|.| +...+.
T Consensus       228 ~~l~ivG~G~~~~~l~~----~~~--~v~f~G~~~~~el~~~~~~adi~v~pS~~E~fg~~~lEAma~G~PvI-~s~~gg  300 (364)
T cd03814         228 VRLVIVGDGPARARLEA----RYP--NVHFLGFLDGEELAAAYASADVFVFPSRTETFGLVVLEAMASGLPVV-APDAGG  300 (364)
T ss_pred             EEEEEECCCCCHHHHHH----CCC--CEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEE-ECCCCC
T ss_conf             59999847633999985----189--87990789989999999824756788653457657999998399899-958997


Q ss_pred             CEEEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             100001024676102302440784---261242054898999999999844989999999999999998389
Q gi|254780767|r  298 IVNFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNT  366 (383)
Q Consensus       298 lt~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~  366 (383)
                      +..               ++-+.+   ++|     .-+++.+++++..+++|++.|++|-++.++..++...
T Consensus       301 ~~E---------------iv~~~~~G~l~~-----~~d~~~la~~i~~l~~~~~~~~~mg~~ar~~~~~~~w  352 (364)
T cd03814         301 PAD---------------IVTDGENGLLVE-----PGDAEAFAAALAALLADPELRRRMAARARAEAERRSW  352 (364)
T ss_pred             HHH---------------HHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCH
T ss_conf             488---------------831798289979-----9999999999999976999999999999999996899


No 31 
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
Probab=99.58  E-value=2e-12  Score=101.91  Aligned_cols=324  Identities=16%  Similarity=0.199  Sum_probs=180.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCC---EEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH--CCCCCCC
Q ss_conf             7899999999997389983999971789994788---0650444531101367466459999999999861--0012888
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGL---VSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL--IVSSKPD   90 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~---~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~--i~~~~Pd   90 (383)
                      ..+.-.|+++|.++ +.++.+...+...-.....   ..............................+.+.  ....+||
T Consensus        17 e~~~~~la~~L~~~-G~~V~Vit~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~D   95 (377)
T cd03798          17 GIFVKELARALAKR-GVEVTVLAPGPWGPKLLDLLKGRLVGVERLPVLLPVVPLLKGPLLYLLAARALLKLLKLKRFRPD   95 (377)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999977-99699995379875312312575200034454554443310466778999999999997469986


Q ss_pred             EEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCCCC-----HHHHHHHHHHHCCCCCCCHHHHHCCC--CCCE
Q ss_conf             6898511776579999866301346311110-02211003663-----55799999864015677422320025--5314
Q gi|254780767|r   91 VLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWREGR-----ARKMCAYINQVISILPFEKEVMQRLG--GPPT  162 (383)
Q Consensus        91 ~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~~R-----~k~~~~~~d~~~~ifpFE~~~f~k~~--~~~~  162 (383)
                      +|..- ++-+..-++..+++. .++|+++.+ ...+|.|...+     .+..-+..|+++++-+...+.+.+..  +-++
T Consensus        96 vI~~~-~~~~~~~~~~~~~~~-~~~~~v~~~h~~~~~~~~~~~~~~~~~~~~~~~ad~ii~~S~~~~~~~~~~~~~~~~i  173 (377)
T cd03798          96 LIHAH-FAYPDGFAAALLKRK-LGIPLVVTLHGSDVNLLPRKRLLRALLRRALRRADAVIAVSEALADELKALGIDPEKV  173 (377)
T ss_pred             EEEEC-CCCHHHHHHHHHHHH-CCCCEEEEECCCHHHHCCCCHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHCCCCCCE
T ss_conf             89978-840679999999997-3998899967741431023168999999999858999988989999999858996559


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHH
Q ss_conf             76388211221001355888976187655650599853874301230511189998764027351262016633688999
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVR  242 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~  242 (383)
                      ..+.|.+ |...............+...++ .+.++-|. -.+ .+.+..+++++..+.++++++++++.......+.++
T Consensus       174 ~vi~ngi-d~~~f~~~~~~~~~~~~~~~~~-~~i~~~Gr-l~~-~Kg~~~li~a~~~l~~~~~~~~l~i~G~g~~~~~l~  249 (377)
T cd03798         174 TVIPNGV-DTERFSPADRAEARKLGLPEDK-KVILFVGR-LVP-RKGIDYLIEALARLLKKRPDVHLVIVGDGPLREALE  249 (377)
T ss_pred             EEECCCC-CHHHCCCCCHHHHHHHCCCCCC-EEEEEEEE-CCC-CCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHH
T ss_conf             9988975-7875498877789860899998-59999824-520-018289999999988748885224326827888999


Q ss_pred             HHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEE
Q ss_conf             999604888505520----552035788763552331-----15668887627530254057741000010246761023
Q gi|254780767|r  243 CIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCAL  313 (383)
Q Consensus       243 ~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~L  313 (383)
                      ...++.++..+|...    .++..+.++.||+.+..|     |.+.+|++.+|+| ||+...+.+.              
T Consensus       250 ~~~~~~~l~~~v~~~g~v~~~~~~~~~~~adv~v~pS~~E~~~~~~lEama~G~P-vI~~~~gg~~--------------  314 (377)
T cd03798         250 ALAAELGLEDRVTFLGAVPHEEVPAYYAAADVFVLPSLREGFGLVLLEAMACGLP-VVATDVGGIP--------------  314 (377)
T ss_pred             HHHHHCCCCCEEEECCCEEHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC-EEECCCCCHH--------------
T ss_conf             9988618873698605210010101333377413785576512558999975997-9995899869--------------


Q ss_pred             EHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0244078426124205489899999999984498999999999999999838
Q gi|254780767|r  314 PNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       314 pNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
                       .++-+..- = ++-+.-+++.+++.+.++++|+..+ ...++.+.+.++..
T Consensus       315 -e~i~~~~~-G-~~~~~~~~~~l~~~i~~l~~~~~~~-~~~~~~~~~~~~fs  362 (377)
T cd03798         315 -EIITDGEN-G-LLVPPGDPEALAEAILRLLADPWLR-LGRAARRRVAERFS  362 (377)
T ss_pred             -HHHCCCCE-E-EEECCCCHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHHCC
T ss_conf             -98517974-9-9979999999999999998799999-99999999998699


No 32 
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases. wbuB in E. coli is involved in the biosynthesis of the O26 O-antigen.  It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
Probab=99.55  E-value=6.7e-12  Score=98.50  Aligned_cols=333  Identities=15%  Similarity=0.176  Sum_probs=182.8

Q ss_pred             EEEEEECCC-----CHHHHHHHHHHHHHHHCCCCEEEEEEC--CHHHHH---------CCCEEE-ECHHHCCEEEHHHHH
Q ss_conf             599997682-----147899999999997389983999971--789994---------788065-044453110136746
Q gi|254780767|r    5 KIAVIAGEI-----SGDLLAGDLIKSLKEMVSYPINLVGVG--GPSLQK---------EGLVSL-FDFSELSVIGIMQVV   67 (383)
Q Consensus         5 ki~i~aGE~-----SGD~~~a~li~~Lk~~~~~~~~~~giG--G~~m~~---------~G~~~~-~~~~~l~v~G~~evl   67 (383)
                      ||++++.+-     ++..+...|.++|.++ +.++.+..-.  .+....         .|++.. ++.....-.+...-+
T Consensus         1 KIlii~~~fpP~~gG~~~~~~~la~~L~~~-Gh~V~v~t~~~~~~~~~~~~~~~~~~~~gi~v~r~~~~~~~~~~~~~~~   79 (394)
T cd03794           1 KILILSQYFPPELGGGAFRTTELAEELVKR-GHEVTVITGSPNYPSGKIYKGYKREEVDGVRVHRVPLPPYKKNGLLKRL   79 (394)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCCEEEECCEEEEEECCCCCCCCCHHHHH
T ss_conf             989991777898982999999999999977-9979999547877643235666446648859999337766775278899


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC---CC----CCCCCCCC--H-----
Q ss_conf             6459999999999861001288868985117765799998663013463111100---22----11003663--5-----
Q gi|254780767|r   68 RHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC---PS----VWAWREGR--A-----  133 (383)
Q Consensus        68 ~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~---Pq----vWAWr~~R--~-----  133 (383)
                      .....+... ..........+||+|+....|.|....+..+++. .++|+++.+-   |+    .+..+.++  .     
T Consensus        80 ~~~~~~~~~-~~~~~~~~~~~~Div~~~~~~~~~~~~~~~~~~~-~~~p~v~~~hd~~p~~~~~~~~~~~~~~~~~~~~~  157 (394)
T cd03794          80 LNYLSFALS-ALLALLKRRRRPDVIIATSPPLLIALAALLLARL-KGAPFVLEVRDLWPESAVALGLLKNGSLLYRLLRK  157 (394)
T ss_pred             HHHHHHHHH-HHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHH-CCCCEEEEECCCCHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             999999999-9999998558998899917847889999999986-39969999687446789983674444489999999


Q ss_pred             --HHHHHHHHHHCCCCCCCHHHHHCCCCC---CEEECCCCCCC-CCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHH
Q ss_conf             --579999986401567742232002553---14763882112-210013558889761876556505998538743012
Q gi|254780767|r  134 --RKMCAYINQVISILPFEKEVMQRLGGP---PTTFVGHPLSS-SPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIY  207 (383)
Q Consensus       134 --k~~~~~~d~~~~ifpFE~~~f~k~~~~---~~~fVGHPl~d-~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~  207 (383)
                        +.+-+..|++++.=+...+.+.+. +.   ++..+-|..-. .+... ............++. .+.++-|+ -.+ .
T Consensus       158 ~~~~~~~~ad~vi~~S~~~~~~~~~~-~~~~~~i~vipngvd~~~~~~~-~~~~~~~~~~~~~~~-~~i~~~Gr-l~~-~  232 (394)
T cd03794         158 LERLIYRRADAIVVISPGMREYLVRR-GVPPEKISVIPNGVDLELFKPP-PADESLRKELGLDDK-FVVLYAGN-IGR-A  232 (394)
T ss_pred             HHHHHHHHCCEEEECCHHHHHHHHHH-CCCCCCEEEEECCCCHHHCCCC-CCHHHHHHHCCCCCC-EEEEEEEE-CCC-C
T ss_conf             99999984899997729999999984-8992309999476257652777-504777874268998-59999611-100-0


Q ss_pred             HHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCC-----C-HH
Q ss_conf             30511189998764027351262016633688999999604888505520----55203578876355233-----1-15
Q gi|254780767|r  208 KILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAA-----S-GT  277 (383)
Q Consensus       208 ~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~-----S-GT  277 (383)
                      +.++.++++++.+. ..|++++++.......+.++......+.+ +|.+.    .++..+.++.||+.+..     + |.
T Consensus       233 kg~~~li~a~~~l~-~~~~~~l~ivG~G~~~~~l~~~~~~~~~~-~V~~~G~v~~~~~~~~~~~adi~v~p~~~~~~~~~  310 (394)
T cd03794         233 QGLDTLLEAAALLK-DRPDIRFLIVGDGPEKEELKELAKALGLD-NVTFLGRVPKEELPELLAAADVGLVPLKPGPAFEG  310 (394)
T ss_pred             CCCHHHHHHHHHHC-CCCCEEEEEECCCHHHHHHHHHHHHCCCC-EEEECCCCCCCHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             36379999999745-58985999956851678999999981999-49981630461367787429699992777544577


Q ss_pred             H----HHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             6----688876275302540577410000102467610230244078426124205489899999999984498999999
Q gi|254780767|r  278 V----ILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAM  353 (383)
Q Consensus       278 a----TLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~  353 (383)
                      +    .+|++.+|+|.| +...+.+...               +-+...  -++-+.-+++.+++.+..+++|++.|++|
T Consensus       311 ~~P~kllEAma~G~PVV-~s~~gg~~e~---------------i~~~~~--G~l~~~~d~~~la~~i~~ll~d~~~~~~~  372 (394)
T cd03794         311 VSPSKLFEYMAAGKPVL-ASVDGESAEL---------------VEEAGA--GLVVPPGDPEALAAAILELLDDPEERAEM  372 (394)
T ss_pred             CCHHHHHHHHHCCCCEE-EECCCCHHHH---------------EECCCE--EEEECCCCHHHHHHHHHHHHCCHHHHHHH
T ss_conf             35689999998499799-9589980776---------------121880--89977999999999999997799999999


Q ss_pred             HHHHHHH-HHHHC
Q ss_conf             9999999-99838
Q gi|254780767|r  354 LHGFENL-WDRMN  365 (383)
Q Consensus       354 ~~~~~~~-~~~Lg  365 (383)
                      -++.++. .++..
T Consensus       373 ~~~ar~~~~~~fs  385 (394)
T cd03794         373 GENGRRYVEEKFS  385 (394)
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999998589


No 33 
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
Probab=99.53  E-value=5e-12  Score=99.30  Aligned_cols=325  Identities=16%  Similarity=0.159  Sum_probs=182.9

Q ss_pred             EEEEEECC----CCH--HHHHHHHHHHHHHHCCCCEEEEEECCHHHH----HCCCEEEECHHHCCEEE--HHHHHHHH-H
Q ss_conf             59999768----214--789999999999738998399997178999----47880650444531101--36746645-9
Q gi|254780767|r    5 KIAVIAGE----ISG--DLLAGDLIKSLKEMVSYPINLVGVGGPSLQ----KEGLVSLFDFSELSVIG--IMQVVRHL-P   71 (383)
Q Consensus         5 ki~i~aGE----~SG--D~~~a~li~~Lk~~~~~~~~~~giGG~~m~----~~G~~~~~~~~~l~v~G--~~evl~~~-~   71 (383)
                      ||.+++.+    ..|  ..+...|.++|.++ +.++.+...+.....    ..+..............  ........ .
T Consensus         1 rIl~vt~~~pP~~~GG~e~~~~~la~~L~~~-Gh~V~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (359)
T cd03823           1 RILVVNHLYPPRSVGGAEVVAHDLAEALAKR-GHEVAVLTAGEDPPRQDKEVIGVVVYGRPIDEVLRSALPRDLFHLSDY   79 (359)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             9999948648999764999999999999977-998999955798766421357617970476420035431015677642


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH
Q ss_conf             99999999986100128886898511776579999866301346311110022110036635579999986401567742
Q gi|254780767|r   72 QFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEK  151 (383)
Q Consensus        72 ~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~  151 (383)
                      ........+.+.+...+||+|..=++.++.....+.+++.  ++|+++-+- ..| |-..|...+.+..|.++++-.+-.
T Consensus        80 ~~~~~~~~~~~~~~~~~pDivh~h~~~~~~~~~~~~~~~~--~~p~v~t~h-~~~-~~~~~~~~~~~~~d~vi~~S~~~~  155 (359)
T cd03823          80 DNPAVVAEFARLLEDFRPDVVHFHHLQGLGVSILRAARDR--GIPIVLTLH-DYW-LICPRQGLFKKGGDAVIAPSRFLL  155 (359)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHC--CCCEEEEEC-CHH-HCCCHHHHHHCCCCEEEECCHHHH
T ss_conf             2789999999999874999999888317679999999984--998999972-221-106177887458999999999999


Q ss_pred             HHHHCCC--CCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEE
Q ss_conf             2320025--53147638821122100135588897618765565059985387430123051118999876402735126
Q gi|254780767|r  152 EVMQRLG--GPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRF  229 (383)
Q Consensus       152 ~~f~k~~--~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~  229 (383)
                      +.|.+..  .-+++.+-|++-...        +.......++++.+.++-| |-.+ .+....+++++..+.  .+++++
T Consensus       156 ~~~~~~~~~~~~i~vI~ngvd~~~--------~~~~~~~~~~~~~~i~~vG-Rl~~-~Kg~~~li~a~~~l~--~~~~~l  223 (359)
T cd03823         156 DRYVANGLFAEKISVIRNGIDLDR--------AKRPRRAPPGGRLRFGFIG-QLTP-HKGVDLLLEAFKRLP--RGDIEL  223 (359)
T ss_pred             HHHHHHCCCCCCEEEECCCCCHHH--------CCCCCCCCCCCCEEEEEEC-CCCC-CCCHHHHHHHHHHCC--CCCCEE
T ss_conf             999980899323899889868454--------2743334567874999958-8976-259999999998555--578289


Q ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEE----ECCCCHHHHHHHHHHHCCC------HHHHHHHHHHCCCEEEECCCCCCE
Q ss_conf             201663368899999960488850552----0552035788763552331------156688876275302540577410
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDISPEIII----DKEQKKQVFMTCNAAMAAS------GTVILELALCGIPVVSIYKSEWIV  299 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~~~~i~~----~~~~~~~~l~~sd~ai~~S------GTaTLE~al~g~P~IV~Yk~~~lt  299 (383)
                      ++..............   .....+..    ..++..+.++.||+.+..|      |.+.+|++.+|+|.| +...+   
T Consensus       224 ~i~G~g~~~~~~~~~~---~~~~~v~f~G~~~~~~~~~~~~~adi~v~pS~~~E~fg~~~lEAma~G~PvI-as~~g---  296 (359)
T cd03823         224 VIVGNGLELEEESYEL---EGDPRVEFLGAYPQEEIDDFYAEIDVLVVPSIWPENFPLVIREALAAGVPVI-ASDIG---  296 (359)
T ss_pred             EEECCCCHHHHHHHHH---HCCCCCEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCEE-ECCCC---
T ss_conf             9977860568999997---2577648806567899999998657365677565777479999998299899-88899---


Q ss_pred             EEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             0001024676102302440784---2612420548989999999998449899999999999999983899998999999
Q gi|254780767|r  300 NFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAE  376 (383)
Q Consensus       300 ~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~  376 (383)
                                  |++.++-+..   ++|     .-+++.+++++.++++|++.|++|.++.   +++.    ...++|.+
T Consensus       297 ------------g~~e~i~~g~~G~lv~-----~~d~~~la~ai~~ll~d~~~~~~~~~~~---~~~~----s~~~~a~~  352 (359)
T cd03823         297 ------------GMAELVRDGVNGLLFP-----PGDAEDLAAALERLIDDPDLLERLRAGI---EPPR----SIEDQAEE  352 (359)
T ss_pred             ------------CCHHHHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHH---HHCC----CHHHHHHH
T ss_conf             ------------8175603798679989-----9999999999999984999999999999---9747----99999999


Q ss_pred             H
Q ss_conf             9
Q gi|254780767|r  377 I  377 (383)
Q Consensus       377 ~  377 (383)
                      .
T Consensus       353 ~  353 (359)
T cd03823         353 Y  353 (359)
T ss_pred             H
T ss_conf             9


No 34 
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
Probab=99.53  E-value=1.3e-11  Score=96.60  Aligned_cols=323  Identities=18%  Similarity=0.155  Sum_probs=181.1

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             78999999999973899839999717899947880650444531101367466459999999999861001288868985
Q gi|254780767|r   16 DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIV   95 (383)
Q Consensus        16 D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~i   95 (383)
                      ..|...|.++|.++ +.++.+...+...-.      .......... +.-.......    ...+.+.++..+||++++-
T Consensus        16 ~~~~~~La~~L~~~-Gh~V~v~~~~~~~~~------~~~~~~~~~~-~~~~~~~~~~----~~~~~~~i~~~~~Dvvh~~   83 (366)
T cd03822          16 ATFTTDLVNALSAR-GPDVLVVSVAALYPS------LLYGGEQEVV-RVIVLDNPLD----YRRAARAIRLSGPDVVVIQ   83 (366)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCCCC------CCCCCCCCEE-EECCCCCCHH----HHHHHHHHHHCCCCEEEEE
T ss_conf             99999999999867-998999958888875------4446776416-7603667325----9999999985399999993


Q ss_pred             C-HHHH---HHHHHHHHHHHCCCCCCEEEE---CC-CCCCCCCCCHHHHHHHHHHHCCCCCCC-HHHHHCCCCCCEEECC
Q ss_conf             1-1776---579999866301346311110---02-211003663557999998640156774-2232002553147638
Q gi|254780767|r   96 D-NPDF---THRVAKRVRKKMPNLPIINYV---CP-SVWAWREGRARKMCAYINQVISILPFE-KEVMQRLGGPPTTFVG  166 (383)
Q Consensus        96 D-~pgF---nl~lak~lkk~~~~ipvi~yv---~P-qvWAWr~~R~k~~~~~~d~~~~ifpFE-~~~f~k~~~~~~~fVG  166 (383)
                      . +|-|   ....+..+.+ ..++|++.-+   .+ .-|.|..+-.+.+.+..|.+++.-... .++.......+++.+-
T Consensus        84 ~~~~~~~~~~~~~~~~~~~-~~~~p~v~t~H~~~~~~~~~~~~~~~~~~~~~ad~vi~~s~~~~~~~~~~~~~~~i~vIp  162 (366)
T cd03822          84 HEYGIFGGEAGLYLLLLLR-GLGIPVVVTLHTVLLHEPRPGDRALLRLLLRRADAVIVMSSELLRALLLRAYPEKIAVIP  162 (366)
T ss_pred             CCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHCCCCCEEEEC
T ss_conf             6533210668999999998-559989999777765542277999999999867999995799999998646987399967


Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC--CC---HHHHH
Q ss_conf             82112210013558889761876556505998538743012305111899987640273512620166--33---68899
Q gi|254780767|r  167 HPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV--SS---QENLV  241 (383)
Q Consensus       167 HPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~--~~---~~~~~  241 (383)
                      |+......  . .....+.....+++++ .++.| |-.+ .+.+..+++++..+.+++|+.++++...  ++   .....
T Consensus       163 ngv~~~~~--~-~~~~~~~~~~~~~~~~-il~~G-rl~~-~Kg~~~li~A~~~l~~~~~~~~l~ivG~~~~~~~~~~~~~  236 (366)
T cd03822         163 HGVPDPPA--E-PPESLKALGGLDGRPV-LLTFG-LLRP-YKGLELLLEALPLLVAKHPDVRLLVAGETHPDLERYRGEA  236 (366)
T ss_pred             CCCCCCCC--C-CHHHHHHHCCCCCCEE-EEEEE-CCCC-CCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHH
T ss_conf             99875455--8-8677887458999859-99985-3405-5485999999999887689859999958987426678999


Q ss_pred             HHHHHHCCCCCEEEE-----ECCCCHHHHHHHHHHHCCC-----HH--HHHHHHHHCCCEEEECCCCCCEEEEEECCCCC
Q ss_conf             999960488850552-----0552035788763552331-----15--66888762753025405774100001024676
Q gi|254780767|r  242 RCIVSKWDISPEIII-----DKEQKKQVFMTCNAAMAAS-----GT--VILELALCGIPVVSIYKSEWIVNFFIFYIKTW  309 (383)
Q Consensus       242 ~~~~~~~~~~~~i~~-----~~~~~~~~l~~sd~ai~~S-----GT--aTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~  309 (383)
                      +...++.++..+|.+     ..++....++.||+.+..|     |+  +.+|++.+|+|.| +.+.+.....    +.-.
T Consensus       237 ~~~~~~lgl~~~V~f~~g~v~~~~~~~~~~~adv~v~Ps~~e~~~~s~v~~EAma~G~PvV-at~~gg~~ev----~~~~  311 (366)
T cd03822         237 YALAERLGLADRVIFINRYLPDEELPELFSAADVVVLPYRSADQTQSGVLAYAIGFGKPVI-STPVGHAEEV----LDGG  311 (366)
T ss_pred             HHHHHHCCCCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCEE-EECCCCHHEE----ECCC
T ss_conf             9999973997655324788899999999995570305554665445699999997499899-9089974408----8399


Q ss_pred             CEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             102302440784261242054898999999999844989999999999999998389999899999999986
Q gi|254780767|r  310 TCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQV  381 (383)
Q Consensus       310 ~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~  381 (383)
                       -|+        ++     +.-+++.+++++..+++|++.|+++-++..+..+...    -+++ |+..+++
T Consensus       312 -~G~--------lv-----~~~d~~~la~ai~~ll~d~~~r~~l~~~a~~~a~~~s----W~~i-a~~~~~l  364 (366)
T cd03822         312 -TGL--------LV-----PPGDPAALAEAIRRLLADPELAQALRARAREYARAMS----WERV-AERYLRL  364 (366)
T ss_pred             -CEE--------EE-----CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC----HHHH-HHHHHHH
T ss_conf             -689--------98-----9999999999999998799999999999999999799----9999-9999998


No 35 
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase. Members of this protein family, found exclusively in the Actinobacteria, are MshA, the glycosyltransferase of mycothiol biosynthesis. Mycothiol replaces glutathione in these species.
Probab=99.51  E-value=7.9e-11  Score=91.41  Aligned_cols=332  Identities=14%  Similarity=0.124  Sum_probs=180.9

Q ss_pred             CCCCH-HHHHHHHHHHHHHHCCCCEEEEEECC-----HHHH-HCCCEEEECHHHCCEEEH--HHHHHHHHHHHHH-HHHH
Q ss_conf             68214-78999999999973899839999717-----8999-478806504445311013--6746645999999-9999
Q gi|254780767|r   11 GEISG-DLLAGDLIKSLKEMVSYPINLVGVGG-----PSLQ-KEGLVSLFDFSELSVIGI--MQVVRHLPQFIFR-INQT   80 (383)
Q Consensus        11 GE~SG-D~~~a~li~~Lk~~~~~~~~~~giGG-----~~m~-~~G~~~~~~~~~l~v~G~--~evl~~~~~~~~~-~~~~   80 (383)
                      |++.| ..|...|.++|.++ +.+++++.-+.     +..+ ..|+... ++......|+  .+....+..+... .+..
T Consensus        17 gd~GG~e~~v~~La~~La~r-GheV~V~t~~~~~~~~~~~~~~~gv~v~-~~~~~p~~~~~~~~l~~~l~~~~~~~l~~~   94 (405)
T TIGR03449        17 GDAGGMNVYILETATELARR-GIEVDIFTRATRPSQPPVVEVAPGVRVR-NVVAGPYEGLDKEDLPTQLCAFTGGVLRAE   94 (405)
T ss_pred             CCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCEEEECCCEEEE-EECCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99588699999999999978-9969999358887788846704984999-825786232456676999999999999999


Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC------CCCCCCCCC-----C---HHHHHHHHHHHCCC
Q ss_conf             861001288868985117765799998663013463111100------221100366-----3---55799999864015
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC------PSVWAWREG-----R---ARKMCAYINQVISI  146 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~------PqvWAWr~~-----R---~k~~~~~~d~~~~i  146 (383)
                      .+ .....+|++-.=++-  .-.++..+++. .++|+++-.-      ...|+++..     |   -+.+-+..|.+++.
T Consensus        95 ~~-~~~~~~DvIH~h~~~--~~~~~~~~~~~-~~iP~V~t~H~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ad~ii~~  170 (405)
T TIGR03449        95 AR-HEPGYYDLIHSHYWL--SGQVGWLLRDR-WGVPLVHTAHTLAAVKNAALADGDTPEPEARRIGEQQLVDNADRLIAN  170 (405)
T ss_pred             HH-HCCCCCCEEEECCCC--HHHHHHHHHHH-CCCCEEEEECCHHHHCCHHHHCCCCCCHHHHHHHHHHHHHHCCEEEEE
T ss_conf             98-568997689988710--78999999986-499989981441431312443266644199999999999748999995


Q ss_pred             CCCCHHHHHCCCCC---CEEECCCCCC-CCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHH
Q ss_conf             67742232002553---1476388211-2210013558889761876556505998538743012305111899987640
Q gi|254780767|r  147 LPFEKEVMQRLGGP---PTTFVGHPLS-SSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVK  222 (383)
Q Consensus       147 fpFE~~~f~k~~~~---~~~fVGHPl~-d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~  222 (383)
                      -+.+.+-+.+.-+.   ++..+-|-+- +.+. ..++...+.+.+++.+.++ .++.| |-.+ .+.+..+++++..+.+
T Consensus       171 s~~~~~~l~~~~~~~~~ki~vi~nGvd~~~f~-p~~~~~~r~~~g~~~~~~~-il~vG-Rl~~-~Kg~~~li~A~~~l~~  246 (405)
T TIGR03449       171 TDEEARDLVRHYDADPDRIDVVAPGADLERFR-PGDRATERARLGLPLDTKV-VAFVG-RIQP-LKAPDVLLRAVAELLD  246 (405)
T ss_pred             CHHHHHHHHHHHCCCHHHEEEECCCCCCCEEC-CCCHHHHHHHCCCCCCCCE-EEEEC-CCCH-HHHHHHHHHHHHHHHH
T ss_conf             78999999998498867889977997703068-8885899997198989818-99955-8850-1148999999999998


Q ss_pred             CCCCCEEEEC--CCC---CH--HHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHC
Q ss_conf             2735126201--663---36--88999999604888505520----552035788763552331-----15668887627
Q gi|254780767|r  223 RNPFFRFSLV--TVS---SQ--ENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----GTVILELALCG  286 (383)
Q Consensus       223 ~~~~~~~~i~--~~~---~~--~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g  286 (383)
                      +.|+..+.+.  ..+   +.  .+.++....+.++...+.+.    .++..++|+.||+.+..|     |.+.||++.+|
T Consensus       247 ~~p~~~l~~~v~Gg~~g~~~~~~~~l~~~~~~lgl~~~V~f~G~~~~~~~~~~~~~adv~v~PS~~E~fg~~~lEAma~G  326 (405)
T TIGR03449       247 RDPDRNLRVIVVGGPSGSGLATPDALIELAAELGIADRVRFLPPRPPEELVHVYRAADVVAVPSYNESFGLVAMEAQACG  326 (405)
T ss_pred             HCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHCC
T ss_conf             68998789999838887536569999999998288875986799889999999995787635566678884799999869


Q ss_pred             CCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53025405774100001024676102302440784261242054898999999999844989999999999999998389
Q gi|254780767|r  287 IPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNT  366 (383)
Q Consensus       287 ~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~  366 (383)
                      +| ||+.+.+.+...+               -+..-  =++-+..+++.+++++..+++|++.|+++-++..+..++...
T Consensus       327 ~P-VVas~~gg~~e~v---------------~~g~~--G~lv~~~d~~~la~ai~~ll~d~~~~~~l~~~~~~~~~~fsw  388 (405)
T TIGR03449       327 TP-VVAARVGGLPVAV---------------ADGET--GLLVDGHDPADWADALARLLDDPRTRIRMGAAAVEHAAGFSW  388 (405)
T ss_pred             CC-EEEECCCCCCEEE---------------ECCCC--EEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCH
T ss_conf             99-9991799861125---------------37973--899798999999999999975999999999999999996999


Q ss_pred             CCCH
Q ss_conf             9998
Q gi|254780767|r  367 KKPA  370 (383)
Q Consensus       367 ~~~a  370 (383)
                      +..+
T Consensus       389 ~~~a  392 (405)
T TIGR03449       389 AATA  392 (405)
T ss_pred             HHHH
T ss_conf             9999


No 36 
>PRK10307 predicted glycosyl transferase; Provisional
Probab=99.47  E-value=1.3e-09  Score=83.34  Aligned_cols=340  Identities=15%  Similarity=0.118  Sum_probs=184.8

Q ss_pred             CEEEEEECC----CCH-HHHHHHHHHHHHHHCCCCEEEEEE---------C-CHH------HHHCCCEEE-ECHHHCCEE
Q ss_conf             459999768----214-789999999999738998399997---------1-789------994788065-044453110
Q gi|254780767|r    4 LKIAVIAGE----ISG-DLLAGDLIKSLKEMVSYPINLVGV---------G-GPS------LQKEGLVSL-FDFSELSVI   61 (383)
Q Consensus         4 mki~i~aGE----~SG-D~~~a~li~~Lk~~~~~~~~~~gi---------G-G~~------m~~~G~~~~-~~~~~l~v~   61 (383)
                      |||++++-+    .+| -.|..+|.++|.++ +.++.+..-         + |..      =...|++.+ .+.---.--
T Consensus         1 MrIl~vs~~y~P~~~G~~~~~~~La~~L~~~-GheV~Vit~~p~~p~~~~~~~~~~~~~~~e~~~gv~v~R~p~~~~~~~   79 (415)
T PRK10307          1 MKILVYGINYAPELTGIGKYTGEMAEWLAAR-GHEVRVITAPPYYPQWQVGEGYSAWRYRREERGGVTVWRCPLYVPKQP   79 (415)
T ss_pred             CEEEEECCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCCCCCCCEEEECCEEEEEEECCCCCCC
T ss_conf             9899985848997887999999999999978-998999977998876655777666543113678889998304567884


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC---C-CCCCC------CCC
Q ss_conf             1367466459999999999861001288868985117765799998663013463111100---2-21100------366
Q gi|254780767|r   62 GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC---P-SVWAW------REG  131 (383)
Q Consensus        62 G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~---P-qvWAW------r~~  131 (383)
                      +...-+.++..+.-...........++||+++..--+-|....+..+.+. .+.|.+..+.   | ..+.+      +.+
T Consensus        80 ~~~~r~~~~~~f~~~~~~~~~~~~~~~pD~v~~~~p~~~~~~~~~~~~~~-~~~~~v~~~~d~~~~~~~~~g~l~~~~~~  158 (415)
T PRK10307         80 SGLKRLLHLGSFALSSFPPLMAQRRWRPDRVIGVAPTLFCAPGARLLARL-SGARTWLHIQDYEVDAAFGLGLLGKGKGG  158 (415)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH-CCCCEEEEEEEEEHHHHHHHCCCCCCCCH
T ss_conf             08999999999999999999998476999899928778899999999996-29888999900211456651401124456


Q ss_pred             CHH--------HHHHHHHHHCCCCCCCHHHHHCCCCC---CEEECCCCCC-CCCC--CCCCHHHHHHHCCCCCCCCEEEE
Q ss_conf             355--------79999986401567742232002553---1476388211-2210--01355888976187655650599
Q gi|254780767|r  132 RAR--------KMCAYINQVISILPFEKEVMQRLGGP---PTTFVGHPLS-SSPS--ILEVYSQRNKQRNTPSQWKKILL  197 (383)
Q Consensus       132 R~k--------~~~~~~d~~~~ifpFE~~~f~k~~~~---~~~fVGHPl~-d~~~--~~~~~~~~~~~~~~~~~~~~I~l  197 (383)
                      .+.        .+-+..|.+.++=+.-.+..... |+   +++++-|-.= +.+.  ...+....+++++++++++ +.+
T Consensus       159 ~~~~~~~~~e~~~~~~ad~v~~~S~~~~~~l~~~-g~~~~ki~vipNgvd~~~f~p~~~~~~~~~r~~~g~~~~~~-vvl  236 (415)
T PRK10307        159 KVARLATAFERSLLRRFDNVSTISRSMMNKAREK-GVAAEKVIFFPNWSDVARFQDVADADVDALRAQLGLPDGKK-IVL  236 (415)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCE-EEE
T ss_conf             9999999999999985898997799999999982-89987099976815100037878520689999709999987-999


Q ss_pred             EECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHC
Q ss_conf             853874301230511189998764027351262016633688999999604888505520----5520357887635523
Q gi|254780767|r  198 LPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMA  273 (383)
Q Consensus       198 lPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~  273 (383)
                      +-| |-.+ .+.+..+++++..+.. .|+++|++......++.++...+..++. ++.+.    .++..++++.||+.+.
T Consensus       237 y~G-rl~~-~kg~~~li~A~~~l~~-~~~~~lvivG~G~~~~~L~~~a~~~gl~-~V~f~g~~~~e~l~~~~~~aDv~v~  312 (415)
T PRK10307        237 YSG-NIGE-KQGLELVIDAAARLRD-RPDLIFVICGQGGGKARLEKMARCRGLR-NVHFLPLQPYDALPALLKMADCHLL  312 (415)
T ss_pred             EEC-CCHH-HCCHHHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHCCCC-CEEECCCCCHHHHHHHHHHCCEEEE
T ss_conf             947-7601-1187999999998312-8986999968874089999999970998-3898188788999999984749997


Q ss_pred             CC-----HHH----HHHHHHHCCCEEEECC-CCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHH
Q ss_conf             31-----156----6888762753025405-7741000010246761023024407842612420548989999999998
Q gi|254780767|r  274 AS-----GTV----ILELALCGIPVVSIYK-SEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERL  343 (383)
Q Consensus       274 ~S-----GTa----TLE~al~g~P~IV~Yk-~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~l  343 (383)
                      .|     |.+    .+|++.+|+|.|..=. -+.+...+   +...-.|        -++|     .-+++.+++++..+
T Consensus       313 ps~~e~~~~v~Pskl~~~mA~G~PVva~~~~g~~~~~~v---~~~~~~G--------~~v~-----p~d~~~La~ai~~l  376 (415)
T PRK10307        313 PQKAGAADLVLPSKLTNMLASGRNVVATAEPGTELGQLC---ETFPGIG--------VCVP-----PEDVEALVAAIRQL  376 (415)
T ss_pred             ECCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHE---EEECCEE--------EEEC-----CCCHHHHHHHHHHH
T ss_conf             044111234575799999866996899925887652012---7627808--------9978-----99999999999999


Q ss_pred             HCCHHHHHHHHHHHHHHH-HHHCCC
Q ss_conf             449899999999999999-983899
Q gi|254780767|r  344 SQDTLQRRAMLHGFENLW-DRMNTK  367 (383)
Q Consensus       344 l~d~~~r~~~~~~~~~~~-~~Lg~~  367 (383)
                      ++|++.|++|-++.++.- +.+..+
T Consensus       377 l~d~~~~~~mg~~gr~~~~~~f~~e  401 (415)
T PRK10307        377 LALPKRRTALGAAAREYAERTLDRE  401 (415)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             7799999999999999999977999


No 37 
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases. mtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
Probab=99.47  E-value=1.8e-11  Score=95.68  Aligned_cols=316  Identities=16%  Similarity=0.108  Sum_probs=174.0

Q ss_pred             CCH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             214-7899999999997389983999971789994788065044453110136746645999999999986100128886
Q gi|254780767|r   13 ISG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDV   91 (383)
Q Consensus        13 ~SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~   91 (383)
                      .+| ..|...|.++|.+. +.+..+....+..-....    ...............................+...++|+
T Consensus        14 ~gGi~ry~~~L~~~L~~~-g~~v~v~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dv   88 (365)
T cd03809          14 PTGIGRYARELLRALLKL-DPEEVLLLLPGAPGLLLL----PLRAALRLLLRLPRRLLWGLLFLLRAGDRLLLLLLGLDL   88 (365)
T ss_pred             CCCHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             996899999999999745-997799993586422111----112354101356653113343577888899998559999


Q ss_pred             EEEECHHHHHHHHHHHHHHHCCCCCCE---E----EECCCCCCC-----CCCCHHHHHHHHHHHCCCCCCCHHHHHCCCC
Q ss_conf             898511776579999866301346311---1----100221100-----3663557999998640156774223200255
Q gi|254780767|r   92 LLIVDNPDFTHRVAKRVRKKMPNLPII---N----YVCPSVWAW-----REGRARKMCAYINQVISILPFEKEVMQRLGG  159 (383)
Q Consensus        92 vi~iD~pgFnl~lak~lkk~~~~ipvi---~----yv~PqvWAW-----r~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~  159 (383)
                      +..-.   +...+.+.     .++|++   |    +-.|+.+.|     .....+...+..|+++|+=.+..+-+.+.-+
T Consensus        89 ~h~~~---~~~~~~~~-----~~~~~V~t~HD~~~~~~~~~~~~~~~~~~~~~~~~~~~~ad~ii~vS~~~~~~~~~~~~  160 (365)
T cd03809          89 LHSPH---NTAPLLRL-----RGVPVVVTIHDLIPLRFPEYFSPGFRRYFRRLLRRALRRADAIITVSEATKRDLLRYLG  160 (365)
T ss_pred             EEECC---CHHHHHHH-----CCCCEEEEECCCHHHHCCCCCCHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHC
T ss_conf             99898---32655643-----59989999788506538200797789999999999999699999979999999999849


Q ss_pred             ---CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC-C
Q ss_conf             ---314763882112210013558889761876556505998538743012305111899987640273512620166-3
Q gi|254780767|r  160 ---PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV-S  235 (383)
Q Consensus       160 ---~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~-~  235 (383)
                         -+++-+-|..-.................. .+.+. .++.|+-..  .++...++++...+.++.++.++++... .
T Consensus       161 ~~~~~i~vi~~gv~~~~~~~~~~~~~~~~~~~-~~~~~-il~vg~~~~--~K~~~~li~a~~~l~~~~~~~~lvivG~~~  236 (365)
T cd03809         161 VPPDKIVVIPLGVDPRFRPPPAEAEVLRALYL-LPRPY-FLYVGTIEP--RKNLERLLEAFARLPAKGPDPKLVIVGKRG  236 (365)
T ss_pred             CCHHHEEEECCCCCHHCCCCCCHHHHHHHHCC-CCCCE-EEEEECCCC--CCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             88589899815555110588742678887438-99988-999953645--579999999999988768993899977897


Q ss_pred             CHHHHHHHHHHHCCCCCEEEEEC----CCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECC
Q ss_conf             36889999996048885055205----52035788763552331-----1566888762753025405774100001024
Q gi|254780767|r  236 SQENLVRCIVSKWDISPEIIIDK----EQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYI  306 (383)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~li  306 (383)
                      .............+....|....    ++...+++.||+.+..|     |-+.||++.+|+|. |+...+.+...     
T Consensus       237 ~~~~~~~~~~~~~~~~~~v~~~g~~~~~~l~~~y~~ad~~v~PS~~EgfGl~~lEAma~G~Pv-i~s~~~~~~Ei-----  310 (365)
T cd03809         237 WLNEELLARLRELGLGDRVRFLGYVSDEELAALYRGARAFVFPSLYEGFGLPVLEAMACGTPV-IASNISSLPEV-----  310 (365)
T ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHCCCCE-EEECCCCCCEE-----
T ss_conf             417999999996599985899368798999999971774354143357896899999859989-99079987308-----


Q ss_pred             CCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             67610230244078426124205489899999999984498999999999999999838
Q gi|254780767|r  307 KTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       307 k~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
                                +-+..+   ++ +.-+++.+++.+.++++|++.|+++.++..+..++..
T Consensus       311 ----------~g~~g~---~~-~p~d~~~la~~i~~ll~d~~~~~~~~~~~~~~~~~fs  355 (365)
T cd03809         311 ----------AGDAAL---YF-DPLDPEALAAAIERLLEDPALREELRERGLARAKRFS  355 (365)
T ss_pred             ----------ECCCEE---EE-CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             ----------578379---98-9999999999999998799999999999999999699


No 38 
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases.  ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.
Probab=99.46  E-value=1.9e-10  Score=88.93  Aligned_cols=330  Identities=16%  Similarity=0.161  Sum_probs=171.1

Q ss_pred             CEEEEEECCC---CHHHHHHHHHHHHHHHCCCCEEEEEECCHH------HHHCCCEEE--ECHHHCCEEEHHHHHHHHHH
Q ss_conf             4599997682---147899999999997389983999971789------994788065--04445311013674664599
Q gi|254780767|r    4 LKIAVIAGEI---SGDLLAGDLIKSLKEMVSYPINLVGVGGPS------LQKEGLVSL--FDFSELSVIGIMQVVRHLPQ   72 (383)
Q Consensus         4 mki~i~aGE~---SGD~~~a~li~~Lk~~~~~~~~~~giGG~~------m~~~G~~~~--~~~~~l~v~G~~evl~~~~~   72 (383)
                      |||.++--+-   .+..+...|.++|.++ +.++.++.--.+.      ....+...-  .+.-.-+..|-...+   ..
T Consensus         1 MkI~fi~p~l~~GGaEr~v~~la~~L~~~-Gh~V~v~t~~~d~~~~~~~~~~~~~~v~~~~~~~p~~~~~~~~~~---~~   76 (392)
T cd03805           1 LRVAFIHPDLGIGGAERLVVDAALALQSR-GHEVTIYTSHHDPSHCFEETKDGTLPVRVRGDWLPRSIFGRFHIL---CA   76 (392)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCHHHCCCCEEEEEECCCCCCHHCCHHHHH---HH
T ss_conf             98999869999986999999999999976-993999972688332405551785489992674670121237899---99


Q ss_pred             HHHHHHH--HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC-CCCCCCCCCC-HHHH------------
Q ss_conf             9999999--9861001288868985117765799998663013463111100-2211003663-5579------------
Q gi|254780767|r   73 FIFRINQ--TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC-PSVWAWREGR-ARKM------------  136 (383)
Q Consensus        73 ~~~~~~~--~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~-PqvWAWr~~R-~k~~------------  136 (383)
                      +.+....  ........+||+++. |.......+.+.+.    +.|+++|+- |..+.++.+. .+++            
T Consensus        77 ~lr~~~~~~~~~~~~~~~~Dvi~~-~~~~~~~~~~~~~~----~~~ii~~~H~p~~~l~~~~~~~~~~y~~~~~~le~~~  151 (392)
T cd03805          77 YLRMLYLALYLLLLPDEKYDVFIV-DQVSACVPLLKLFS----PSKILFYCHFPDQLLAQRGSLLKRLYRKPFDWLEEFT  151 (392)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEE-CCCCHHHHHHHHCC----CCCEEEEEECCCHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999998633479809998-88534799999746----9967999607840210266689999999999999998


Q ss_pred             HHHHHHHCCCCCCCHHHHHC----CCCCCEEECCCCCCCC--CCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHC
Q ss_conf             99998640156774223200----2553147638821122--10013558889761876556505998538743012305
Q gi|254780767|r  137 CAYINQVISILPFEKEVMQR----LGGPPTTFVGHPLSSS--PSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKIL  210 (383)
Q Consensus       137 ~~~~d~~~~ifpFE~~~f~k----~~~~~~~fVGHPl~d~--~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~l  210 (383)
                      .+..|.++|.=.|..+.+.+    ...-+...+=|| .|.  ........ .........+.+ +.+..| |-.+ .+..
T Consensus       152 ~~~~d~ii~~S~~~~~~~~~~~~~~~~~~~~vi~ng-id~~~~~~~~~~~-~~~~~~~~~~~~-~il~vg-Rl~~-~Kg~  226 (392)
T cd03805         152 TGMADKIVVNSNFTASVFKKTFPSLAKNPREVVYPC-VDTDSFESTSEDP-DPGLLIPKSGKK-TFLSIN-RFER-KKNI  226 (392)
T ss_pred             HHCCCEEEECCHHHHHHHHHHHHHHCCCCCEEECCC-CCHHHCCCCCCCH-HHHHHCCCCCCE-EEEEEE-CCCC-CCCH
T ss_conf             850889999567899999998302065885797798-4777648764104-455532467873-999984-4453-4668


Q ss_pred             CCHHHHHHHHHHCCC---CCEEEECCCCCH---H-----HHHHHHHHHC-CCCCEEEEE----CCCCHHHHHHHHHHHCC
Q ss_conf             111899987640273---512620166336---8-----8999999604-888505520----55203578876355233
Q gi|254780767|r  211 PFFESAVASLVKRNP---FFRFSLVTVSSQ---E-----NLVRCIVSKW-DISPEIIID----KEQKKQVFMTCNAAMAA  274 (383)
Q Consensus       211 P~~l~~~~~l~~~~~---~~~~~i~~~~~~---~-----~~~~~~~~~~-~~~~~i~~~----~~~~~~~l~~sd~ai~~  274 (383)
                      +.++++...+.++.+   ++++++......   +     ..++....+. +....|...    ..+..++++.||+.+.+
T Consensus       227 ~~lI~A~~~l~~~~~~~~~~~Lvi~Gg~~~r~~e~~~y~~eL~~l~~~~~~l~~~V~Flg~~~~~~~~~l~~~ad~~v~~  306 (392)
T cd03805         227 ALAIEAFAILKDKLAEFKNVRLVIAGGYDPRVAENVEYLEELQRLAEELLLLEDQVIFLPSISDSQKELLLSSARALLYT  306 (392)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCEEEEC
T ss_conf             99999999999856766885999981875555101899999999999825987859998889969999999859799988


Q ss_pred             C-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHH
Q ss_conf             1-----15668887627530254057741000010246761023024407842612420548989999999998449899
Q gi|254780767|r  275 S-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQ  349 (383)
Q Consensus       275 S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~  349 (383)
                      |     |.+.+|++.+|+|.|.. ..+...               -+|-+..- =-++ + .+++.+++.+.++++|++.
T Consensus       307 s~~Egfg~v~lEAma~G~PVVas-d~gG~~---------------E~I~~g~~-G~Lv-~-~d~~~la~~i~~ll~d~~l  367 (392)
T cd03805         307 PSNEHFGIVPLEAMYAGKPVIAC-NSGGPL---------------ETVVDGET-GFLC-E-PTPEEFAEAMLKLANDPDL  367 (392)
T ss_pred             CCCCCCCHHHHHHHHCCCCEEEE-CCCCCH---------------HHEECCCE-EEEE-C-CCHHHHHHHHHHHHCCHHH
T ss_conf             74346660799999779999994-899867---------------66457966-9995-9-5999999999999789999


Q ss_pred             HHHHHHHHHH-HHHHHCC
Q ss_conf             9999999999-9998389
Q gi|254780767|r  350 RRAMLHGFEN-LWDRMNT  366 (383)
Q Consensus       350 r~~~~~~~~~-~~~~Lg~  366 (383)
                      |++|-++.++ +.++.+.
T Consensus       368 r~~mg~~ar~~v~~~Fs~  385 (392)
T cd03805         368 ADRMGAAGRKRVKEKFST  385 (392)
T ss_pred             HHHHHHHHHHHHHHHCCH
T ss_conf             999999999999986699


No 39 
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP-linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=99.46  E-value=1.6e-11  Score=95.98  Aligned_cols=324  Identities=15%  Similarity=0.116  Sum_probs=170.2

Q ss_pred             EEEEEEC----CCCH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHH--HHHHHHHHHHHHH
Q ss_conf             5999976----8214-7899999999997389983999971789994788065044453110136--7466459999999
Q gi|254780767|r    5 KIAVIAG----EISG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIM--QVVRHLPQFIFRI   77 (383)
Q Consensus         5 ki~i~aG----E~SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~--evl~~~~~~~~~~   77 (383)
                      ||++++-    +..| ..+..+|.++|.++ +.++.+...++..-...   ...  ....+..+.  -.+...+......
T Consensus         1 kIL~i~~~f~P~~GG~e~~~~~L~~~L~~~-Gh~V~v~~~~~~~~~~~---~~~--~~~~~~~~~~~~~~~~~~~~~~~~   74 (357)
T cd03795           1 RVLHVGKFYPPDRGGIEQVIRDLAEGLAAR-GIEVAVLCASPEPKGRD---EER--NGHRVIRAPSLLNVASTPFSPSFF   74 (357)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCC---CCC--CCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             999993828998982999999999999977-99899998279887765---025--884799877433334420469999


Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE-EC---CCCCCCCCCC--HHHHHHHHHHHCCCCCCCH
Q ss_conf             9998610012888689851177657999986630134631111-00---2211003663--5579999986401567742
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY-VC---PSVWAWREGR--ARKMCAYINQVISILPFEK  151 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y-v~---PqvWAWr~~R--~k~~~~~~d~~~~ifpFE~  151 (383)
                      .  ...++..+||+|.. .+|..-..++..+.+.  ++|++.. -+   .+-|.|+-.+  .+.+-+..|+++++-+.-.
T Consensus        75 ~--~~~~~~~~~Diih~-h~~~~~~~~~~~~~~~--~~~~v~t~H~~~~~~~~~~~~~~~~~~~~~~~ad~ii~~S~~~~  149 (357)
T cd03795          75 K--QLKKLAKKADVIHL-HFPNPLADLALLLLPR--KKPVVVHWHSDIVKQKLLLKLYRPLQRRFLRRADAIVATSPNYA  149 (357)
T ss_pred             H--HHHHHCCCCCEEEE-CCCCHHHHHHHHHHHC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCEEEECCHHHH
T ss_conf             9--99997259999999-4763599999999857--99799998788532056799999999999984899998899999


Q ss_pred             HHHHCC--CCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEE
Q ss_conf             232002--553147638821122100135588897618765565059985387430123051118999876402735126
Q gi|254780767|r  152 EVMQRL--GGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRF  229 (383)
Q Consensus       152 ~~f~k~--~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~  229 (383)
                      +..+..  ..-+++.+-|.+ |...................+.+.| ++-| |-.+- +.++.++++++++    |++++
T Consensus       150 ~~~~~~~~~~~k~~vIpngv-d~~~~~~~~~~~~~~~~~~~~~~~i-~~vG-rl~~~-Kg~~~li~a~~~l----~~~~l  221 (357)
T cd03795         150 ETSPVLRRFRDKVRVIPLGL-DPARYPRPDALEEAIWRRAAGRPFF-LFVG-RLVYY-KGLDVLLEAAAAL----PDAPL  221 (357)
T ss_pred             HHHHHHCCCCCCEEEECCCC-CCCCCCCCCHHHHHHHHCCCCCCEE-EEEE-CCCHH-CCCHHHHHHHHHC----CCEEE
T ss_conf             99998447767689988976-6233688736788874035899789-9980-78043-0957899898769----89099


Q ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-------HHHHHHHHHHCCCEEEECCCCCC
Q ss_conf             2016633688999999604888505520----552035788763552331-------15668887627530254057741
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-------GTVILELALCGIPVVSIYKSEWI  298 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-------GTaTLE~al~g~P~IV~Yk~~~l  298 (383)
                      ++.......+.++....+.+...+|...    .++..+.++.||+.+.+|       |.+.+|++.+|+|.| +...+..
T Consensus       222 ~i~G~G~~~~~l~~~~~~~~~~~~V~f~G~~~~~~~~~~~~~adi~v~pS~~~~Egfg~~~lEAma~G~PVV-at~~gg~  300 (357)
T cd03795         222 VIVGEGPLEAELEALAAALGLLDRVRFLGRLDDEEKAALLAACDVFVFPSVERSEAFGIVLLEAMAFGKPVI-STEIGTG  300 (357)
T ss_pred             EEEECCCCCCCCCCHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCHHCCCCCHHHHHHHHCCCCEE-EECCCCC
T ss_conf             999567542221000555187514752586514557988626878999464021356667999998799899-9359998


Q ss_pred             EEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHH
Q ss_conf             0000102467610230244078426124205489899999999984498999999999999-99983
Q gi|254780767|r  299 VNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRM  364 (383)
Q Consensus       299 t~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~L  364 (383)
                      ...+              +.+.. . =++-+.-+++.+++.+..+++|++.|++|-++.++ +.++.
T Consensus       301 ~~~i--------------~~~~~-~-G~l~~~~d~~~l~~~i~~ll~~~~~~~~m~~~ar~~~~~~f  351 (357)
T cd03795         301 GSYV--------------NLHGV-T-GLVVPPGDPAALAEAIRRLLEDPELRERLGEAARERAEEEF  351 (357)
T ss_pred             HHHH--------------EECCC-E-EEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
T ss_conf             1560--------------55695-7-99978999999999999997799999999999999999857


No 40 
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
Probab=99.46  E-value=4.5e-11  Score=93.05  Aligned_cols=328  Identities=16%  Similarity=0.155  Sum_probs=188.4

Q ss_pred             EEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEE--E--ECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             999976821478999-99999997389983999--9--717899947880650444531101367466459999999999
Q gi|254780767|r    6 IAVIAGEISGDLLAG-DLIKSLKEMVSYPINLV--G--VGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         6 i~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~--g--iGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |++=|. .=|+..++ .|+++|+++.+ +.++.  .  -.|.++.+.-.   -+.....+.- +|          ....+
T Consensus        52 IW~Haa-SvGE~~~~~pli~~l~~~~p-~~~ilvTt~T~sg~~~~~~~~---~~~~~~~ylP-~D----------~~~~~  115 (423)
T PRK05749         52 IWFHAV-SVGETRAAIPLIRALRKRYP-DLPILVTTMTPTGSERAKALF---GDDVEHVYLP-YD----------LPFAV  115 (423)
T ss_pred             EEEEEC-CHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCHHHHHHHHHC---CCCEEEEEEC-CC----------CHHHH
T ss_conf             999828-79899999999999996299-974999837830999999866---8973799922-47----------87999


Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC---CC---CCCCCCCCHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             861001288868985117765799998663013463111100---22---110036635579999986401567742232
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC---PS---VWAWREGRARKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~---Pq---vWAWr~~R~k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      .+.+...+||++|++.+- |=-.+-..++++  |||++-.=+   ..   =|-|-.+=.+.+-+.+|++++-=.-..+-|
T Consensus       116 ~rfl~~~~P~~~i~~E~E-iWPnli~~~~~~--~Ip~~liNaR~s~~S~~~y~~~~~~~~~~l~~~~~i~~qs~~~~~r~  192 (423)
T PRK05749        116 RRFLRFWRPKLLIIMETE-LWPNLIAEAKKR--GIPLVLANARLSERSFKRYAKFKRFYRLLFKNIDLVLAQSEEDAERF  192 (423)
T ss_pred             HHHHHHHCCCEEEEEECC-CCHHHHHHHHHC--CCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHH
T ss_conf             999997398879986203-108899999627--88667652511633676667669999999974276652699999999


Q ss_pred             HCCCCC--CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             002553--147638821122100135588897618765565059985387430123051118999876402735126201
Q gi|254780767|r  155 QRLGGP--PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLV  232 (383)
Q Consensus       155 ~k~~~~--~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~  232 (383)
                      .+. |+  ++..+|+.=.|......+......-...-.++ .+.++.-++..|-.    +++++.+.+.+++|++..+++
T Consensus       193 ~~l-G~~~~v~v~GnlKfd~~~~~~~~~~~~~~~~~~~~~-~v~vagSth~~EE~----iil~~~~~l~~~~~~~~lIia  266 (423)
T PRK05749        193 LAL-GAKNEVTVTGNLKFDIEIPPELAARAAALRRQLPNR-PVWIAASTHEGEEE----LVLDAHQALLKQFPNLLLILV  266 (423)
T ss_pred             HHC-CCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHCCC-CEEEEEECCHHHHH----HHHHHHHHHHHCCCCCEEEEE
T ss_conf             975-999743876863224578711078899999981899-68999928876999----999999999740878289994


Q ss_pred             C-CCCHHHHHHHHHHHCCC-------------CCEEEE--ECCCCHHHHHHHHHHHCCC------HHHHHHHHHHCCCEE
Q ss_conf             6-63368899999960488-------------850552--0552035788763552331------156688876275302
Q gi|254780767|r  233 T-VSSQENLVRCIVSKWDI-------------SPEIII--DKEQKKQVFMTCNAAMAAS------GTVILELALCGIPVV  290 (383)
Q Consensus       233 ~-~~~~~~~~~~~~~~~~~-------------~~~i~~--~~~~~~~~l~~sd~ai~~S------GTaTLE~al~g~P~I  290 (383)
                      . -++..+.+...+...+.             +.+|.+  ..|+...+++.||+|.+.-      |-+.||.|.+|+|.+
T Consensus       267 PRHpeR~~~i~~~l~~~gl~~~~~S~~~~~~~~~~Vli~Dt~GeL~~~Y~~a~iafvGGsf~~~GGHN~lEpa~~g~pvi  346 (423)
T PRK05749        267 PRHPERFKEVEELLKKAGLSYVRRSQGEAPSADTDVLLGDTMGELGLLYAIADIAFVGGSLVKIGGHNPLEPAAFGVPVI  346 (423)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCEEEEECCCCHHHHHHHHCCEEEECCCCCCCCCCCHHHHHHCCCCEE
T ss_conf             78776799999999967997798279999998872999888875889998578789827768889959799998399889


Q ss_pred             EECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCC-----CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             5405774100001024676102302440784261242054-----89899999999984498999999999999999838
Q gi|254780767|r  291 SIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSM-----IRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       291 V~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~-----~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
                      +.-.+.-.                     ++++.+|++..     -+++.+.+.+..+++|++.|++|..+..+..+.- 
T Consensus       347 ~GP~~~nf---------------------~e~~~~L~~~g~~~~v~~~~eL~~~~~~ll~~~~~~~~~~~~a~~~v~~~-  404 (423)
T PRK05749        347 SGPHTFNF---------------------KEIFERLLQAGAAIQVEDAEDLAKAVSSLLTDPDAREAMGEAGVAFLKQN-  404 (423)
T ss_pred             ECCCCCCH---------------------HHHHHHHHHCCCEEEECCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHC-
T ss_conf             99383277---------------------99999999789958968999999999999769999999999999999978-


Q ss_pred             CCCCHHHHHHHHHHHHC
Q ss_conf             99998999999999861
Q gi|254780767|r  366 TKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       366 ~~~~a~~~AA~~I~~~L  382 (383)
                       .| |.++.-+.|.++|
T Consensus       405 -~G-at~r~~~~i~~~L  419 (423)
T PRK05749        405 -RG-ALQRTLQLLKPYL  419 (423)
T ss_pred             -CC-HHHHHHHHHHHHC
T ss_conf             -47-9999999999763


No 41 
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
Probab=99.46  E-value=4.1e-12  Score=99.91  Aligned_cols=252  Identities=15%  Similarity=0.154  Sum_probs=142.6

Q ss_pred             CEEEEEE--CCC--CHHHHHH-HHHHHHHHHCCCCEEEEEECCHH-----HHHCCCEEEECHHHCCEEEHHHHHHHHHHH
Q ss_conf             4599997--682--1478999-99999997389983999971789-----994788065044453110136746645999
Q gi|254780767|r    4 LKIAVIA--GEI--SGDLLAG-DLIKSLKEMVSYPINLVGVGGPS-----LQKEGLVSLFDFSELSVIGIMQVVRHLPQF   73 (383)
Q Consensus         4 mki~i~a--GE~--SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~-----m~~~G~~~~~~~~~l~v~G~~evl~~~~~~   73 (383)
                      |||+|-|  |..  .|++.-+ .|.++|+++ +.++.|.+-+-+.     ...+|.....-    ..-+..         
T Consensus         1 mkI~fr~d~~~~iG~GH~~RclaLA~~l~~~-g~~v~f~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~---------   66 (280)
T TIGR03590         1 MRILFRADASSEIGLGHVMRCLTLARELRKR-GAEVAFACKTLPGDLIDLILSAGFPVYVL----PDTSSW---------   66 (280)
T ss_pred             CEEEEEEECCCCEEHHHHHHHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHHCCCCEEEC----CCCCCC---------
T ss_conf             9799999678991320899999999999988-99499999279588999999759817981----675652---------


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCC-CCHH
Q ss_conf             999999986100128886898511776579999866301346311110022110036635579999986401567-7422
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILP-FEKE  152 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifp-FE~~  152 (383)
                      ......+.+.+.+.+||++| +|.-+++...-+.+|+.  +.+++.+--         ... -..++|.++-.-| .+..
T Consensus        67 ~~~~~~~~~~~~~~~~d~vI-iD~y~~~~~~~~~lk~~--~~~~i~iDD---------~~~-~~~~~d~vin~~~~~~~~  133 (280)
T TIGR03590        67 QDDALELINLLEKEKFDILI-VDHYALDADWEKLIKHF--GRKLLVIDD---------LAD-RPHDCDLLLDQNPGADAL  133 (280)
T ss_pred             CCCHHHHHHHHHHCCCCEEE-EECCCCCHHHHHHHHHH--CCEEEEEEC---------CCC-CCCCCCEEECCCCCCCHH
T ss_conf             01299999999737979999-92599997999999983--983999936---------765-465614254145444756


Q ss_pred             HHHC-CCCCCEEECCC---CCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             3200-25531476388---2112210013558889761876556505998538743012305111899987640273512
Q gi|254780767|r  153 VMQR-LGGPPTTFVGH---PLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       153 ~f~k-~~~~~~~fVGH---Pl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
                      -|+. ..+-...|.|.   |+.+++......     ...-++..+++..|.||-...+      ..++++.+.+...+++
T Consensus       134 ~y~~~~~~~~~~l~G~~Y~~lr~~F~~~~~~-----~~~~~~~~~Ili~~GGsD~~~l------t~~il~~l~~~~~~~~  202 (280)
T TIGR03590       134 DYQGLVPANCRLLLGPSYALLREEFYQLRTA-----NKRRKPLRRVLVSFGGADPDNL------TLKLLSALAESQINIS  202 (280)
T ss_pred             HHCCCCCCCCEEEECCCCCCCCHHHHHHHHH-----HHCCCCCCEEEEEECCCCHHHH------HHHHHHHHHHHCCCCC
T ss_conf             6364488676698657534357888763032-----2103655328999778770008------9999999985166856


Q ss_pred             EEECCCCC--HHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECC
Q ss_conf             62016633--6889999996048885055205520357887635523311566888762753025405
Q gi|254780767|r  229 FSLVTVSS--QENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYK  294 (383)
Q Consensus       229 ~~i~~~~~--~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk  294 (383)
                      +.+...+.  ..+.+....... .+..+....++..+.|+.||+||+++||.+.|++.+|+|+|++.-
T Consensus       203 i~vvig~~~~~~~~i~~~~~~~-~~~~~~~~~~~m~~~m~~aDlaI~agG~t~~El~~~gvP~i~i~~  269 (280)
T TIGR03590       203 ITLVTGSSNPNLDELKKFAKEY-PNIILFIDVENMAELMNEADLAIGAAGSTSWERCCLGLPSLSIVL  269 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC-CCEEEECCHHHHHHHHHHCCEEEECCCHHHHHHHHHCCCEEEEEE
T ss_conf             7999867987669999999728-996996598899999997799998596589999994999899997


No 42 
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing. This family of enzymes catalyzes the combined epimerization and UDP-hydrolysis of UDP-N-acetylglucosamine to N-acetylmannosamine. This is in contrast to the related enzyme WecB (TIGR00236) which retains the UDP moiety. NeuC acts in concert with NeuA and NeuB to synthesize CMP-N5-acetyl-neuraminate.
Probab=99.45  E-value=9.3e-11  Score=90.96  Aligned_cols=308  Identities=17%  Similarity=0.179  Sum_probs=169.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE-EECCHH-----------HHHCCCEEEECHHHC----CEEEHHHHH
Q ss_conf             4599997682147899999999997389983999-971789-----------994788065044453----110136746
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLV-GVGGPS-----------LQKEGLVSLFDFSEL----SVIGIMQVV   67 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~-giGG~~-----------m~~~G~~~~~~~~~l----~v~G~~evl   67 (383)
                      +||++++|--+-=+..|.++++|++.  ++++.. =+.|.+           +...|+....++...    +-.+..+  
T Consensus         1 kKI~~v~GtRpe~iklapli~~l~~~--~~~~~~li~TGqH~~~~~g~t~~~i~~d~~~~~~~~~~~~~~~~~~~~~~--   76 (365)
T TIGR03568         1 KKICVVTGTRADYGLLRPLLKALQDD--PDLELQLIVTGMHLSPEYGNTVNEIEKDGFDIDEKIEILLDSDSNAGMAK--   76 (365)
T ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHC--CCCCEEEEEECCCCCHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHH--
T ss_conf             94999985077299999999999728--99888999907778411070899999757987655765456898533999--


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC--CCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             64599999999998610012888689851177657999986630134631111002--2110036635579999986401
Q gi|254780767|r   68 RHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP--SVWAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        68 ~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P--qvWAWr~~R~k~~~~~~d~~~~  145 (383)
                          .+-+.+..+-+.+.+.+||+|+..  .|=|=-+|-.+-....+||++|.=+=  +.-.+-    ...++.+|++..
T Consensus        77 ----~~~~~~~~~~~~l~~~kPD~VlV~--GDt~stla~alaA~~~~Ipv~HveaGlrs~~~~d----E~~R~~i~~lS~  146 (365)
T TIGR03568        77 ----SMGLTIIGFSDAFERLKPDLVVVL--GDRFEMLAAAIAAALLNIPIAHIHGGEVTEGAID----ESIRHAITKLSH  146 (365)
T ss_pred             ----HHHHHHHHHHHHHHHCCCCEEEEE--CCCCHHHHHHHHHHHHCCEEEEEECCCCCCCCCC----HHHHHHHHHHHH
T ss_conf             ----999999999999854399899994--8986077999999981981899967864589886----588889899877


Q ss_pred             C-CCCCHHH---HHCCCCC---CEEECCCCCCCCCCCC--CCHHHHHHHCCCCCCCCEEEEEEC---CCCCCHHHHCCCH
Q ss_conf             5-6774223---2002553---1476388211221001--355888976187655650599853---8743012305111
Q gi|254780767|r  146 I-LPFEKEV---MQRLGGP---PTTFVGHPLSSSPSIL--EVYSQRNKQRNTPSQWKKILLLPG---SRAQEIYKILPFF  213 (383)
Q Consensus       146 i-fpFE~~~---f~k~~~~---~~~fVGHPl~d~~~~~--~~~~~~~~~~~~~~~~~~I~llPG---SR~~EI~~~lP~~  213 (383)
                      + |.=.+..   ..+ .|+   ++.+||+|..|.+...  .......+.++++.+++.+++.-=   .+..+....+..+
T Consensus       147 ~hf~~t~~a~~nL~~-eG~~~~~I~~vGn~~iD~l~~~~~~~~~~~~~~~~~~~~~~~~LvT~Hp~~~~~~~~~~~l~~i  225 (365)
T TIGR03568       147 LHFVATEEYRQRVIQ-MGEDPDRVFNVGSPGLDNILSLDLLSKEELEEKLGIDLDKPYALVTFHPVTLEKESAEEQIKEL  225 (365)
T ss_pred             HHHCCCHHHHHHHHH-CCCCCCEEEEECCHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             773233578899986-2478670898277189998622213788999874121368769999535325665689999999


Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHC-CCCCEEEEE----CCCCHHHHHHHHHHHCCCHHHHHHHHHHCCC
Q ss_conf             89998764027351262016633688999999604-888505520----5520357887635523311566888762753
Q gi|254780767|r  214 ESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKW-DISPEIIID----KEQKKQVFMTCNAAMAASGTVILELALCGIP  288 (383)
Q Consensus       214 l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~-~~~~~i~~~----~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P  288 (383)
                      ++++.+   ...++.|+.|........+...+.++ ..+.++.+.    ..+...+++.|+++|+-||..--|++.+|+|
T Consensus       226 l~al~~---~~~~~~~i~Pn~d~~~~~i~~~i~~~~~~~~ni~~i~pl~y~~fl~ll~~a~~vitdSsggi~Ea~~l~~P  302 (365)
T TIGR03568       226 LKALDE---LNKNYIFTYPNADAGSRIINEAIEEYVNEHPNFRLFKSLGQERYLSLLKNADAVIGNSSSGIIEAPSFGVP  302 (365)
T ss_pred             HHHHHH---HCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHCCEEEECCCCCEEEECCCCCC
T ss_conf             999972---08881798269860278899999999707998899667888999999987019998588654670104986


Q ss_pred             EEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHH
Q ss_conf             025405774100001024676102302440784261242054898999999999844989999
Q gi|254780767|r  289 VVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRR  351 (383)
Q Consensus       289 ~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~  351 (383)
                      ++.+-  ..-+..    ...     .|++.          -.+++++|.+++..+++ +..++
T Consensus       303 ~i~i~--~Rq~~r----~~~-----~nvi~----------v~~~~~~I~~ai~~~~~-~~~~~  343 (365)
T TIGR03568       303 TINIG--TRQKGR----LRA-----DSVID----------VDPDKEEIVKAIEKLLD-PAFKK  343 (365)
T ss_pred             EEEEC--CCCCCC----CCC-----CEEEE----------ECCCHHHHHHHHHHHHC-HHHHH
T ss_conf             78837--885555----247-----60898----------17999999999999748-78987


No 43 
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases. wcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
Probab=99.43  E-value=7.1e-11  Score=91.73  Aligned_cols=323  Identities=15%  Similarity=0.145  Sum_probs=162.2

Q ss_pred             CEEEEEECCC---CHHHHHHHHHHHHHHHCCCCEEEEEECCHHH----HHCCCEEEECHHHCCEEEHHHHHHHHHHHHHH
Q ss_conf             4599997682---1478999999999973899839999717899----94788065044453110136746645999999
Q gi|254780767|r    4 LKIAVIAGEI---SGDLLAGDLIKSLKEMVSYPINLVGVGGPSL----QKEGLVSLFDFSELSVIGIMQVVRHLPQFIFR   76 (383)
Q Consensus         4 mki~i~aGE~---SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m----~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~   76 (383)
                      |||+.+....   .+..+.-+|.++|.++ +.++++.-......    +..+.+.+ ++..+ ..|+.    .+..    
T Consensus         1 MKIL~v~~~~~~GGae~~~~~L~~~L~~~-Gh~v~v~~~~~~~~~~~~~~~~~dvv-h~h~~-~~~~~----~~~~----   69 (365)
T cd03825           1 MKVLHLNTSDISGGAARAAYRLHRALQAA-GVDSTMLVQEKKALISKIEIINADIV-HLHWI-HGGFL----SIED----   69 (365)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCCHHHHHHHCCCCEE-EECCC-CCCHH----CHHH----
T ss_conf             95999938999923899999999999977-99089999269847776655289989-98477-61020----5999----


Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHH------HHHHHHHHHHCCCCCCEEE---ECCCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             9999861001288868985117765------7999986630134631111---002211003663557999998640156
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFT------HRVAKRVRKKMPNLPIINY---VCPSVWAWREGRARKMCAYINQVISIL  147 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFn------l~lak~lkk~~~~ipvi~y---v~PqvWAWr~~R~k~~~~~~d~~~~if  147 (383)
                          ...+....|.++.+=|+.-|.      ....++.+. ...+|.+..   ..-+-|.|...+. .+...-++++|.=
T Consensus        70 ----l~~l~~~~p~v~t~Hd~~~~tg~~~~~~~~~~~~~~-~~~~p~l~~~~~~~~~~~~~~~~~~-~~~~~~~~iv~~S  143 (365)
T cd03825          70 ----LSKLLDRKPVVWTLHDMWPFTGGCHYPGGCDRYKTE-CGNCPQLGSYPEKDLSRWIWRRKRK-AWADLNLTIVAPS  143 (365)
T ss_pred             ----HHHHHCCCCEEEEECCCCHHHCCCHHCCHHHHHHHC-CCCCCCCCCCCHHHHHHHHHHHHHH-HHHHCCCEEEECC
T ss_conf             ----999970899899963565221510100011343020-4657775665534667999999999-9852599899869


Q ss_pred             CCCHHHHHCC---CCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCC-HHHHCCCHHHHHHHHHHC
Q ss_conf             7742232002---553147638821122100135588897618765565059985387430-123051118999876402
Q gi|254780767|r  148 PFEKEVMQRL---GGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQE-IYKILPFFESAVASLVKR  223 (383)
Q Consensus       148 pFE~~~f~k~---~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~E-I~~~lP~~l~~~~~l~~~  223 (383)
                      .+-.+...+.   .+.+++.+-|++-.......++...++.++++.+.++|+ + |++... -.+....+++++..+.+.
T Consensus       144 ~~~~~~~~~~~~~~~~ki~vI~Ngid~~~f~p~~~~~~r~~~~~~~~~~vi~-~-~~~~~~~~~Kg~~~li~A~~~l~~~  221 (365)
T cd03825         144 RWLADCARSSSLFKGIPIEVIPNGIDTTIFRPRDKREARKRLGLPADKKIIL-F-GAVGGTDPRKGFDELIEALKRLAER  221 (365)
T ss_pred             HHHHHHHHHCCCCCCCCEEEECCCCCHHHCCCCCHHHHHHHHCCCCCCCEEE-E-EEECCCCCCCCHHHHHHHHHHHHHC
T ss_conf             8999999972488989789989973646449868899999839798885899-9-5300156432479999999987650


Q ss_pred             C-CCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEEC--CC---CHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEE
Q ss_conf             7-3512620166336889999996048885055205--52---035788763552331-----15668887627530254
Q gi|254780767|r  224 N-PFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDK--EQ---KKQVFMTCNAAMAAS-----GTVILELALCGIPVVSI  292 (383)
Q Consensus       224 ~-~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~--~~---~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~  292 (383)
                      . +++.+++......+.  .   ...+  .++....  ++   ..+.+++||+.+.+|     |.+.+|++.+|+| ||+
T Consensus       222 ~~~~~~lvi~G~~~~~~--~---~~l~--~~v~flG~~~~~~~l~~~~~~aDi~v~pS~~Egfg~v~lEAma~G~P-VVa  293 (365)
T cd03825         222 WKDDIELVVFGASDPEI--P---PDLP--FPVHYLGSLNDDESLALIYSAADVFVVPSLQENFPNTAIEALACGTP-VVA  293 (365)
T ss_pred             CCCCEEEEEECCCCHHH--H---HHCC--CCEEEECCCCCHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHCCCC-EEE
T ss_conf             68988999937985888--9---6689--97999268799899999997272995167768885999999971998-997


Q ss_pred             CCCCCCEEEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHH-HHHHCCCC
Q ss_conf             05774100001024676102302440784---261242054898999999999844989999999999999-99838999
Q gi|254780767|r  293 YKSEWIVNFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENL-WDRMNTKK  368 (383)
Q Consensus       293 Yk~~~lt~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~-~~~Lg~~~  368 (383)
                      +..+.+..               ++-+..   ++|     .-+++.+++++..+++|++.|+++-++.++. .++..   
T Consensus       294 sd~gg~~e---------------iv~~~~~G~lv~-----~~d~~~la~ai~~ll~d~~~~~~~~~~ar~~~~~~fs---  350 (365)
T cd03825         294 FDVGGIPD---------------IVDHGVTGYLAK-----PGDPEDLAEGIEWLLADPDEREELGEAARELAENEFD---  350 (365)
T ss_pred             CCCCCHHH---------------HHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC---
T ss_conf             38998599---------------960798279979-----9999999999999986999999999999999998689---


Q ss_pred             CHHHHHHHH
Q ss_conf             989999999
Q gi|254780767|r  369 PAGHMAAEI  377 (383)
Q Consensus       369 ~a~~~AA~~  377 (383)
                       .++++++.
T Consensus       351 -~~~~~~~~  358 (365)
T cd03825         351 -SRVQAKRY  358 (365)
T ss_pred             -HHHHHHHH
T ss_conf             -99999999


No 44 
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
Probab=99.40  E-value=1.7e-09  Score=82.66  Aligned_cols=335  Identities=15%  Similarity=0.103  Sum_probs=163.7

Q ss_pred             CEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECC--HHHHHCCCEEEE-C--HHHCC----------EEEHHHHH
Q ss_conf             45999976821478999-999999973899839999717--899947880650-4--44531----------10136746
Q gi|254780767|r    4 LKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGG--PSLQKEGLVSLF-D--FSELS----------VIGIMQVV   67 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG--~~m~~~G~~~~~-~--~~~l~----------v~G~~evl   67 (383)
                      |||.+.++-..||++.. .|.++|+++ +.++.|.+-.+  +..++.|++... +  .....          ..+.....
T Consensus         1 Mril~~~~~~~GH~~P~l~lA~~L~~r-Gh~Vt~~~~~~~~~~i~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (401)
T cd03784           1 MRVLITTIGSRGDVQPLVALAWALRAA-GHEVRVATPPEFADLVEAAGLEFVPVGGDPDELLASPERNAGLLLLGPGLLL   79 (401)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHC-CCEEEEEECHHHHHHHHHCCCEEEECCCCHHHHHHCCCCCCCCCCCCHHHHH
T ss_conf             979998798575899999999999988-9959999387888899977986887698777764211123333454055799


Q ss_pred             HHH----HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH-HHHHHHHHHHCCCCCCEEEE-CC----------CCCCCC--
Q ss_conf             645----9999999999861001288868985117765-79999866301346311110-02----------211003--
Q gi|254780767|r   68 RHL----PQFIFRINQTVELIVSSKPDVLLIVDNPDFT-HRVAKRVRKKMPNLPIINYV-CP----------SVWAWR--  129 (383)
Q Consensus        68 ~~~----~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn-l~lak~lkk~~~~ipvi~yv-~P----------qvWAWr--  129 (383)
                      ...    .........+.+.+...+||+|| .|+-.+- .-+|+.     .|||.+.+. .|          ..|.|.  
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~pD~vi-~d~~~~~~~~~A~~-----~giP~v~~~~~p~~~~~~~~~~~~~~~~~~  153 (401)
T cd03784          80 GALRLLRREAEAMLDDLVAAARDWGPDLVV-ADPLAFAGAVAAEA-----LGIPAVRLLLGPDTPTSAFPPPLGRANLRL  153 (401)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCEEE-ECCCHHHHHHHHHH-----HCCCEEEEECCCCCCCCCCCCCCHHHHHHH
T ss_conf             999999999999999999996167998899-89707899999999-----299989995666545332567410244310


Q ss_pred             ----------CCCHHHHHHHHHHH---------------C-----CCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCH
Q ss_conf             ----------66355799999864---------------0-----15677422320025531476388211221001355
Q gi|254780767|r  130 ----------EGRARKMCAYINQV---------------I-----SILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVY  179 (383)
Q Consensus       130 ----------~~R~k~~~~~~d~~---------------~-----~ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~  179 (383)
                                ....+.+....+..               .     +.++++..+     .-....+|.++..........
T Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~  228 (401)
T cd03784         154 YALLEAELWQDLLGAWLRARRRRLGLPPLSLLDGSDVPELYGFSPAVLPPPPDW-----PRFDLVTGYGFRDVPYNGPPP  228 (401)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCCCCCC-----CCCCEECCCCCCCCCCCCCCC
T ss_conf             455555555545788999999983999654200047840012125555657664-----445512278877777778888


Q ss_pred             HHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEE-EC
Q ss_conf             88897618765565059985387430123051118999876402735126201663368899999960488850552-05
Q gi|254780767|r  180 SQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIII-DK  258 (383)
Q Consensus       180 ~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~-~~  258 (383)
                      .+.  ...+++++++|.+--||-...-   ...+.+.+...... .+.+++.........     ..  ..+.++.+ ..
T Consensus       229 ~~~--~~~l~~~~~vVyvs~GS~~~~~---~~~~~~~~~~~l~~-~~~~~i~~~~~~~~~-----~~--~~~~nv~i~~~  295 (401)
T cd03784         229 PEL--WLFLAAGRPPVYVGFGSMVVRD---PEALARLDVEAVAT-LGQRAILSLGWGGLG-----AE--DLPDNVRVVDF  295 (401)
T ss_pred             HHH--HHHCCCCCCEEEEECCCCHHCC---HHHHHHHHHHHHHH-CCCEEEEEECCCCCC-----CC--CCCCCEEEECC
T ss_conf             567--7513569976999788301028---99999999999996-698499996787666-----55--68997899567


Q ss_pred             CCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHH
Q ss_conf             5203578876355233115668-887627530254057741000010246761023024407842612420548989999
Q gi|254780767|r  259 EQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALV  337 (383)
Q Consensus       259 ~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~  337 (383)
                      -...++|.++|+.|+-.|..|. |+...|+|||++--. +=....++.+.-.-+|           ..+-++++|++.|.
T Consensus       296 ~pq~~iL~~~~~~ItHgG~~s~~Eal~~GvP~v~~P~~-~DQ~~nA~rv~~~G~G-----------~~l~~~~~t~e~l~  363 (401)
T cd03784         296 VPHDWLLPRCAAVVHHGGAGTTAAALRAGVPQLVVPFF-GDQPFWAARVAELGAG-----------PALDPRELTAERLA  363 (401)
T ss_pred             CCHHHHHHHCCEEEECCCHHHHHHHHHCCCCEEECCCC-CCHHHHHHHHHHCCCC-----------CCCCCCCCCHHHHH
T ss_conf             89899974379999668758999999819998953775-5689999999987971-----------27783569999999


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             99999844989999999999999998389999899999999986
Q gi|254780767|r  338 RWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQV  381 (383)
Q Consensus       338 ~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~  381 (383)
                      +++.++|+|+.+++.     .++.+.+...+++ ..||++|.++
T Consensus       364 ~av~~lL~~~~~~~a-----~~~~~~~~~~~g~-~~aa~~ie~l  401 (401)
T cd03784         364 AALRRLLDPPSRRRA-----AALLRRIREEDGV-PSAADVIERL  401 (401)
T ss_pred             HHHHHHHCCHHHHHH-----HHHHHHHHHCCCH-HHHHHHHHCC
T ss_conf             999999489999999-----9999998755888-9999998439


No 45 
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]
Probab=99.37  E-value=8.9e-10  Score=84.47  Aligned_cols=337  Identities=16%  Similarity=0.155  Sum_probs=197.2

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE-EEEECCHHH---------HHCCCEEEECHHHCCEE--E--HHHH
Q ss_conf             98745999976821478999999999973899839-999717899---------94788065044453110--1--3674
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPIN-LVGVGGPSL---------QKEGLVSLFDFSELSVI--G--IMQV   66 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~-~~giGG~~m---------~~~G~~~~~~~~~l~v~--G--~~ev   66 (383)
                      |+.|||.++.|----=+--|.|++++++. + +++ +.-+.|.++         +..|+.  .+--++++|  |  +.+.
T Consensus         1 m~~~Kv~~I~GTRPE~iKmapli~~~~~~-~-~~~~~vi~TGQH~d~em~~~~le~~~i~--~pdy~L~i~~~~~tl~~~   76 (383)
T COG0381           1 MKMLKVLTIFGTRPEAIKMAPLVKALEKD-P-DFELIVIHTGQHRDYEMLDQVLELFGIR--KPDYDLNIMKPGQTLGEI   76 (383)
T ss_pred             CCCEEEEEEEECCHHHHHHHHHHHHHHHC-C-CCCEEEEEECCCCCHHHHHHHHHHHCCC--CCCCCHHCCCCCCCHHHH
T ss_conf             99638999985589999870999999858-9-9735999706654277899999982898--888313216668888999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC----CCCCCCCCCCHHHHHHHHHH
Q ss_conf             66459999999999861001288868985117765799998663013463111100----22110036635579999986
Q gi|254780767|r   67 VRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC----PSVWAWREGRARKMCAYINQ  142 (383)
Q Consensus        67 l~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~----PqvWAWr~~R~k~~~~~~d~  142 (383)
                      .      -+.+..+.+.+.+.+||+|+.  ..|=|--+|-.+-....+|||.|.=+    =..+ |-+.   .-++.+|+
T Consensus        77 t------~~~i~~~~~vl~~~kPD~VlV--hGDT~t~lA~alaa~~~~IpV~HvEAGlRt~~~~-~PEE---~NR~l~~~  144 (383)
T COG0381          77 T------GNIIEGLSKVLEEEKPDLVLV--HGDTNTTLAGALAAFYLKIPVGHVEAGLRTGDLY-FPEE---INRRLTSH  144 (383)
T ss_pred             H------HHHHHHHHHHHHHHCCCEEEE--ECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCC-CCHH---HHHHHHHH
T ss_conf             9------999999999998629998999--1785368899999998689368874254447877-8379---87878877


Q ss_pred             HCCC--CCCC--HHHHHCCCCC---CEEECCCCCCCCCCCCCCHHH----HHHHCCCCCCCCEEEEEECCCCCCHHHHCC
Q ss_conf             4015--6774--2232002553---147638821122100135588----897618765565059985387430123051
Q gi|254780767|r  143 VISI--LPFE--KEVMQRLGGP---PTTFVGHPLSSSPSILEVYSQ----RNKQRNTPSQWKKILLLPGSRAQEIYKILP  211 (383)
Q Consensus       143 ~~~i--fpFE--~~~f~k~~~~---~~~fVGHPl~d~~~~~~~~~~----~~~~~~~~~~~~~I~llPGSR~~EI~~~lP  211 (383)
                      +.-+  =|=|  ++...+ .|+   .+..+|+|..|.......+..    ....+-.+.++++|++ -+-|+--+...+.
T Consensus       145 ~S~~hfapte~ar~nLl~-EG~~~~~IfvtGnt~iDal~~~~~~~~~~~~~~~~~~~~~~~~~iLv-T~HRreN~~~~~~  222 (383)
T COG0381         145 LSDLHFAPTEIARKNLLR-EGVPEKRIFVTGNTVIDALLNTRDRVLEDSKILAKGLDDKDKKYILV-TAHRRENVGEPLE  222 (383)
T ss_pred             HHHHHCCCHHHHHHHHHH-CCCCCCCEEEECCHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCEEEE-ECCHHHCCCCCHH
T ss_conf             652303771999999997-69995516885973999999877641000466776632456738999-7055540364299


Q ss_pred             CHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHH-HHHCCCCCEEEEEC----CCCHHHHHHHHHHHCCCHHHHHHHHHHC
Q ss_conf             118999876402735126201663368899999-96048885055205----5203578876355233115668887627
Q gi|254780767|r  212 FFESAVASLVKRNPFFRFSLVTVSSQENLVRCI-VSKWDISPEIIIDK----EQKKQVFMTCNAAMAASGTVILELALCG  286 (383)
Q Consensus       212 ~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~-~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~SGTaTLE~al~g  286 (383)
                      -+.+++.++.++++++.++.|..+.  ..++.. ....+...++.+..    .+...++..|.+.++-||+..-|+..+|
T Consensus       223 ~i~~al~~i~~~~~~~~viyp~H~~--~~v~e~~~~~L~~~~~v~li~pl~~~~f~~L~~~a~~iltDSGgiqEEAp~lg  300 (383)
T COG0381         223 EICEALREIAEEYPDVIVIYPVHPR--PRVRELVLKRLKNVERVKLIDPLGYLDFHNLMKNAFLILTDSGGIQEEAPSLG  300 (383)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC--HHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHCEEEEECCCCHHHHHHHCC
T ss_conf             9999999999867895699747997--66668899983898767986883669899999745099954871354477619


Q ss_pred             CCEEEECC-CCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             53025405-77410000102467610230244078426124205489899999999984498999999999999999838
Q gi|254780767|r  287 IPVVSIYK-SEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       287 ~P~IV~Yk-~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg  365 (383)
                      +|.+++=. |-+-...-     .-    .|++.           ..+.++|.+++..+++|++..++|.+.    ..--|
T Consensus       301 ~Pvl~lR~~TERPE~v~-----ag----t~~lv-----------g~~~~~i~~~~~~ll~~~~~~~~m~~~----~npYg  356 (383)
T COG0381         301 KPVLVLRDTTERPEGVE-----AG----TNILV-----------GTDEENILDAATELLEDEEFYERMSNA----KNPYG  356 (383)
T ss_pred             CCEEEECCCCCCCCCEE-----CC----CEEEE-----------CCCHHHHHHHHHHHHHCHHHHHHHHCC----CCCCC
T ss_conf             92776136777841000-----37----04871-----------765899999999986295889987425----58886


Q ss_pred             CCCCHHHHHHHHHHHHC
Q ss_conf             99998999999999861
Q gi|254780767|r  366 TKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       366 ~~~~a~~~AA~~I~~~L  382 (383)
                      ... ++++-++++.+..
T Consensus       357 dg~-as~rIv~~l~~~~  372 (383)
T COG0381         357 DGN-ASERIVEILLNYF  372 (383)
T ss_pred             CCC-HHHHHHHHHHHHH
T ss_conf             750-5799999999885


No 46 
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center
Probab=99.35  E-value=2.5e-10  Score=88.09  Aligned_cols=260  Identities=19%  Similarity=0.239  Sum_probs=159.9

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE-EEC------CC-CC----CCCCCCHHHHHHHHHHHC
Q ss_conf             9999861001288868985117765799998663013463111-100------22-11----003663557999998640
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN-YVC------PS-VW----AWREGRARKMCAYINQVI  144 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~-yv~------Pq-vW----AWr~~R~k~~~~~~d~~~  144 (383)
                      ...+.+.+++.+||+|-.= + ++.--.+-.+.++ .|||+++ |=.      |. .|    .|-..+-+.+.+..|.++
T Consensus        71 ~~~l~r~lr~~~pDlIHaH-~-~~~g~~~~~~a~~-~~iP~V~T~Hg~d~~~~~~~~~~~~~~~~~~~~~~l~~~a~~iI  147 (367)
T cd05844          71 APQLRRLLRRHRPDLVHAH-F-GFDGVYALPLARR-LGVPLVVTFHGFDATTSLALLLRSRWALYARRRRRLARRAALFI  147 (367)
T ss_pred             CHHHHHHHHHCCCCEEEEC-C-CCHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCHHCCCHHHHHHHHHHHHHHHCCEEE
T ss_conf             4899999997699999976-8-6068999999999-69999999813641014101001104678999999997269999


Q ss_pred             CCCCCCHHHHHCCCCCC---EEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHH
Q ss_conf             15677422320025531---476388211221001355888976187655650599853874301230511189998764
Q gi|254780767|r  145 SILPFEKEVMQRLGGPP---TTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLV  221 (383)
Q Consensus       145 ~ifpFE~~~f~k~~~~~---~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~  221 (383)
                      |.=.+..+...+. |++   ++.+-|-+ |... ...      .  ..+......++-| |-.| ++.++.+++++..+.
T Consensus       148 ~vS~~~~~~l~~~-G~~~~ki~vi~~Gv-D~~~-f~~------~--~~~~~~~~il~vG-Rl~~-~KG~~~li~A~~~l~  214 (367)
T cd05844         148 AVSQFIRDRLLAL-GFPPEKVHVHPIGV-DTAK-FTP------A--TPARRPPRILFVG-RFVE-KKGPLLLLEAFARLA  214 (367)
T ss_pred             ECCHHHHHHHHHC-CCCHHHEEEECCCC-CHHH-CCC------C--CCCCCCCEEEEEE-CCCC-CCCHHHHHHHHHHHH
T ss_conf             6999999999985-98978999977863-6764-699------9--8777896899993-5730-007699999999979


Q ss_pred             HCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC-----------HHHHHHHHHHC
Q ss_conf             027351262016633688999999604888505520----552035788763552331-----------15668887627
Q gi|254780767|r  222 KRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS-----------GTVILELALCG  286 (383)
Q Consensus       222 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S-----------GTaTLE~al~g  286 (383)
                      +++|++++++.........++....+.++...+.+.    .++..+.|+.||+.+..|           |.+.+|++.+|
T Consensus       215 ~~~p~~~l~ivG~Gp~~~~l~~~~~~l~l~~~V~f~G~~~~~~v~~~l~~adv~v~PS~~~~~g~~Eg~~~~~lEAmA~G  294 (367)
T cd05844         215 RRVPEVRLVIIGDGPLLAALEALARALGLGGRVTFLGAQPHAEVRELMRRARIFLQPSVTAPSGDAEGLPVVLLEAQASG  294 (367)
T ss_pred             HHCCCEEEEEEECCCCHHHHHHHHHHCCCCCCEEECCCCCCHHHHHHHHHCCEEEEEEEECCCCCCCCCCHHHHHHHHCC
T ss_conf             66869799999888378999999997098763787788981889999985787996002037788567637999999849


Q ss_pred             CCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCC---CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             5302540577410000102467610230244078---4261242054898999999999844989999999999999998
Q gi|254780767|r  287 IPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDY---PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDR  363 (383)
Q Consensus       287 ~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~---~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~  363 (383)
                      +|.| +-+.+               ++|-++.+.   -++||     -+++.+++.+..+++|++.+++|-.+.++..+.
T Consensus       295 ~PVV-at~~g---------------gi~e~V~~g~~G~lv~~-----~d~~~La~ai~~Ll~d~~~~~~m~~~gr~~v~~  353 (367)
T cd05844         295 VPVV-ATRHG---------------GIPEAVEDGETGLLVPE-----GDVAALAAALGRLLADPDLRARMGAAGRRRVEE  353 (367)
T ss_pred             CCEE-EECCC---------------CCHHHHCCCCCEEEECC-----CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9789-92799---------------86877207996899789-----999999999999984999999999999999998


Q ss_pred             HCCCCCHHHHHHH
Q ss_conf             3899998999999
Q gi|254780767|r  364 MNTKKPAGHMAAE  376 (383)
Q Consensus       364 Lg~~~~a~~~AA~  376 (383)
                         .-+.++.+++
T Consensus       354 ---~f~~~~~~~~  363 (367)
T cd05844         354 ---RFDLRRQTAK  363 (367)
T ss_pred             ---HCCHHHHHHH
T ss_conf             ---1999999999


No 47 
>pfam04007 DUF354 Protein of unknown function (DUF354). Members of this family are around 350 amino acids in length. They are found in archaebacteria and have no known function.
Probab=99.34  E-value=9.8e-11  Score=90.81  Aligned_cols=300  Identities=17%  Similarity=0.165  Sum_probs=173.7

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE----EECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             4599997682147899999999997389983999----971789994788065044453110136746645999999999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLV----GVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~----giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      |||||=.+-+.-=..-..++++|+++ +.++-+.    +.--+.++..|++-.    .++--|- ....++-.......+
T Consensus         1 MkIwiDI~~p~hvhfFk~iI~eL~k~-GheV~iTaR~~~~~~~LL~~y~i~~~----~iG~~g~-s~~~Kl~~~~~R~~~   74 (335)
T pfam04007         1 LKVWIDITNAPHVHFFKPIISELEKE-GYEVLLTCRKFGELPELLRSLGFQVK----SIGKHGA-TLIKKLLSSAERVYL   74 (335)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHCCCCEE----EECCCCC-CHHHHHHHHHHHHHH
T ss_conf             93999789950888899999999868-98899999613519999997699769----9758888-889999999999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCC
Q ss_conf             986100128886898511776579999866301346311110-0221100366355799999864015677422320025
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLG  158 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~  158 (383)
                      +.+.+++++||++|...+|+-. ++|.     +.|+|.|.+. .|+  |=...|  ..--++|.+++-..+-.+++.++ 
T Consensus        75 L~~~~~~~~PDv~is~~S~~a~-~va~-----~LgipsI~f~Dteh--a~~~~~--Lt~Pf~~~i~~P~~~~~~~~~~~-  143 (335)
T pfam04007        75 LTKLIPEKKPDVAIMKNSMELP-RVAF-----GLRIPSIIVLDNEH--ALAANK--LTFPLADYILVPEIIDDEFLRFF-  143 (335)
T ss_pred             HHHHHHHHCCCEEEECCCHHHH-HHHH-----HCCCCEEEEECCHH--HCCCCE--EEEECCCEEECCCCCCHHHHHHH-
T ss_conf             9999886299789944880199-9998-----82998799947755--412330--23123868881244677899860-


Q ss_pred             CCC---EEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCC-CHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             531---4763882112210013558889761876556505998538743-012305111899987640273512620166
Q gi|254780767|r  159 GPP---TTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQ-EIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       159 ~~~---~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~-EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      |.+   .+|=|---.-++....+..+..+++|+++ +++|.+=|.|-.+ =....-++.-+.++.+.+. .+-.+++|-.
T Consensus       144 G~~~~i~~y~g~~E~a~l~~F~Pd~~vl~~lgl~~-~~yIvvR~~~~~A~y~~g~~~i~~~ii~~l~~~-~~~iv~~pr~  221 (335)
T pfam04007       144 GADNRIRTYPGIKEIANISDYVPDPEILKKLGLEF-EEYIVMRPEPLASSYVNGHESILPEIIEMLTKE-GVNIIYFPRN  221 (335)
T ss_pred             CCCCCEEEECCCCEEEECCCCCCCHHHHHHCCCCC-CCEEEEEECCCCCEECCCCCCHHHHHHHHHHHC-CCCEEEECCC
T ss_conf             87785676668441432166689865787649987-988999616455600114421599999999875-9819997587


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEE
Q ss_conf             33688999999604888505520552035788763552331156688876275302540577410000102467610230
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALP  314 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~Lp  314 (383)
                      +++.    ....++.  ..+....-+..+++..||+.|..+||.+.|+|++|||+|-||...... .=..+++.      
T Consensus       222 ~~q~----~~~~~~~--v~i~~~~vd~~~Lly~adl~Ig~GgTMa~EAAlLGtPaIs~~p~~~~~-vd~~l~~~------  288 (335)
T pfam04007       222 KEQR----EIFRGFD--VIIPKKPVDTLSLLYYSDLVIGAGGTMNREAALLGTPAVSCYPGKLLA-VDKYLIEK------  288 (335)
T ss_pred             CHHH----HHHCCCC--EECCCCCCCHHHHHHHCCEEECCCHHHHHHHHHHCCCEEEECCCCCCH-HHHHHHHC------
T ss_conf             0366----7750477--036788877788886546897275689999998289879843885213-67999867------


Q ss_pred             HHHCCCCCCCHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             2440784261242054898999999999844
Q gi|254780767|r  315 NLIVDYPLVPEYFNSMIRSEALVRWIERLSQ  345 (383)
Q Consensus       315 Nii~~~~ivPEliQ~~~~~~~i~~~~~~ll~  345 (383)
                            .    ++-.--+++++.+.+.+.+.
T Consensus       289 ------g----l~~~~~d~~~i~~~v~~~~~  309 (335)
T pfam04007       289 ------G----EMYHSTDPREIVNYVISNLK  309 (335)
T ss_pred             ------C----CEEEECCHHHHHHHHHHHHH
T ss_conf             ------9----87961898999999999860


No 48 
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=99.33  E-value=1.1e-09  Score=83.91  Aligned_cols=313  Identities=15%  Similarity=0.132  Sum_probs=165.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHH-HHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             4789999999999738998399997178999478806504445311013674-664599999999998610012888689
Q gi|254780767|r   15 GDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQV-VRHLPQFIFRINQTVELIVSSKPDVLL   93 (383)
Q Consensus        15 GD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~ev-l~~~~~~~~~~~~~~~~i~~~~Pd~vi   93 (383)
                      -..|...|.++|.++ +.++.++.........   .  .......+..+... ......+...+..+. .....+||.++
T Consensus        17 ~e~~v~~La~~L~~~-Gh~V~v~t~~~~~~~~---~--~~~~gv~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~d~~~   89 (363)
T cd04955          17 FETFVEELAPRLVAR-GHEVTVYCRSPYPKQK---E--TEYNGVRLIHIPAPEIGGLGTIIYDILAIL-HALFVKRDIDH   89 (363)
T ss_pred             HHHHHHHHHHHHHHC-CCEEEEEECCCCCCCC---C--EEECCEEEEEECCCCCCCHHHHHHHHHHHH-HHHHHCCCEEE
T ss_conf             899999999999977-9979999878988887---5--134777999927644451677898999999-99860899899


Q ss_pred             EECHHHHHHHHHHHHHHHCCCCCCEEEECCCC-----CCCCCCCH-----HHHHHHHHHHCCCCCCCHHHHHCCCCCCEE
Q ss_conf             85117765799998663013463111100221-----10036635-----579999986401567742232002553147
Q gi|254780767|r   94 IVDNPDFTHRVAKRVRKKMPNLPIINYVCPSV-----WAWREGRA-----RKMCAYINQVISILPFEKEVMQRLGGPPTT  163 (383)
Q Consensus        94 ~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pqv-----WAWr~~R~-----k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~  163 (383)
                      .-...-+....+..+++.  ++|++.-+--.-     |.+-..+.     +...+..|+++|.-+...+++.+..+.+.+
T Consensus        90 ~h~~~~~~~~~~~~~~~~--~~~~v~t~Hg~~~~~~~~~~~~~~~~~~~~~~~~~~ad~vi~~S~~~~~~l~~~~~~~~~  167 (363)
T cd04955          90 VHALGPAIAPFLPLLRLK--GKKVVVNMDGLEWKRAKWGRPAKRYLKFGEKLAVKFADRLIADSPGIKEYLKEKYGRDST  167 (363)
T ss_pred             EEECCHHHHHHHHHHHHC--CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHCCCCCE
T ss_conf             997781689999999733--983999936740113220178999999999999860899999988999999986499839


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC-CHHHHHH
Q ss_conf             638821122100135588897618765565059985387430123051118999876402735126201663-3688999
Q gi|254780767|r  164 FVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS-SQENLVR  242 (383)
Q Consensus       164 fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~-~~~~~~~  242 (383)
                      ++-|+. |. .........+++.++.+++  ..++.| |-..- +.+..+++++.++..   ++.+++.... ......+
T Consensus       168 vIpnGv-d~-~~~~~~~~~~~~~~~~~~~--~il~vg-Rl~~~-Kg~~~ll~A~~~l~~---~~~l~iiG~g~~~~~~~~  238 (363)
T cd04955         168 YIPYGA-DH-VVSSEEDEILKKYGLEPGR--YYLLVG-RIVPE-NNIDDLIEAFSKSNS---GKKLVIVGNADHNTPYGK  238 (363)
T ss_pred             EECCCC-CC-CCCCCCHHHHHHCCCCCCC--EEEEEE-CCCCC-CCHHHHHHHHHHHCC---CCEEEEECCCCCCCHHHH
T ss_conf             978987-54-6777506679870899898--899994-47530-479999999985263---561999777776308999


Q ss_pred             HHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC------HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEE
Q ss_conf             999604888505520----552035788763552331------1566888762753025405774100001024676102
Q gi|254780767|r  243 CIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS------GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCA  312 (383)
Q Consensus       243 ~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S------GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~  312 (383)
                      ..........+|.+.    .++..+.++.||+.+..|      |.+.||++++|+|.| +.........           
T Consensus       239 ~l~~~~~~~~~V~flG~~~~~~~~~~~~~ad~~v~pS~~~Eg~~~~~lEAma~G~PVV-as~~~~~~ev-----------  306 (363)
T cd04955         239 LLKEKAAADPRIIFVGPIYDQELLELLRYAALFYLHGHSVGGTNPSLLEAMAYGCPVL-ASDNPFNREV-----------  306 (363)
T ss_pred             HHHHHHCCCCCEEEECCCCCHHHHHHHHCCCEEECCCCCCCCCCHHHHHHHHHCCCEE-ECCCCCCCEE-----------
T ss_conf             9999734699379707888477898631354464345666787689999998199999-9179987069-----------


Q ss_pred             EEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHCCC
Q ss_conf             30244078426124205489899999999984498999999999999-99983899
Q gi|254780767|r  313 LPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LWDRMNTK  367 (383)
Q Consensus       313 LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~~~Lg~~  367 (383)
                          +.+...   ++   -+++.+++.+.++++|++.|++|-++..+ +.+....+
T Consensus       307 ----~~~~~~---~~---~~~~~la~~i~~ll~d~~~~~~~g~~ar~~v~~~fsw~  352 (363)
T cd04955         307 ----LGDKAI---YF---KVGDDLASLLEELEADPEEVSAMAKAARERIREKYTWE  352 (363)
T ss_pred             ----ECCCEE---EC---CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             ----758847---77---99899999999997599999999999999999858999


No 49 
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional
Probab=99.30  E-value=1.1e-09  Score=83.84  Aligned_cols=308  Identities=13%  Similarity=0.119  Sum_probs=164.5

Q ss_pred             CCCEEEEEECCCCH----HHHHHHHHHHHHHHCCCCEEEEEEC--CHHHHHCCCEEEECHHHCCEEEHHH-HHHHHHHHH
Q ss_conf             87459999768214----7899999999997389983999971--7899947880650444531101367-466459999
Q gi|254780767|r    2 NSLKIAVIAGEISG----DLLAGDLIKSLKEMVSYPINLVGVG--GPSLQKEGLVSLFDFSELSVIGIMQ-VVRHLPQFI   74 (383)
Q Consensus         2 ~~mki~i~aGE~SG----D~~~a~li~~Lk~~~~~~~~~~giG--G~~m~~~G~~~~~~~~~l~v~G~~e-vl~~~~~~~   74 (383)
                      ++|||.++...-+|    ..+...|+.+|.+. ..++++.-+.  ++.-+..       ...+....... .-..+.+..
T Consensus         1 ~~MKIlfi~~~l~~~GGaErvl~~La~~L~~~-~~~~~v~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~   72 (361)
T PRK09922          1 KKMKIAFIGEAVSGFGGMETVISNVINTFENS-KINCEMFFFCRNDKMDKAW-------LKKIKYAQSFSNIKLSFLRRA   72 (361)
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHH-CCCEEEEEEECCCCCCHHH-------HHCCCCEEECCCCCCCHHHHH
T ss_conf             97099999999999880499999999999871-9987999993498541557-------644772243366552024578


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECHHHHH-HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHH--HHHHHHHHHCCCCCCCH
Q ss_conf             999999861001288868985117765-799998663013463111100221100366355--79999986401567742
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIVDNPDFT-HRVAKRVRKKMPNLPIINYVCPSVWAWREGRAR--KMCAYINQVISILPFEK  151 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~iD~pgFn-l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k--~~~~~~d~~~~ifpFE~  151 (383)
                      +....+.+.+++.+||+++..+..... .+++++.  .+..++++++  ++... ...+..  ...++.|..+++-....
T Consensus        73 ~~~~~l~~~ik~~~~Dii~~~~~~~~~~~~~~~~~--~~~~~~ii~~--~h~~~-~~~~~~~~~~~~~~d~~i~vS~~~~  147 (361)
T PRK09922         73 KHVYNFSQWLKETSPDIVICIDVISCLYANKARKK--SGKQFKIFSW--PHFSL-DHKKHAECITLVYADYHLAISSGIK  147 (361)
T ss_pred             HHHHHHHHHHHHHCCCEEEECCHHHHHHHHHHHHH--CCCCCEEEEE--CCCCH-HHHHHHHHHHHHHCCEEEEECHHHH
T ss_conf             99999999999709999999880689999999998--2999589997--55653-4267899899985885699578999


Q ss_pred             HHHHCCCCC---CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             232002553---14763882112210013558889761876556505998538743012305111899987640273512
Q gi|254780767|r  152 EVMQRLGGP---PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       152 ~~f~k~~~~---~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
                      +.+.+. ++   ++..+-||+-.... ..+..        ..+.+...+.-|.=.-+=.+++..+++++.++   .++.+
T Consensus       148 ~~~~~~-~~~~~ki~vI~N~i~~~~~-~~~~~--------~~~~~~~il~vGRl~~~~qK~~~~li~a~~~~---~~~~~  214 (361)
T PRK09922        148 EQMIAR-GISAQRISVIYNPVEIKTI-IIPPP--------ERDKPAVFLYVGRLKFEGQKNVKELFDGLSRT---TGEWQ  214 (361)
T ss_pred             HHHHHC-CCCHHCEEEEECCCCHHHC-CCCCH--------HHCCCCEEEEEECCCCCCCCCHHHHHHHHHHH---CCCCE
T ss_conf             999970-9975429999599173540-46750--------31578779999544452568999999999854---89948


Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCCEEEEEC--CC----CHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCC
Q ss_conf             620166336889999996048885055205--52----035788763552331-----1566888762753025405774
Q gi|254780767|r  229 FSLVTVSSQENLVRCIVSKWDISPEIIIDK--EQ----KKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEW  297 (383)
Q Consensus       229 ~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~--~~----~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~  297 (383)
                      +.+....+.++.+++..++.++..+|.+..  .+    ..+.++.||+.+.+|     |.+-||++.+|+|.|..--.+.
T Consensus       215 L~IvG~G~~~~~L~~~i~~l~l~~~V~flG~~~np~~~l~~~~~~adifVl~S~~EGfp~vllEAma~G~PvIatd~~~G  294 (361)
T PRK09922        215 LHIIGDGSDFEKCKAYSRELGIEQRIIWHGWQSNPWEVVQQKIKNVSALLLTSKFEGFPMTLLEAMSYGIPCISSDCMSG  294 (361)
T ss_pred             EEEEEEECCHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCHHHHHHHHCCCEEEECCCCC
T ss_conf             99998438899999999983898738990675987999999985134999647556887289999995998999759999


Q ss_pred             CEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHH
Q ss_conf             1000010246761023024407842612420548989999999998449899999
Q gi|254780767|r  298 IVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRA  352 (383)
Q Consensus       298 lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~  352 (383)
                      ...               ||-+.+ -= ++-+.-+++.+++++.++++|......
T Consensus       295 ~~E---------------iI~dg~-nG-~Lv~~~d~~~la~~i~~li~~e~~~~~  332 (361)
T PRK09922        295 PRD---------------IIKPGL-NG-ELYTPGNIDEFVGKLNKVISGEVKYQH  332 (361)
T ss_pred             CHH---------------HHCCCC-CE-EEECCCCHHHHHHHHHHHHHCHHHCCH
T ss_conf             088---------------715898-37-997799999999999999848221399


No 50 
>pfam04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
Probab=99.29  E-value=4.2e-11  Score=93.20  Aligned_cols=158  Identities=16%  Similarity=0.187  Sum_probs=111.2

Q ss_pred             EEEEEECCCCCC-HHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             059985387430-1230511189998764027351262016633688999999604888505520552035788763552
Q gi|254780767|r  194 KILLLPGSRAQE-IYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAM  272 (383)
Q Consensus       194 ~I~llPGSR~~E-I~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai  272 (383)
                      +|+++.||..++ +.+.+|   ++...+.....+++++..+.....+.++..+.+.+.+..+....++..++|+.||++|
T Consensus         1 TiLV~GGSqGa~~lN~~v~---~~~~~~~~~~~~~~vihq~G~~~~~~~~~~~~~~~~~~~~~~f~~~m~~~~~~adlvI   77 (167)
T pfam04101         1 TIFVTGGSQGAQALNRLVL---EVDPLLELKGIEYQVLHQTGKSDYEPVNCKYSKFGINVEVFPFIDNMAEYIKAADLVI   77 (167)
T ss_pred             CEEEEECHHHHHHHHHHHH---HHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHCCHHH
T ss_conf             9899954488999999999---9999987539982999985973589999998605998899712555999999660688


Q ss_pred             CCCHHHHH-HHHHHCCCEEEECCCCC---CEEEEEE-CCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCH
Q ss_conf             33115668-88762753025405774---1000010-2467610230244078426124205489899999999984498
Q gi|254780767|r  273 AASGTVIL-ELALCGIPVVSIYKSEW---IVNFFIF-YIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDT  347 (383)
Q Consensus       273 ~~SGTaTL-E~al~g~P~IV~Yk~~~---lt~~i~~-lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~  347 (383)
                      +.+|+.|+ |++..|+|+|++---+.   ..+.-++ +.+.- .+        .++   .|.+++++.|.+.+.+++.|+
T Consensus        78 sRaGa~Ti~E~~~~g~P~IliP~p~~~~~hQ~~NA~~l~~~g-aa--------~~i---~e~~~~~~~L~~~i~~l~~~~  145 (167)
T pfam04101        78 SRAGAGTIAELLALGKPAILVPRPKAAGEHQDNNALELVKAG-AA--------LVL---LQKELTPEKLVEALLKLLLKP  145 (167)
T ss_pred             HCCCCHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHCC-CE--------EEE---ECCCCCHHHHHHHHHHHHCCH
T ss_conf             657622799999948998997076556563999999999879-98--------996---426799999999999998699


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             99999999999999983899998
Q gi|254780767|r  348 LQRRAMLHGFENLWDRMNTKKPA  370 (383)
Q Consensus       348 ~~r~~~~~~~~~~~~~Lg~~~~a  370 (383)
                      +.+++|.++.+    +++.+.++
T Consensus       146 ~~l~~m~~~a~----~~~~~da~  164 (167)
T pfam04101       146 LRLYEMNKAAK----GSRLKDAI  164 (167)
T ss_pred             HHHHHHHHHHH----HCCCCCHH
T ss_conf             99999999998----44894845


No 51 
>COG1817 Uncharacterized protein conserved in archaea [Function unknown]
Probab=99.17  E-value=8.4e-09  Score=78.05  Aligned_cols=305  Identities=16%  Similarity=0.148  Sum_probs=181.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEE--E--EECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             459999768214789999999999738998399--9--971789994788065044453110136746645999999999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINL--V--GVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~--~--giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      ||++|=.|-+---.....++.+|+++ +..+-+  +  |.-++.|...|++    .+.++-.|..-.--++-.-..+...
T Consensus         1 mkVwiDI~n~~hvhfFk~lI~elekk-G~ev~iT~rd~~~v~~LLd~ygf~----~~~Igk~g~~tl~~Kl~~~~eR~~~   75 (346)
T COG1817           1 MKVWIDIGNPPHVHFFKNLIWELEKK-GHEVLITCRDFGVVTELLDLYGFP----YKSIGKHGGVTLKEKLLESAERVYK   75 (346)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHC-CEEEEEEEEECCCHHHHHHHHCCC----EEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             93799758961023899999999857-849999985127588999983997----0764045774478999999999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC-CCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCC
Q ss_conf             9861001288868985117765799998663013463111100-221100366355799999864015677422320025
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC-PSVWAWREGRARKMCAYINQVISILPFEKEVMQRLG  158 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~-PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~  158 (383)
                      +.+.+.+++||+.+.+-+|.    +++...  +.|+|.|.++- ||-=+= .   |.+..++|.+++-=.+..+.-.+.+
T Consensus        76 L~ki~~~~kpdv~i~~~s~~----l~rvaf--gLg~psIi~~D~ehA~~q-n---kl~~Pla~~ii~P~~~~~~~~~~~G  145 (346)
T COG1817          76 LSKIIAEFKPDVAIGKHSPE----LPRVAF--GLGIPSIIFVDNEHAEAQ-N---KLTLPLADVIITPEAIDEEELLDFG  145 (346)
T ss_pred             HHHHHHHCCCCEEEECCCCC----HHHHHH--HCCCCEEEECCCHHHHHH-H---HCCHHHHHHEECCCCCCHHHHHHHC
T ss_conf             99987522985575227810----556776--528863896487547778-6---3000244215064344357788708


Q ss_pred             CCCEEECCCCCCCCC---CCCCCHHHHHHHCCCCCCCCEEEEEECCCCCC---HHHHCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             531476388211221---00135588897618765565059985387430---123051118999876402735126201
Q gi|254780767|r  159 GPPTTFVGHPLSSSP---SILEVYSQRNKQRNTPSQWKKILLLPGSRAQE---IYKILPFFESAVASLVKRNPFFRFSLV  232 (383)
Q Consensus       159 ~~~~~fVGHPl~d~~---~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~E---I~~~lP~~l~~~~~l~~~~~~~~~~i~  232 (383)
                      .-+..|+|.+=..+.   ....+..+..+++|+..+.+.|.+=|-|-.+-   =.+...+..+.++.+.+. +  ..++|
T Consensus       146 ~~p~~i~~~~giae~~~v~~f~pd~evlkeLgl~~~~~yIVmRpe~~~A~y~~g~~~~~~~~~li~~l~k~-g--iV~ip  222 (346)
T COG1817         146 ADPNKISGYNGIAELANVYGFVPDPEVLKELGLEEGETYIVMRPEPWGAHYDNGDRGISVLPDLIKELKKY-G--IVLIP  222 (346)
T ss_pred             CCCCCEECCCCEEEEEECCCCCCCHHHHHHCCCCCCCCEEEEEECCCCCEEECCCCCHHHHHHHHHHHHHC-C--EEEEC
T ss_conf             89552113566267731026798878998758887986699964344542343322256688899988757-2--89955


Q ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEE
Q ss_conf             66336889999996048885055205520357887635523311566888762753025405774100001024676102
Q gi|254780767|r  233 TVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCA  312 (383)
Q Consensus       233 ~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~  312 (383)
                      ....+.    +....+.... +--.-.++.+++-.|++.+.+|||..-|+|++|+|.|-||---.+ +.=+.++..   |
T Consensus       223 r~~~~~----eife~~~n~i-~pk~~vD~l~Llyya~lvig~ggTMarEaAlLGtpaIs~~pGkll-~vdk~lie~---G  293 (346)
T COG1817         223 REKEQA----EIFEGYRNII-IPKKAVDTLSLLYYATLVIGAGGTMAREAALLGTPAISCYPGKLL-AVDKYLIEK---G  293 (346)
T ss_pred             CCHHHH----HHHHHHCCCC-CCCCCCCHHHHHHHHHEEECCCCHHHHHHHHHCCCEEEECCCCCC-CCCHHHHHC---C
T ss_conf             755689----9874101105-885552278788654156417703788888728834785388533-223898866---8


Q ss_pred             EEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHH
Q ss_conf             302440784261242054898999999999844989
Q gi|254780767|r  313 LPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTL  348 (383)
Q Consensus       313 LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~  348 (383)
                                   ++-+.+++..+.+.+.+.+.++.
T Consensus       294 -------------~~~~s~~~~~~~~~a~~~l~~~~  316 (346)
T COG1817         294 -------------LLYHSTDEIAIVEYAVRNLKYRR  316 (346)
T ss_pred             -------------CEEECCCHHHHHHHHHHHHHCHH
T ss_conf             -------------43431788899999999842500


No 52 
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase  family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B st
Probab=99.12  E-value=2.3e-08  Score=75.18  Aligned_cols=339  Identities=17%  Similarity=0.142  Sum_probs=176.8

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHC-CCE---EEECHHH---CCEEEHHHHHHHHHHHHHHH
Q ss_conf             5999976821478999999999973899839999717899947-880---6504445---31101367466459999999
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKE-GLV---SLFDFSE---LSVIGIMQVVRHLPQFIFRI   77 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~-G~~---~~~~~~~---l~v~G~~evl~~~~~~~~~~   77 (383)
                      ||.+++|--+-=..-+.|+++|++..+-+..+ -++|.+.... |..   ..+....   +.++|=.  -...-......
T Consensus         1 KI~~vtGtRae~~kl~pl~~~l~~~~~~~~~l-i~TGqH~~~~~g~t~~~i~~~~~~~~~~~~~~~~--~~~~~~~~~~~   77 (363)
T cd03786           1 KILVVTGTRPEYIKLAPLIRALKKDPGFELVL-VVTGQHYDMEMGVTFFEILFIIKPDYDLLLGSDS--QSLGAQTAGLL   77 (363)
T ss_pred             CEEEEEECHHHHHHHHHHHHHHHHCCCCCEEE-EEECCCCCHHCCCHHHHHHCCCCCCEEEECCCCC--CCHHHHHHHHH
T ss_conf             98999931371999999999997489998899-9938976701088899982688887785459999--76999999999


Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCC-CCCCCCCHHHHHHHHHHHCCC-CCCCHHHHH
Q ss_conf             999861001288868985117765799998663013463111100221-100366355799999864015-677422320
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSV-WAWREGRARKMCAYINQVISI-LPFEKEVMQ  155 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pqv-WAWr~~R~k~~~~~~d~~~~i-fpFE~~~f~  155 (383)
                      ..+.+.+.+.+||+|+..  .|=+=-+|-.+-....+||++|.-+=-. |-|+.= =...+..+|++..+ |.-.++..+
T Consensus        78 ~~~~~~l~~~kPD~VlV~--GDr~e~la~Alaa~~~~Ipi~HiegG~rs~~~~~~-de~~R~~i~kls~lhf~~t~~~~~  154 (363)
T cd03786          78 IGLEAVLLEEKPDLVLVL--GDTNETLAAALAAFKLGIPVAHVEAGLRSFDRGMP-DEENRHAIDKLSDLHFAPTEEARR  154 (363)
T ss_pred             HHHHHHHHHHCCCEEEEE--CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC-CHHHHHHHHHCCCEEECCCHHHHH
T ss_conf             999999997299999994--88842879999999819818996264334767998-779875522101256146199999


Q ss_pred             CC--CC---CCEEECCCCCCCCCCCCCC--HHHHHHHCCCCCCCCEEEEEECCCCCC-HHHHCCCHHHHHHHHHHCCCCC
Q ss_conf             02--55---3147638821122100135--588897618765565059985387430-1230511189998764027351
Q gi|254780767|r  156 RL--GG---PPTTFVGHPLSSSPSILEV--YSQRNKQRNTPSQWKKILLLPGSRAQE-IYKILPFFESAVASLVKRNPFF  227 (383)
Q Consensus       156 k~--~~---~~~~fVGHPl~d~~~~~~~--~~~~~~~~~~~~~~~~I~llPGSR~~E-I~~~lP~~l~~~~~l~~~~~~~  227 (383)
                      +.  .|   -++..||+|..|.+.....  ........+...+++.+++.-=-+..+ -+..+..+++++..+...  ++
T Consensus       155 ~L~~~G~~~~~I~~vG~~~iD~l~~~~~~~~~~~~~~~~~~~~~~~~lvt~Hr~~n~~~~~~~~~i~~al~~~~~~--~~  232 (363)
T cd03786         155 NLLQEGEPPERIFVVGNTMIDALLRLLELAKKELILELLGLLPKKYILVTLHRVENVDDGEQLEEILEALAELAEE--DV  232 (363)
T ss_pred             HHHHHCCCCCCEEECCCCHHHHHHHHHHHHHCCHHHHHCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHC--CC
T ss_conf             9986154755257738619999998876410326677445455877999964523335689999999999998743--96


Q ss_pred             EEEECCCCCHHHHHHHHHHHCC-CCCEEEEEC----CCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEE-CCCCCCEEE
Q ss_conf             2620166336889999996048-885055205----5203578876355233115668887627530254-057741000
Q gi|254780767|r  228 RFSLVTVSSQENLVRCIVSKWD-ISPEIIIDK----EQKKQVFMTCNAAMAASGTVILELALCGIPVVSI-YKSEWIVNF  301 (383)
Q Consensus       228 ~~~i~~~~~~~~~~~~~~~~~~-~~~~i~~~~----~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~-Yk~~~lt~~  301 (383)
                      .|+.|..+.....+.....++. ...++.+..    .+...++..|+++|+=||..--|+..+|+|+|++ -++.+-.. 
T Consensus       233 ~v~~pn~d~~~~~i~~~~~~~~~~~~~i~~~~~l~~~~~~~ll~~a~~vigdSsGi~Eea~~l~~P~i~ir~rqe~re~-  311 (363)
T cd03786         233 PVVFPNHPRTRPRIREAGLEFLGHHPNVLLISPLGYLYFLLLLKNADLVLTDSGGIQEEASFLGVPVLNLRDRTERPET-  311 (363)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCEEEEECCCCCEEEECCCCCCEEEECCCCCCCEE-
T ss_conf             8999779725778999999985578779997887749999999507399825888688502069878982687767342-


Q ss_pred             EEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             01024676102302440784261242054898999999999844989999999999999998389999899999999
Q gi|254780767|r  302 FIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIV  378 (383)
Q Consensus       302 i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I  378 (383)
                            .+.+  .|.+         +  ..+.+.|.+++..++++........      ..-.| .|.++++..+++
T Consensus       312 ------~~~~--~~~~---------v--~~~~~~I~~~i~~~l~~~~~~~~~~------~npyG-dG~as~rI~~iL  362 (363)
T cd03786         312 ------VESG--TNVL---------V--GTDPEAILAAIEKLLSDEFAYSLMS------INPYG-DGNASERIVEIL  362 (363)
T ss_pred             ------HHCC--EEEE---------C--CCCHHHHHHHHHHHHCCHHHHHCCC------CCCCC-CCHHHHHHHHHH
T ss_conf             ------1005--4886---------5--8999999999999975703453558------99897-987999999986


No 53 
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT1 family of glycosyltransferases.
Probab=99.11  E-value=5.1e-08  Score=72.85  Aligned_cols=320  Identities=13%  Similarity=0.056  Sum_probs=169.5

Q ss_pred             ECCCCHHHH-HHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHH-HHHHHHHHHHHHHHHCCCC
Q ss_conf             768214789-99999999973899839999717899947880650444531101367466-4599999999998610012
Q gi|254780767|r   10 AGEISGDLL-AGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVR-HLPQFIFRINQTVELIVSS   87 (383)
Q Consensus        10 aGE~SGD~~-~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~-~~~~~~~~~~~~~~~i~~~   87 (383)
                      +-...|.-. -..|++.+++. +.++++.=+-|+..--.-.+.+.+.-+-.-..+.+--. .|...  ......+.....
T Consensus         8 T~~gGGVa~~l~~Lv~~~~~l-Gv~~~w~V~~~~~~ff~~tk~~hn~Lqg~~~~ls~~~~~~y~~~--~~~na~~~~~~~   84 (372)
T cd03792           8 TPYGGGVAEILHSLVPLMRDL-GVDTRWEVIKGDPEFFNVTKKFHNALQGADIELSEEEKEIYLEW--NEENAERPLLDL   84 (372)
T ss_pred             CCCCCCHHHHHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHCCHHHCCCCCCCCHHHHHHHHHH--HHHHHHCCCCCC
T ss_conf             998876999999999999966-98169999459835789887500654199976798899999999--999873131027


Q ss_pred             CCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-----CCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCC--
Q ss_conf             8886898511776579999866301346311110-----022110036635579999986401567742232002553--
Q gi|254780767|r   88 KPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-----CPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGP--  160 (383)
Q Consensus        88 ~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-----~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~--  160 (383)
                      ..|+|+ |+.|- -+.+.+..++  .+.|+|+-.     .|+--+|.--  +..-+.+|....-.   ++|...  ++  
T Consensus        85 ~~DvV~-iHdpq-p~~l~~~~~~--~~~~~I~r~Hid~~~~~~~~w~fl--~~~i~~~d~~V~~~---~~~~~~--~~~~  153 (372)
T cd03792          85 DADVVV-IHDPQ-PLALPLFKKK--RGRPWIWRCHIDLSSPNRRVWDFL--QPYIEDYDAAVFHL---PEYVPP--QVPP  153 (372)
T ss_pred             CCCEEE-ECCCC-HHHHHHHHHC--CCCCEEEEECCCCCCCHHHHHHHH--HHHHHHCCEEEEEC---HHHHCC--CCCC
T ss_conf             999899-87936-6789998636--899589996886688538899999--99998579999973---575043--6887


Q ss_pred             CEEECCCCCCCCC----C--CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             1476388211221----0--013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  161 PTTFVGHPLSSSP----S--ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       161 ~~~fVGHPl~d~~----~--~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      +..++- |-.|..    .  ...+....+++.|+++++++|+..  ||-.. .+....++++..++.++.|+.++++...
T Consensus       154 ~~~~ip-~~IDpl~~kn~~l~~~~~~~~~~~~gi~~d~piIl~V--gRl~~-~Kg~~~li~A~~~~~~~~~d~~LvivG~  229 (372)
T cd03792         154 RKVIIP-PSIDPLSGKNRELSPADIEYILEKYGIDPERPYITQV--SRFDP-WKDPFGVIDAYRKVKERVPDPQLVLVGS  229 (372)
T ss_pred             CEEEEC-CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEE--EECCC-CCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             647816-7106677434558989999999982989899589998--72565-4686999999999997689978999899


Q ss_pred             CCH-----HHHHHHHHHHCCCCCEEEEEC--C----CCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCC
Q ss_conf             336-----889999996048885055205--5----2035788763552331-----15668887627530254057741
Q gi|254780767|r  235 SSQ-----ENLVRCIVSKWDISPEIIIDK--E----QKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWI  298 (383)
Q Consensus       235 ~~~-----~~~~~~~~~~~~~~~~i~~~~--~----~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~l  298 (383)
                      ...     ....++..........+.+..  .    ....+++.||+.+..|     |-+.+|++.+|+|.| +..++.+
T Consensus       230 g~~ddpe~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~l~~~adv~v~~S~~Egfgl~~lEAm~~G~PVV-as~vgGi  308 (372)
T cd03792         230 GATDDPEGWIVYEEVLEYAEGDPDIHVLTLPPVSDLEVNALQRASTVVLQKSIREGFGLTVTEALWKGKPVI-AGPVGGI  308 (372)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCCEE-ECCCCCC
T ss_conf             877781478999999997188996699936888678999999539799957642344469999998699899-8379983


Q ss_pred             EEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHH-HHHHHHHHHCCC
Q ss_conf             000010246761023024407842612420548989999999998449899999999-999999983899
Q gi|254780767|r  299 VNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLH-GFENLWDRMNTK  367 (383)
Q Consensus       299 t~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~-~~~~~~~~Lg~~  367 (383)
                      ...+..-    .-|+        ++|       +++.++..+.++++|++.|++|-+ +.+.+++.....
T Consensus       309 ~e~v~dg----~~G~--------Lv~-------~~d~~A~~i~~ll~d~~l~~~mg~~ar~~v~~~f~~~  359 (372)
T cd03792         309 PLQIEDG----ETGF--------LVD-------TVEEAAVRILYLLRDPELRRKMGANAREHVRENFLIT  359 (372)
T ss_pred             HHHCCCC----CCEE--------ECC-------CHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             7760489----8579--------889-------8699999999997499999999999999999878999


No 54 
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases. ExpC in Rhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucan (exopolysaccharide II).
Probab=99.08  E-value=1.8e-07  Score=69.29  Aligned_cols=315  Identities=14%  Similarity=0.080  Sum_probs=155.2

Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEE-CHHHCCEEEHH----HHHHHHHHHHHHHHHHHHHC-CCCCCCEEEE
Q ss_conf             999999973899839999717899947880650-44453110136----74664599999999998610-0128886898
Q gi|254780767|r   21 DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLF-DFSELSVIGIM----QVVRHLPQFIFRINQTVELI-VSSKPDVLLI   94 (383)
Q Consensus        21 ~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~-~~~~l~v~G~~----evl~~~~~~~~~~~~~~~~i-~~~~Pd~vi~   94 (383)
                      .|.++|.++ +.++.+..-+.+.-...|++.+. ........+..    ........-......+.... ..++||+|..
T Consensus        15 ~LA~~La~r-GHeV~Vit~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PDvVh~   93 (396)
T cd03818          15 HLAPALAAQ-GHEVVFLTEPNAAPPPGGVRVVRYRPPRGPTSGTHPYLREFEEAVLRGQAVARALLALRAKGFRPDVIVA   93 (396)
T ss_pred             HHHHHHHHC-CCEEEEEECCCCCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999999978-9989999689998899972688853368887777732344788888789999999999971899988998


Q ss_pred             ECHHHHHHHHHHHHHHHCCCCCCEEEEC----C------------CCCCCCCCCHHHH-------HHHHHHHCCCCCCCH
Q ss_conf             5117765799998663013463111100----2------------2110036635579-------999986401567742
Q gi|254780767|r   95 VDNPDFTHRVAKRVRKKMPNLPIINYVC----P------------SVWAWREGRARKM-------CAYINQVISILPFEK  151 (383)
Q Consensus        95 iD~pgFnl~lak~lkk~~~~ipvi~yv~----P------------qvWAWr~~R~k~~-------~~~~d~~~~ifpFE~  151 (383)
                      =...+..+-+    +...+++|++.|+.    +            +-|.| ..|.+..       ....|...+-=.++.
T Consensus        94 H~~~~~~l~l----~~~~p~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~ad~~v~~s~~~~  168 (396)
T cd03818          94 HPGWGETLFL----KDVWPDAPLIGYFEFYYRAEGADVGFDPEFPPSLDD-ALRLRNRNALILLALAQADAGVSPTRWQR  168 (396)
T ss_pred             CCCHHHHHHH----HHHCCCCCEEEEEEEEECCCCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHHHHCCEEECCCHHHH
T ss_conf             8705899999----985656878876412410365446778333655668-99999988888888984878871889999


Q ss_pred             HHHHCCCCCCEEECCCCCCCC--CCCCC-CHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             232002553147638821122--10013-558889761876556505998538743012305111899987640273512
Q gi|254780767|r  152 EVMQRLGGPPTTFVGHPLSSS--PSILE-VYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       152 ~~f~k~~~~~~~fVGHPl~d~--~~~~~-~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
                      +-|...-.-+++.+-|- +|.  +.+.. .............++++|+. -| |.-|=.+.++.+++++.++.++.|+.+
T Consensus       169 ~~~~~~~~~~i~VipnG-VD~~~f~P~~~a~~~~~~~~~~~~~~~vvl~-vG-R~l~~~KG~~~Ll~A~~~l~~~~p~~~  245 (396)
T cd03818         169 STFPAELRSRISVIHDG-IDTDRLRPDPQARLRLPNGRVLTPGDEVITF-VA-RNLEPYRGFHVFMRALPRLLRARPDAR  245 (396)
T ss_pred             HHHHHHHCCCEEEEECC-CCCCCCCCCHHHHHHHHHCCCCCCCCEEEEE-EC-CCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             75267624837998268-7713338880455544211468999869999-77-651304489999999999998789968


Q ss_pred             EEECCCCC---------HH---HHHHHHHHHCCCCCEEEE----ECCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCC
Q ss_conf             62016633---------68---899999960488850552----0552035788763552331-----156688876275
Q gi|254780767|r  229 FSLVTVSS---------QE---NLVRCIVSKWDISPEIII----DKEQKKQVFMTCNAAMAAS-----GTVILELALCGI  287 (383)
Q Consensus       229 ~~i~~~~~---------~~---~~~~~~~~~~~~~~~i~~----~~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~  287 (383)
                      +++...+.         ..   +.....+........+.+    ..++..+.|+.||+.+..|     |.+.||++.+|+
T Consensus       246 lvivG~~~~~~g~~~~~~~~~~~~ll~~l~~~~~~~rV~F~G~v~~~~l~~~l~~adv~v~PS~~~~~~~~llEAMA~G~  325 (396)
T cd03818         246 VVIVGGDGVSYGAPPPDGESWKQHMLDELGGRLDLSRVHFLGRVPYDQYLALLQVSDVHVYLTYPFVLSWSLLEAMACGC  325 (396)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHEEEEEEECCEECCCCCHHHHHHHCCC
T ss_conf             99992687445666765437999999863223676368970898589998875100399953140455760899997799


Q ss_pred             CEEEECCCCCCEEEEEECCCCCCEEEEHHHCCC---CCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             302540577410000102467610230244078---42612420548989999999998449899999999999999983
Q gi|254780767|r  288 PVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDY---PLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRM  364 (383)
Q Consensus       288 P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~---~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~L  364 (383)
                      | ||...+..+..               ++-+.   -++|     --+++.++..+.++++|++.|++|-++.++.-++.
T Consensus       326 P-VVas~~gg~~e---------------~V~dg~~G~Lvp-----p~d~~~LA~ai~~lL~dp~~r~~lg~aaR~~~~~~  384 (396)
T cd03818         326 L-VVGSDTAPVRE---------------VITDGENGLLVD-----FFDPDALAAAVIELLDDPARRARLRRAARRTALRY  384 (396)
T ss_pred             C-EEEECCCCCHH---------------HHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             8-99927998265---------------525998789969-----99999999999999759999999999999999998


Q ss_pred             C
Q ss_conf             8
Q gi|254780767|r  365 N  365 (383)
Q Consensus       365 g  365 (383)
                      -
T Consensus       385 ~  385 (396)
T cd03818         385 D  385 (396)
T ss_pred             H
T ss_conf             4


No 55 
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]
Probab=99.02  E-value=1.2e-07  Score=70.36  Aligned_cols=317  Identities=13%  Similarity=0.051  Sum_probs=157.8

Q ss_pred             CCEEEEEECCCCHHHH-HHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             7459999768214789-999999999738998399997178999478806504445311013674664599999999998
Q gi|254780767|r    3 SLKIAVIAGEISGDLL-AGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTV   81 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~-~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~   81 (383)
                      .|||+|+--..=||+. ...+++.||+..| ++++.-++.+.-... +...-.++.+-.+   +.-++- .-++.+..+.
T Consensus         1 ~~kIliir~~~iGD~vlt~p~~~~lk~~~P-~a~i~~~~~~~~~~i-~~~~p~I~~vi~~---~~~~~~-~~~~~~~~l~   74 (334)
T COG0859           1 MMKILVIRLSKLGDVVLTLPLLRTLKKAYP-NAKIDVLVPKGFAPI-LKLNPEIDKVIII---DKKKKG-LGLKERLALL   74 (334)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCHHHH-HHCCCCHHEEEEC---CCCCCC-HHHHHHHHHH
T ss_conf             907999955740137769999999998789-977999955431467-7559524168511---211212-1389999999


Q ss_pred             HHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCC
Q ss_conf             61001288868985117765799998663013463111100221100366355799999864015677422320025531
Q gi|254780767|r   82 ELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPP  161 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~  161 (383)
                      +.+++++.|+||-.-   -+++-|.....  .++|.-.  .+   .++..|--....+..+  +.++......+++.. -
T Consensus        75 ~~lr~~~yD~vidl~---~~~ksa~l~~~--~~~~~r~--g~---~~~~~r~~~~~~~~~~--~~~~~~~~~~~~~~~-l  141 (334)
T COG0859          75 RTLRKERYDAVIDLQ---GLLKSALLALL--LGIPFRI--GF---DKKSARELLLNKFYPR--LDKPEGQHVVERYLA-L  141 (334)
T ss_pred             HHHCCCCCCEEEECH---HHHHHHHHHHH--HCCCCEE--CC---CCHHHHHHHHHHCCCC--CCCCCHHHHHHHHHH-H
T ss_conf             983146867899740---25889999997--3898363--14---5077777777630244--565402459999999-9


Q ss_pred             EEECCCCCCC--C--CCCCCCHHHHHHHCCCCCCCCEEEEEEC-CCCCCHHHHCC--CHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             4763882112--2--1001355888976187655650599853-87430123051--11899987640273512620166
Q gi|254780767|r  162 TTFVGHPLSS--S--PSILEVYSQRNKQRNTPSQWKKILLLPG-SRAQEIYKILP--FFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       162 ~~fVGHPl~d--~--~~~~~~~~~~~~~~~~~~~~~~I~llPG-SR~~EI~~~lP--~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      ....|.+..+  .  .................. +++|++.|| ||.+  .+.+|  -+.+.++.+.++.  ++++++..
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~i~i~pg~s~~~--~K~wp~e~~~~l~~~l~~~~--~~Vvl~g~  216 (334)
T COG0859         142 LEDLGLYPPPEPQLDFPLPRPPIELAKNLAKFD-RPYIVINPGASRGS--AKRWPLEHYAELAELLIAKG--YQVVLFGG  216 (334)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCC-CCEEEEECCCCCCC--CCCCCHHHHHHHHHHHHHCC--CEEEEEEC
T ss_conf             876079876677555455547888986542037-98799964734667--78899999999999999769--98999408


Q ss_pred             CCHHHHHHHHHHHCCCCCEE--EEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEE-----EEECCC
Q ss_conf             33688999999604888505--52055203578876355233115668887627530254057741000-----010246
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEI--IIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNF-----FIFYIK  307 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i--~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~-----i~~lik  307 (383)
                      ++..+..+.+.+.......+  ...-.+.-.+++.||++|+...-.+-=+|.+|+|+|.+|-.+.-+++     ....+.
T Consensus       217 ~~e~e~~~~i~~~~~~~~~l~~k~sL~e~~~li~~a~l~I~~DSg~~HlAaA~~~P~I~iyg~t~~~~~~p~~~~~~~~~  296 (334)
T COG0859         217 PDEEERAEEIAKGLPNAVILAGKTSLEELAALIAGADLVIGNDSGPMHLAAALGTPTIALYGPTSPAFTPPPDPKLPGIS  296 (334)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCEEECCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             78999999999736766121799999999999966989991488799999873998899988987555788665443443


Q ss_pred             CCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCC
Q ss_conf             761023024407842612420548989999999998449
Q gi|254780767|r  308 TWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQD  346 (383)
Q Consensus       308 ~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d  346 (383)
                      ..+-..+.-..+   -++---++.+++.+..++..++..
T Consensus       297 ~~~~~~~~~~~~---~~~~~~~~i~~~~v~~~~~~~~~~  332 (334)
T COG0859         297 GNLDCSPCKPSG---GHHECLKDIEPEKVLEAAEALLAT  332 (334)
T ss_pred             CCCCCCCCCCCC---CCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             555555256678---755564559989999999987641


No 56 
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane]
Probab=98.99  E-value=1.3e-07  Score=70.24  Aligned_cols=291  Identities=14%  Similarity=0.207  Sum_probs=166.8

Q ss_pred             CEEEEEE--CCCCHHHH--HH-HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             4599997--68214789--99-9999999738998399997178999478806504445311013674664599999999
Q gi|254780767|r    4 LKIAVIA--GEISGDLL--AG-DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRIN   78 (383)
Q Consensus         4 mki~i~a--GE~SGD~~--~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~   78 (383)
                      |||.|.|  |-.+|=-|  -. .|.++|++.   +.++..++++.-++ +..   .  ..+..++.+            -
T Consensus         1 M~V~i~~Dgg~~iGmGHV~R~l~LA~~l~k~---~~~~~fl~k~~~e~-~~~---~--~~~~f~~~~------------~   59 (318)
T COG3980           1 MKVLIRCDGGLEIGMGHVMRTLTLARELEKR---GFACLFLTKQDIEA-IIH---K--VYEGFKVLE------------G   59 (318)
T ss_pred             CCEEEEECCCCCCCCCHHHHHHHHHHHHHHC---CCEEEEECCCCHHH-HHH---H--HHHHCCCEE------------E
T ss_conf             9579992687555751345599999999851---74688840662564-215---6--665104300------------2


Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCC
Q ss_conf             99861001288868985117765799998663013463111100221100366355799999864015677422320025
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLG  158 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~  158 (383)
                      +.-..|++.++|++|+ |+-|-|-...|.+|.+ .+-|++++=        ....+.++ +.|.++--.--...+|.-. 
T Consensus        60 ~~~n~ik~~k~d~lI~-Dsygl~~dd~k~ik~e-~~~k~l~fD--------d~~~~~~~-d~d~ivN~~~~a~~~y~~v-  127 (318)
T COG3980          60 RGNNLIKEEKFDLLIF-DSYGLNADDFKLIKEE-AGSKILIFD--------DENAKSFK-DNDLIVNAILNANDYYGLV-  127 (318)
T ss_pred             ECCCCCCCCCCCEEEE-ECCCCCHHHHHHHHHH-HCCCEEEEC--------CCCCCCHH-HHHHHHHHHHCCHHHCCCC-
T ss_conf             3364100366778999-4268887899998897-388179964--------77764225-6673545553511220536-


Q ss_pred             CCCE-EECCC---CCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             5314-76388---2112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  159 GPPT-TFVGH---PLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       159 ~~~~-~fVGH---Pl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      .-++ .|.|-   |+.+++.  ..+++...+    +.+.+..-|.||-..   .   +.++++..|.+.+-++.++....
T Consensus       128 ~~k~~~~lGp~y~~lr~eF~--~~r~~~~~r----~~r~ilI~lGGsDpk---~---lt~kvl~~L~~~~~nl~iV~gs~  195 (318)
T COG3980         128 PNKTRYYLGPGYAPLRPEFY--ALREENTER----PKRDILITLGGSDPK---N---LTLKVLAELEQKNVNLHIVVGSS  195 (318)
T ss_pred             CCCEEEEECCCCEECCHHHH--HHHHHHHHC----CHHEEEEECCCCCHH---H---HHHHHHHHHHCCCEEEEEEECCC
T ss_conf             76637996587114169999--868998635----311289971688724---4---59999998403570499994688


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEE-CCCCCCE-E-EEEECCCCCCE
Q ss_conf             3368899999960488850552055203578876355233115668887627530254-0577410-0-00102467610
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSI-YKSEWIV-N-FFIFYIKTWTC  311 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~-Yk~~~lt-~-~i~~lik~~~i  311 (383)
                      .......+...++. .+.+.....++..++|..||+||++.|..+-|++++|+|..|+ |--|-+. . ++         
T Consensus       196 ~p~l~~l~k~~~~~-~~i~~~~~~~dma~LMke~d~aI~AaGstlyEa~~lgvP~l~l~~a~NQ~~~a~~f---------  265 (318)
T COG3980         196 NPTLKNLRKRAEKY-PNINLYIDTNDMAELMKEADLAISAAGSTLYEALLLGVPSLVLPLAENQIATAKEF---------  265 (318)
T ss_pred             CCCHHHHHHHHHHC-CCEEEEECCHHHHHHHHHCCHHEECCCHHHHHHHHHCCCCEEEEEECCHHHHHHHH---------
T ss_conf             85466788888657-88026862245899998603331446357999998269825876330178887789---------


Q ss_pred             EEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             230244078426124205489899999999984498999999999
Q gi|254780767|r  312 ALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHG  356 (383)
Q Consensus       312 ~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~  356 (383)
                            ....+++++=-+ .++.....++..+.+|+.+|+.....
T Consensus       266 ------~~lg~~~~l~~~-l~~~~~~~~~~~i~~d~~~rk~l~~~  303 (318)
T COG3980         266 ------EALGIIKQLGYH-LKDLAKDYEILQIQKDYARRKNLSFG  303 (318)
T ss_pred             ------HHCCCHHHCCCC-CCHHHHHHHHHHHHHCHHHHHHHHHC
T ss_conf             ------866860022677-76187899999864077776422211


No 57 
>pfam00534 Glycos_transf_1 Glycosyl transferases group 1. Mutations in this domain of subunit A of phosphatidylinositol N-acetylglucosaminyltransferase lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
Probab=98.94  E-value=6.3e-08  Score=72.25  Aligned_cols=160  Identities=21%  Similarity=0.247  Sum_probs=109.4

Q ss_pred             CHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHC-CCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             5588897618765565059985387430123051118999876402-735126201663368899999960488850552
Q gi|254780767|r  178 VYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKR-NPFFRFSLVTVSSQENLVRCIVSKWDISPEIII  256 (383)
Q Consensus       178 ~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~-~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~  256 (383)
                      ++...|++.+++++++ +.+++|+=.  -.+....++++++++.++ ++++.+++..........+...........+.+
T Consensus         1 ~~~~~r~~~~i~~~~~-vi~~~G~~~--~~Kg~~~~i~a~~~l~~~~~~~~~l~i~G~~~~~~~~~~~~~~~~~~~~i~~   77 (172)
T pfam00534         1 DREEERKKLGIPEDKP-IILFVGRLV--PEKGLDLLLEAFALLKEQLHPNLKLVIVGDGEEEKKLKKLALKLGLEDNVIF   77 (172)
T ss_pred             CHHHHHHHCCCCCCCE-EEEEECCCC--CCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCCCEEE
T ss_conf             9789999879999995-999965485--5449899999899888740898599998378326789999998399986899


Q ss_pred             E----CCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHH
Q ss_conf             0----552035788763552331-----1566888762753025405774100001024676102302440784261242
Q gi|254780767|r  257 D----KEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYF  327 (383)
Q Consensus       257 ~----~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEli  327 (383)
                      .    .++..+.++.||+.+.+|     |+.-+|++.+|+|.|+. ..++...               ++.+... =-++
T Consensus        78 ~~~~~~~~~~~~l~~sdi~i~ps~~E~~~~~~~Eam~~G~pvI~s-~~~~~~e---------------ii~~~~~-G~~~  140 (172)
T pfam00534        78 VGFVPREDLIELYRIADLFVLPSRYEGFGLVLLEAMAAGVPVIAS-DVGGPAE---------------IVKDGET-GLLV  140 (172)
T ss_pred             ECCCCHHHHHHHHHHHHHCCCCCHHHCCCCHHHHHHHCCCEEEEE-CCCCHHH---------------HHHCCCE-EEEE
T ss_conf             578898999999997241047736651571189999679719995-6997299---------------9718983-9997


Q ss_pred             CCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             0548989999999998449899999999999
Q gi|254780767|r  328 NSMIRSEALVRWIERLSQDTLQRRAMLHGFE  358 (383)
Q Consensus       328 Q~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~  358 (383)
                       +.-+++.+++++..+++|++.|++|.++.+
T Consensus       141 -~~~~~~~l~~~i~~li~n~~~~~~m~~n~~  170 (172)
T pfam00534       141 -DPGDAEALAEAIEKLLKDEELRERLGENAR  170 (172)
T ss_pred             -CCCCHHHHHHHHHHHHCCHHHHHHHHHHHC
T ss_conf             -899999999999999879999999999844


No 58 
>PRK00654 glgA glycogen synthase; Provisional
Probab=98.92  E-value=4.8e-06  Score=59.86  Aligned_cols=187  Identities=14%  Similarity=0.114  Sum_probs=114.2

Q ss_pred             HHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHHHHCCCCCEEEE
Q ss_conf             588897618765565059985387430123051118999876402735126201663--368899999960488850552
Q gi|254780767|r  179 YSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS--SQENLVRCIVSKWDISPEIII  256 (383)
Q Consensus       179 ~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~--~~~~~~~~~~~~~~~~~~i~~  256 (383)
                      +...++++|++.+....++.-=||-.+ .+-+.++++++..+.+.  +.+|++....  ..++.++.....++.+....+
T Consensus       278 k~~l~~~~gl~~~~~~pl~~~vgRl~~-qKG~~ll~~a~~~~~~~--~~~~vi~G~G~~~~~~~l~~l~~~~~~~~~~~~  354 (476)
T PRK00654        278 KRALQERFGLPVDDDAPLFAMVSRLTE-QKGLDLVLEALDEILEQ--GGQLVLLGTGDPELEEAFRALAARYPGRVGVQI  354 (476)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEEEECCC-CCCHHHHHHHHHHHHHC--CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999999949897899748999851645-67889999999999970--998999945978999999999987798889995


Q ss_pred             ECC--CCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCC
Q ss_conf             055--2035788763552331-----156688876275302540577410000102467610230244078426124205
Q gi|254780767|r  257 DKE--QKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNS  329 (383)
Q Consensus       257 ~~~--~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~  329 (383)
                      ..+  ..+.+++.||+.++.|     |-+-||++..|+|-|| -+|+.|.--+.-         .|.  ..+-..-|+-.
T Consensus       355 gf~e~l~~~iya~aD~~lmPS~~EP~Gl~qleAm~~Gt~Pvv-~~tGGL~dtV~d---------~~~--~~~~~tGf~f~  422 (476)
T PRK00654        355 GYDEALAHRIYAGADFFLMPSRFEPCGLTQLYALRYGTLPIV-RRTGGLADTVID---------YDP--EDGGATGFVFD  422 (476)
T ss_pred             CCCHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHCCCCCEE-ECCCCCCCCCCC---------CCC--CCCCCCEEEEC
T ss_conf             788689899987288786456113677689999876998588-179997551456---------666--77876348737


Q ss_pred             CCCHHHHHHHHH---HHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCC
Q ss_conf             489899999999---984498999999999999999838999989999999998619
Q gi|254780767|r  330 MIRSEALVRWIE---RLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG  383 (383)
Q Consensus       330 ~~~~~~i~~~~~---~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~Lg  383 (383)
                      +.+++.++.++.   .+++|++..+++..+.  +.+..+...+|.+ -.++-.++||
T Consensus       423 ~~~~~~l~~ai~~al~~~~~~~~~~~l~~~~--m~~~fsW~~~A~~-y~~lY~~llg  476 (476)
T PRK00654        423 DFNAEDLLTALRRALELYRQPDLWRALQRQA--MAQDFSWDKSAEE-YLELYRRLLG  476 (476)
T ss_pred             CCCHHHHHHHHHHHHHHHCCHHHHHHHHHHH--HHCCCCCHHHHHH-HHHHHHHHHC
T ss_conf             9999999999999998856999999999998--5237995999999-9999999739


No 59 
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
Probab=98.92  E-value=1.2e-06  Score=63.78  Aligned_cols=287  Identities=14%  Similarity=0.107  Sum_probs=140.7

Q ss_pred             CEEEEEECCC--------CH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHH
Q ss_conf             4599997682--------14-78999999999973899839999717899947880650444531101367466459999
Q gi|254780767|r    4 LKIAVIAGEI--------SG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFI   74 (383)
Q Consensus         4 mki~i~aGE~--------SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~   74 (383)
                      |||.+++..-        .| ..|...|.++|.++ +.++.++.-++..-.... ....+. .    .............
T Consensus         1 MkI~~v~~~~~p~pP~~~GG~e~~~~~La~~L~~~-Gh~V~v~~~~~~~~~~~~-~~~~~~-~----~~~~~~~~~~~~~   73 (335)
T cd03802           1 MRIALVAPPREPVPPPAYGGTERVVAALTEGLVAR-GHEVTLFASGDSKTAAPL-VPVVPE-P----LRLDAPGRDRAEA   73 (335)
T ss_pred             CEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCC-CCCCCC-C----CCCCCCCCCHHHH
T ss_conf             98699888400369999897999999999999976-998999962898778850-045676-6----5445442212456


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC--CCCCCCCCCCHHHHHHHHHHHCCCCCCCHH
Q ss_conf             999999861001288868985117765799998663013463111100--221100366355799999864015677422
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC--PSVWAWREGRARKMCAYINQVISILPFEKE  152 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~--PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~  152 (383)
                      .....+.+.+...+||+|..- ++.   .++..++.  .++|+++-+-  +..|.+..++   .....+.+.++-.....
T Consensus        74 ~~~~~~~~~~~~~~~Dvvh~~-~~~---~~~~~~~~--~~~p~v~t~H~~~~~~~~~~~~---~~~~~~~~i~vS~~~~~  144 (335)
T cd03802          74 EALALAERALAAGDFDIVHNH-SLH---LPLPFARP--LPVPVVTTLHGPPDPELLKLYY---AARPDVPFVSISDAQRR  144 (335)
T ss_pred             HHHHHHHHHHHHCCCCEEEEC-CCH---HHHHHHHH--CCCCEEEEECCCCCHHHHHHHH---HHCCCCEEEECCHHHHH
T ss_conf             899999999975798589989-717---89999862--7997899989997067799997---52358689994599995


Q ss_pred             HHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             32002553147638821122100135588897618765565059985387430123051118999876402735126201
Q gi|254780767|r  153 VMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLV  232 (383)
Q Consensus       153 ~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~  232 (383)
                      .....  -++..|-|++ |.       ..+.  .. .+.+..+ ++-| |-.+-|. +..++++++.     ++.+.++.
T Consensus       145 ~~~~~--~~~~vI~ngv-d~-------~~f~--~~-~~~~~~~-l~vG-Rl~~~KG-~~~li~a~~~-----~~~~L~i~  203 (335)
T cd03802         145 PWPPL--PWVATVHNGI-DL-------DDYP--FR-GPKGDYL-LFLG-RISPEKG-PHLAIRAARR-----AGIPLKLA  203 (335)
T ss_pred             HCCCC--CCEEEECCCC-CH-------HHCC--CC-CCCCCEE-EEEE-ECCCCCC-HHHHHHHHHH-----CCCEEEEE
T ss_conf             45776--7779987998-88-------7679--88-8999789-9999-3363347-6999999874-----59808999


Q ss_pred             CCCCH-HHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHHHHHCCC------HHHHHHHHHHCCCEEEECCCCCCEEE
Q ss_conf             66336-88999999604888505520----552035788763552331------15668887627530254057741000
Q gi|254780767|r  233 TVSSQ-ENLVRCIVSKWDISPEIIID----KEQKKQVFMTCNAAMAAS------GTVILELALCGIPVVSIYKSEWIVNF  301 (383)
Q Consensus       233 ~~~~~-~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd~ai~~S------GTaTLE~al~g~P~IV~Yk~~~lt~~  301 (383)
                      ..... ................|...    ..+..++++.||+.+..|      |-+.||++.+|+| ||++..+.+...
T Consensus       204 G~~~~~~~~~~~~~~~~~~~~~V~f~G~v~~~~~~~~~~~a~~~v~pS~~~E~fglv~lEAma~G~P-VVat~~gG~~E~  282 (335)
T cd03802         204 GPVSDPDYFYREIAPELLDGPDIEYLGEVGGAEKAELLGNARALLFPILWEEPFGLVMIEAMACGTP-VIAFRRGAVPEV  282 (335)
T ss_pred             ECCCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCC-EEECCCCCHHHH
T ss_conf             4767379999999996178995899504683999999997412456765324674799999984998-999289981454


Q ss_pred             EEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCH
Q ss_conf             0102467610230244078426124205489899999999984498
Q gi|254780767|r  302 FIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDT  347 (383)
Q Consensus       302 i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~  347 (383)
                                     +.+.+-  =|+-+  +++.++.++.++.+.+
T Consensus       283 ---------------v~~g~~--G~lv~--~~~~la~ai~~~~~~~  309 (335)
T cd03802         283 ---------------VEDGVT--GFLVD--SVEELAAAVARADRLD  309 (335)
T ss_pred             ---------------HCCCCE--EEECC--CHHHHHHHHHHHHHCC
T ss_conf             ---------------238961--89819--9999999999875289


No 60 
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional
Probab=98.89  E-value=3.6e-06  Score=60.69  Aligned_cols=312  Identities=13%  Similarity=0.172  Sum_probs=151.7

Q ss_pred             CCEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHC-----CCEEEECHHHCCEEEHHHHHHHHHHHHHH
Q ss_conf             745999976821478999-999999973899839999717899947-----88065044453110136746645999999
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKE-----GLVSLFDFSELSVIGIMQVVRHLPQFIFR   76 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~-----G~~~~~~~~~l~v~G~~evl~~~~~~~~~   76 (383)
                      +-||+|+---.=||+.-+ -++++||+++| +.++.-+..+...+.     .++.++.+.. .-.|..+-+++       
T Consensus         5 ~kkILIir~~~iGD~il~tP~i~~Lk~~~P-~a~I~~l~~~~~~~ll~~~P~id~i~~~~~-k~~~~~~~~~~-------   75 (352)
T PRK10422          5 FRRILIIKMRFHGDMLLTTPVISSLKKNYP-DAKIDVLLYQDTIPILSENPEINALYGIKN-KKAGASEKIKN-------   75 (352)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCHHHHHHCCCCCCEEEEECC-CCCCHHHHHHH-------
T ss_conf             977999758860499999999999999889-988999978047999833999627988667-55445677999-------


Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCC-CCHHH--
Q ss_conf             999986100128886898511776579999866301346311110022110036635579999986401567-74223--
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILP-FEKEV--  153 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifp-FE~~~--  153 (383)
                      +.++.+.+++++.|++|-.....-.-.+++.+     +.+....     |-|+...-..+...++++..... .+.+.  
T Consensus        76 ~~~l~~~Lr~~~yD~vi~l~~~~~~~~l~~~~-----~~~~~ig-----~~~~~~~~~~~~~~~~~~~~~~~~h~v~~~l  145 (352)
T PRK10422         76 FFSLIKVLRANKYDLIVNLTDQWMVALLVRLL-----NARVKIS-----QDYHHRQSAFWRKSFTHLVPLQGGHVVESNL  145 (352)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH-----CCCEEEC-----CCCCCCHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             99999998554887788667664999999983-----8985865-----6665210145565531468875415999999


Q ss_pred             --HHCCCCCCEEECCCCCCCCCCCCCCHHHHHHH-CCCCCCCCEEEEEECCCCCCHHHHCCC--HHHHHHHHHHCCCCCE
Q ss_conf             --20025531476388211221001355888976-187655650599853874301230511--1899987640273512
Q gi|254780767|r  154 --MQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQ-RNTPSQWKKILLLPGSRAQEIYKILPF--FESAVASLVKRNPFFR  228 (383)
Q Consensus       154 --f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~-~~~~~~~~~I~llPGSR~~EI~~~lP~--~l~~~~~l~~~~~~~~  228 (383)
                        .+.. |++.. .-.+.....  ..+.....+. .......+.|++-||++..  .+.+|.  |.+.++.|.++  +++
T Consensus       146 ~ll~~l-~~~~~-~~~~~l~~~--~~~~~~~~~~l~~~~~~~~~ivi~pga~~~--~K~Wp~e~~a~l~~~L~~~--g~~  217 (352)
T PRK10422        146 SVLTPL-GLSSL-VKETTMSYR--PESWKRMRRQLDHLGVTQNYVVIQPTARQI--FKCWDNDKFSAVIDALQAR--GYE  217 (352)
T ss_pred             HHHHHC-CCCCC-CCCCCCCCC--HHHHHHHHHHHHHCCCCCCEEEEECCCCCC--CCCCCHHHHHHHHHHHHHC--CCE
T ss_conf             998646-99866-755566788--789999998767448889879996789985--6779999999999999847--991


Q ss_pred             EEECCCCCHHHH--HHHHHHHCCCCCEEEEEC-----CCCHHHHHHHHHHHCC-CHHHHHHHHHHCCCEEEECCCC----
Q ss_conf             620166336889--999996048885055205-----5203578876355233-1156688876275302540577----
Q gi|254780767|r  229 FSLVTVSSQENL--VRCIVSKWDISPEIIIDK-----EQKKQVFMTCNAAMAA-SGTVILELALCGIPVVSIYKSE----  296 (383)
Q Consensus       229 ~~i~~~~~~~~~--~~~~~~~~~~~~~i~~~~-----~~~~~~l~~sd~ai~~-SGTaTLE~al~g~P~IV~Yk~~----  296 (383)
                      +++...++.++.  .+......... .+....     .+.-.+++.|++.|+. ||...| +|++|+|+|.+|-.+    
T Consensus       218 vvl~ggp~~~e~~~~~~i~~~~~~~-~v~~l~G~tsL~el~ali~~a~l~I~nDSGpmHl-AaAlg~P~ValFGpT~p~~  295 (352)
T PRK10422        218 VVLTSGPAKDDLACVNEIAQGCQTP-PVTALAGKTTFPELGALIDHAQLFIGVDSAPAHI-AAAVNTPLICLFGATDHIF  295 (352)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCC-CCEECCCCCCHHHHHHHHHHCCEEEECCCHHHHH-HHHCCCCEEEEECCCCCCC
T ss_conf             9997289889999999999746798-7042357888999999998178756059818999-9982999899989999200


Q ss_pred             --CCEEEEEECCCCCCEEEEHHHCCCC--CCCHHHCCCCCHHHHHHHHHHHHCCH
Q ss_conf             --4100001024676102302440784--26124205489899999999984498
Q gi|254780767|r  297 --WIVNFFIFYIKTWTCALPNLIVDYP--LVPEYFNSMIRSEALVRWIERLSQDT  347 (383)
Q Consensus       297 --~lt~~i~~lik~~~i~LpNii~~~~--ivPEliQ~~~~~~~i~~~~~~ll~d~  347 (383)
                        |++.....+....+-..|   ....  =-++.+ ...+++.+.+++.++|..+
T Consensus       296 ~~P~~~~~~~~~~~~~~~~~---~~~~~~~~~~cl-~~I~~~~V~~a~~~lL~~s  346 (352)
T PRK10422        296 WRPWSDNMIQFWAGDYQPMP---TRDELDRNEKYL-SVIPAADVIAAVDKLLPSS  346 (352)
T ss_pred             CCCCCCCEEEEECCCCCCCC---CCCCCCCCHHHH-CCCCHHHHHHHHHHHHHCC
T ss_conf             28999986888579877778---765668760545-3399999999999986357


No 61 
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.
Probab=98.87  E-value=8e-07  Score=64.99  Aligned_cols=319  Identities=16%  Similarity=0.184  Sum_probs=166.3

Q ss_pred             CHHH-HHHHHHHHHHHHCCCCEEEEEECCH----HHHH---CCCEE--EECHHHCCEE--EHHHHHHHHH----H--HHH
Q ss_conf             1478-9999999999738998399997178----9994---78806--5044453110--1367466459----9--999
Q gi|254780767|r   14 SGDL-LAGDLIKSLKEMVSYPINLVGVGGP----SLQK---EGLVS--LFDFSELSVI--GIMQVVRHLP----Q--FIF   75 (383)
Q Consensus        14 SGD~-~~a~li~~Lk~~~~~~~~~~giGG~----~m~~---~G~~~--~~~~~~l~v~--G~~evl~~~~----~--~~~   75 (383)
                      +|+. ..-++++.|.++  .++.+..+..+    ...+   .-++.  +++.......  .+...+...|    .  -..
T Consensus        14 ~G~~ir~~~llk~L~~~--h~V~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~l~~~~p~~~~~~~s~~   91 (397)
T TIGR03087        14 KGDKIRSFHLLRHLAAR--HRVHLGTFVDDPEDWQYAAALRPLCEEVCVVPLDPRVARLRSLLGLLTGEPLSLPYYRSRR   91 (397)
T ss_pred             CCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHHCCCCCCCCHHHCCHH
T ss_conf             42889999999999828--9389998269866767889998644437999678417777999875248987215534999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE-E--E-------------CCCCCCC-CCC-CH----
Q ss_conf             99999861001288868985117765799998663013463111-1--0-------------0221100-366-35----
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN-Y--V-------------CPSVWAW-REG-RA----  133 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~-y--v-------------~PqvWAW-r~~-R~----  133 (383)
                      ....+.+.+.++++|++++     ++..+|.++.....++|.+. +  +             .|.-|.. ++. |.    
T Consensus        92 ~~~~i~~~~~~~~~D~i~~-----~~~~~a~yl~~~~~~~p~ild~hdv~s~~~~~~a~~~~~~~~~~~~~e~~~l~~~E  166 (397)
T TIGR03087        92 LARWVNALLAAEPVDAIVV-----FSSAMAQYVTPHVRGVPRIVDFVDVDSDKWLQYARTKRWPLRWIYRREGRLLLAYE  166 (397)
T ss_pred             HHHHHHHHHHCCCCCEEEE-----ECHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999960699868999-----16576775344523799899985343489999987345467789999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHCCC---CCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECC--CCCCHHH
Q ss_conf             5799999864015677422320025---5314763882112210013558889761876556505998538--7430123
Q gi|254780767|r  134 RKMCAYINQVISILPFEKEVMQRLG---GPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGS--RAQEIYK  208 (383)
Q Consensus       134 k~~~~~~d~~~~ifpFE~~~f~k~~---~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGS--R~~EI~~  208 (383)
                      +++.+.+|.++++-+.|.+++++..   +.++..+.|-+ |.........   .......+.+. .+|-||  ...-+.-
T Consensus       167 ~~~~~~~d~~~~vS~~d~~~~~~~~~~~~~~i~vipnGv-d~~~f~p~~~---~~~~~~~~~~~-i~f~G~~~~~pN~da  241 (397)
T TIGR03087       167 RAIAARFDAATFVSRAEAELFRRLAPEAAGRITAFPNGV-DADFFSPDRD---YPNPYPPGKRV-LVFTGAMDYWPNIDA  241 (397)
T ss_pred             HHHHHHCCEEEEECHHHHHHHHHHCCCCCCEEEECCCCC-CCCCCCCCCC---CCCCCCCCCCE-EEEEEECCCCCCHHH
T ss_conf             999996699999779999999874777677277657875-5123687644---45766788987-999971787230999


Q ss_pred             HCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCC----CHH--HHHHH
Q ss_conf             051118999876402735126201663368899999960488850552055203578876355233----115--66888
Q gi|254780767|r  209 ILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAA----SGT--VILEL  282 (383)
Q Consensus       209 ~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~----SGT--aTLE~  282 (383)
                      ..-..-++...+.+++|+.+|.+...... +.++.. .+.. +..+.-.-.+....++.|+++++.    +|+  -.||+
T Consensus       242 ~~~f~~~v~p~l~~~~p~~~~~ivG~~p~-~~~~~l-~~~~-~V~~~G~V~d~~~~~~~a~v~v~Pl~~g~G~~~KilEa  318 (397)
T TIGR03087       242 VVWFAERVFPAVRARRPAAEFYIVGAKPS-PAVRAL-AALP-GVTVTGSVADVRPYLAHAAVAVAPLRIARGIQNKVLEA  318 (397)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCC-HHHHHH-CCCC-CEEEEEECCCHHHHHHCCCEEEEECCCCCCCCHHHHHH
T ss_conf             99999999999998789987999908962-999985-1799-97997654986999961989999465445753579999


Q ss_pred             HHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHH-HH
Q ss_conf             76275302540577410000102467610230244078426124205489899999999984498999999999999-99
Q gi|254780767|r  283 ALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFEN-LW  361 (383)
Q Consensus       283 al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~-~~  361 (383)
                      +.+|+|.|.   |+    .-.       -|+ ....|+.+.+.     -|++..++++.++++|++.++++-++.++ +.
T Consensus       319 ma~g~PvVs---t~----~g~-------egl-~~~~g~~~lia-----~~~~~fa~~i~~Ll~d~~~~~~l~~~~r~~v~  378 (397)
T TIGR03087       319 MAMAKPVVA---SP----EAA-------EGI-DALPGAELLVA-----ADPADFAAAILALLANPAEREELGQAARRRVL  378 (397)
T ss_pred             HHCCCCEEE---CC----CCC-------CCC-CCCCCCEEEEC-----CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             976998997---77----430-------244-36789705957-----99999999999998199999999999999999


Q ss_pred             HHHCCC
Q ss_conf             983899
Q gi|254780767|r  362 DRMNTK  367 (383)
Q Consensus       362 ~~Lg~~  367 (383)
                      ++...+
T Consensus       379 ~~ysW~  384 (397)
T TIGR03087       379 QHYHWP  384 (397)
T ss_pred             HHCCHH
T ss_conf             829999


No 62 
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This family consists of UDP-N-acetylglucosamine 2-epimerases EC:5.1.3.14 this enzyme catalyses the production of UDP-ManNAc from UDP-GlcNAc. Note that some of the enzymes is this family are bifunctional, in this instance Pfam matches only the N-terminal half of the protein suggesting that the additional C-terminal part (when compared to mono-functional members of this family) is responsible for the UPD-N-acetylmannosamine kinase activity of these enzymes. This hypothesis is further supported by the assumption that the C-terminal part of rat bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase is the kinase domain.
Probab=98.84  E-value=1.5e-07  Score=69.76  Aligned_cols=276  Identities=15%  Similarity=0.131  Sum_probs=149.5

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCC-CCCCCCCCH-HHHHHHHHHHCCC-CCCC
Q ss_conf             999999986100128886898511776579999866301346311110022-110036635-5799999864015-6774
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPS-VWAWREGRA-RKMCAYINQVISI-LPFE  150 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pq-vWAWr~~R~-k~~~~~~d~~~~i-fpFE  150 (383)
                      -.....+-+.+.+.+||+|+..  .|=+=-+|-.+-....+||++|.=+=- =+=|..+=. ...+..+|++..+ |.--
T Consensus        53 ~~~i~~~~~~l~~~~PD~vlv~--GDr~e~la~aiaa~~~~ipi~HiegG~RS~d~t~g~~de~~R~~isklS~~hf~~t  130 (346)
T pfam02350        53 GRILIGLEDVLEEEKPDLVLVL--GDTNETLAGALAAFYLRIPVAHVEAGLRSFDLTEGMPEEINRHLIDKLSDLHFAPT  130 (346)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEE--CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHCCCCCCCCEEECCC
T ss_conf             9999999999998299999996--89715889999999819848995268744556799930543114665413772464


Q ss_pred             HHHHHCC--CC---CCEEECCCCCCCCCCCCCCH---HHHHHHCCCCCCCCEEEEEECCCCCCH-HHHCCCHHHHHHHHH
Q ss_conf             2232002--55---31476388211221001355---888976187655650599853874301-230511189998764
Q gi|254780767|r  151 KEVMQRL--GG---PPTTFVGHPLSSSPSILEVY---SQRNKQRNTPSQWKKILLLPGSRAQEI-YKILPFFESAVASLV  221 (383)
Q Consensus       151 ~~~f~k~--~~---~~~~fVGHPl~d~~~~~~~~---~~~~~~~~~~~~~~~I~llPGSR~~EI-~~~lP~~l~~~~~l~  221 (383)
                      +...++.  .|   -++..||+|..|.+....+.   ...........+++.+++.==.+..+- +..+--+.++++.+.
T Consensus       131 ~~~~~~L~~~G~~~~~If~vG~~~iD~i~~~~~~~~~~~~~~~~~~~~~~~~iLvt~Hr~en~~~~~~~~~i~~~l~~l~  210 (346)
T pfam02350       131 EEARENLLQEGEPPERIFVTGNTVIDALLLSREEIEESLEISGILADLGKRYILVTFHRRENEDDPERLEQILEALKALA  210 (346)
T ss_pred             HHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999999819994728997971999999999873101556664034568779999677534476448999999999998


Q ss_pred             HCCCCCEEEECCC--CCHHHHHHHHHHHCCCCCEEEE--ECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECC-CC
Q ss_conf             0273512620166--3368899999960488850552--05520357887635523311566888762753025405-77
Q gi|254780767|r  222 KRNPFFRFSLVTV--SSQENLVRCIVSKWDISPEIII--DKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYK-SE  296 (383)
Q Consensus       222 ~~~~~~~~~i~~~--~~~~~~~~~~~~~~~~~~~i~~--~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk-~~  296 (383)
                      +. +++.++++..  +.....+...+..++ +..++-  ...+...+++.|+++++=||..-.|++.+|+|+|++=. +.
T Consensus       211 ~~-~~~~~i~~~~n~d~~~~~i~~~l~~~~-ni~~~~~l~~~~fl~ll~~s~~vigdSs~~~~Ea~~l~~P~iniR~~ge  288 (346)
T pfam02350       211 ER-PDVPVVFPVHNNPRTRKRINELLEELP-NIRLIEPLGYLDFLSLLKNADLVITDSGGIQEEAPSLGKPVLNLRDTTE  288 (346)
T ss_pred             HC-CCCCEEEEECCCCHHHHHHHHHHHCCC-CEEEECCCCHHHHHHHHHHCCEEEECCCCHHHHHHHHCCCEEEECCCCC
T ss_conf             35-686099983799207789999983479-8799656899999999985188983686216666650896898278888


Q ss_pred             CCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             41000010246761023024407842612420548989999999998449899999999999999983899998999999
Q gi|254780767|r  297 WIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAE  376 (383)
Q Consensus       297 ~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~  376 (383)
                      |-...               ..+..++     -..+++.|.+++.+.++++..++.+.    ....-.|. |.++++.++
T Consensus       289 Rqegr---------------~~g~nvl-----v~~~~~~I~~ai~~~l~~~~~~~~~~----~~~npyGd-G~as~rI~~  343 (346)
T pfam02350       289 RPEGR---------------EAGTNVL-----VGTDKEAILAAIEKLLDDEEEYEKMS----NAVNPYGD-GNASERIVD  343 (346)
T ss_pred             CHHHH---------------HHCEEEE-----ECCCHHHHHHHHHHHHHCHHHHHHHC----CCCCCCCC-CHHHHHHHH
T ss_conf             87569---------------5384699-----78999999999999971967776412----47898989-869999999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780767|r  377 IV  378 (383)
Q Consensus       377 ~I  378 (383)
                      +|
T Consensus       344 il  345 (346)
T pfam02350       344 IL  345 (346)
T ss_pred             HH
T ss_conf             96


No 63 
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases.  wbaZ in Salmonella enterica has been shown to possess the mannosyl transferase activity. The members of this family are found in certain bacteria and Archaea.
Probab=98.82  E-value=2.1e-07  Score=68.76  Aligned_cols=284  Identities=18%  Similarity=0.241  Sum_probs=144.1

Q ss_pred             HHHHHHHHHHHCCCCEEEE-EECCHH-HHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             9999999997389983999-971789-99478806504445311013674664599999999998610012888689851
Q gi|254780767|r   19 AGDLIKSLKEMVSYPINLV-GVGGPS-LQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVD   96 (383)
Q Consensus        19 ~a~li~~Lk~~~~~~~~~~-giGG~~-m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD   96 (383)
                      |-+++.+|.+..+ +..++ ....+. ........-.....+....+  ..+++..+...+....+.....++|++|. +
T Consensus        15 ~ERVv~~la~~~~-~~~i~T~~~~~~~~~~~~~~~~i~~~~~~~~~~--~~~~~~~~~~l~~~a~~~~~l~~yDiiI~-s   90 (351)
T cd03804          15 GEKVVEALARLFP-DADIFTLVDDPDKLPRLLRLKKIRTSFIQKLPF--ARRRYRKYLPLMPLAIEQFDLSGYDLVIS-S   90 (351)
T ss_pred             HHHHHHHHHHHCC-CCCEEEEECCCCCCCHHHCCCCCEEECHHCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCEEEE-C
T ss_conf             9999999997689-998999956787585655078524640102503--45368899989999999825468998998-7


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCCC-----------CH--HHH-----------HHHHHHHCCCCCCCH
Q ss_conf             1776579999866301346311110-0221100366-----------35--579-----------999986401567742
Q gi|254780767|r   97 NPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWREG-----------RA--RKM-----------CAYINQVISILPFEK  151 (383)
Q Consensus        97 ~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~~-----------R~--k~~-----------~~~~d~~~~ifpFE~  151 (383)
                      ...|.+.+...     .+.|++.|+ .|.-|+|...           |.  +.+           .+.+|.+++.=.+-.
T Consensus        91 ~~~~~~~~~~~-----~~~~~i~Y~H~P~R~~~d~~~~~~~~~~~~~~~~~~~~~~~lr~~~~~~~~~~d~iianS~~t~  165 (351)
T cd03804          91 SHAVAKGVITR-----PDQLHICYCHTPMRYAWDLYHDYLKESGLGKRLALRLLLHYLRIWDRRSAARVDYFIANSRFVA  165 (351)
T ss_pred             CCHHHHHHHCC-----CCCCEEEEEECCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCHHHH
T ss_conf             84143655027-----8985899960551665422688876533577889999999999999988743889998798999


Q ss_pred             HHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             23200255314763882112210013558889761876556505998538743012305111899987640273512620
Q gi|254780767|r  152 EVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSL  231 (383)
Q Consensus       152 ~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i  231 (383)
                      +..++.-+.+++-|=+| .|.-.. ..         ...... ..|..| |-.+ .++...++++...+.     .+.++
T Consensus       166 ~~i~~~~~~~~~Viypp-vd~~~~-~~---------~~~~~~-~~l~vg-Rl~~-~K~~~~~i~a~~~~~-----~~L~i  226 (351)
T cd03804         166 RRIKKYYGRDATVIYPP-VDTDRF-TP---------AEEKED-YYLSVG-RLVP-YKRIDLAIEAFNKLG-----KRLVV  226 (351)
T ss_pred             HHHHHHHCCCCCEECCC-CCCCCC-CC---------CCCCCC-CEEEEE-CCCH-HCCCHHHHHHHHHCC-----CCEEE
T ss_conf             99999858997355829-835435-75---------766677-248855-1504-218089999998479-----97899


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEE----ECCCCHHHHHHHHHHHCCC----HHHHHHHHHHCCCEEEECCCCCCEEEEE
Q ss_conf             1663368899999960488850552----0552035788763552331----1566888762753025405774100001
Q gi|254780767|r  232 VTVSSQENLVRCIVSKWDISPEIII----DKEQKKQVFMTCNAAMAAS----GTVILELALCGIPVVSIYKSEWIVNFFI  303 (383)
Q Consensus       232 ~~~~~~~~~~~~~~~~~~~~~~i~~----~~~~~~~~l~~sd~ai~~S----GTaTLE~al~g~P~IV~Yk~~~lt~~i~  303 (383)
                      .......+.++...   .  .+|.+    ..++..++++.|++.+.+|    |.+.+|++.+|+|+|. +..+.....+.
T Consensus       227 ~G~g~~~~~l~~~~---~--~~V~f~g~~~~~~~~~~~~~a~~~v~ps~E~FGi~~vEAma~G~PvIa-~~~gG~~e~v~  300 (351)
T cd03804         227 IGDGPELDRLRAKA---G--PNVTFLGRVSDEELRDLYARARAFLFPAEEDFGIVPVEAMASGTPVIA-YGKGGALETVI  300 (351)
T ss_pred             EECCHHHHHHHHHC---C--CCEEEEECCCHHHHHHHHHHCCEEEECCHHCCCCHHHHHHHCCCCEEE-ECCCCCCCEEC
T ss_conf             98473799999667---8--987998038989999999838869951642079759999976998898-28999755015


Q ss_pred             ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             02467610230244078426124205489899999999984498999999
Q gi|254780767|r  304 FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAM  353 (383)
Q Consensus       304 ~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~  353 (383)
                      .    ..-|+        ++     +.-+++.+++++.++++|++.+.+.
T Consensus       301 ~----g~tG~--------l~-----~~~~~~~la~ai~~~~~~~~~~~~~  333 (351)
T cd03804         301 D----GVTGI--------LF-----EEQTVESLAAAVERFEKNEDFDPQA  333 (351)
T ss_pred             C----CCCEE--------EE-----CCCCHHHHHHHHHHHHHCCCCCHHH
T ss_conf             8----99789--------95-----9899999999999998595015999


No 64 
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]
Probab=98.81  E-value=4.9e-06  Score=59.80  Aligned_cols=320  Identities=13%  Similarity=0.136  Sum_probs=183.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEC----CHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             99999999997389983999971----78999478806504445311013674664599999999998610012888689
Q gi|254780767|r   18 LAGDLIKSLKEMVSYPINLVGVG----GPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLL   93 (383)
Q Consensus        18 ~~a~li~~Lk~~~~~~~~~~giG----G~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi   93 (383)
                      -+..|+++|++.+| ++.+.=-.    |.+-.++   ..-|.-...+.-+ |          ....+.+.+...+||++|
T Consensus        64 a~~pLv~~l~~~~P-~~~ilvTt~T~Tg~e~a~~---~~~~~v~h~YlP~-D----------~~~~v~rFl~~~~P~l~I  128 (419)
T COG1519          64 AALPLVRALRERFP-DLRILVTTMTPTGAERAAA---LFGDSVIHQYLPL-D----------LPIAVRRFLRKWRPKLLI  128 (419)
T ss_pred             HHHHHHHHHHHHCC-CCCEEEEECCCCHHHHHHH---HCCCCEEEEECCC-C----------CHHHHHHHHHHCCCCEEE
T ss_conf             88999999997689-9878999527637999998---7698708996576-7----------668899999742898799


Q ss_pred             EECHHHHHHHHHHHHHHHCCCCCCEEEEC------CCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCC
Q ss_conf             85117765799998663013463111100------221100366355799999864015677422320025531476388
Q gi|254780767|r   94 IVDNPDFTHRVAKRVRKKMPNLPIINYVC------PSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGH  167 (383)
Q Consensus        94 ~iD~pgFnl~lak~lkk~~~~ipvi~yv~------PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGH  167 (383)
                      ++.+-=- ..+--.++++  |+|++-.-+      =.=|++++.=++.+-+.+|++++=-.-..+=|.+.+.-+++-.||
T Consensus       129 i~EtElW-Pnli~e~~~~--~~p~~LvNaRLS~rS~~~y~k~~~~~~~~~~~i~li~aQse~D~~Rf~~LGa~~v~v~GN  205 (419)
T COG1519         129 IMETELW-PNLINELKRR--GIPLVLVNARLSDRSFARYAKLKFLARLLFKNIDLILAQSEEDAQRFRSLGAKPVVVTGN  205 (419)
T ss_pred             EEECCCC-HHHHHHHHHC--CCCEEEEEEEECHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCEEEECC
T ss_conf             9800136-7899999876--998999942302325777987789999999742333454888899999649861386333


Q ss_pred             CCCCCCCCCCC---HHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEEC-CCCCHHHHHHH
Q ss_conf             21122100135---588897618765565059985387430123051118999876402735126201-66336889999
Q gi|254780767|r  168 PLSSSPSILEV---YSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLV-TVSSQENLVRC  243 (383)
Q Consensus       168 Pl~d~~~~~~~---~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~-~~~~~~~~~~~  243 (383)
                      ==.|.......   ....+.+.+.  . ..+.+.-+++..|-.-    .+++.+.+.+++|+...+++ --|+.-+.+.+
T Consensus       206 lKfd~~~~~~~~~~~~~~r~~l~~--~-r~v~iaaSTH~GEeei----~l~~~~~l~~~~~~~llIlVPRHpERf~~v~~  278 (419)
T COG1519         206 LKFDIEPPPQLAAELAALRRQLGG--H-RPVWVAASTHEGEEEI----ILDAHQALKKQFPNLLLILVPRHPERFKAVEN  278 (419)
T ss_pred             EEECCCCCHHHHHHHHHHHHHCCC--C-CCEEEEECCCCCHHHH----HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHH
T ss_conf             242377873248999999985088--8-8559995477863889----99999999963899569991587556799999


Q ss_pred             HHHHCCC-------------CCEEEE--ECCCCHHHHHHHHHHHCC------CHHHHHHHHHHCCCEEEECCCCCCEEEE
Q ss_conf             9960488-------------850552--055203578876355233------1156688876275302540577410000
Q gi|254780767|r  244 IVSKWDI-------------SPEIII--DKEQKKQVFMTCNAAMAA------SGTVILELALCGIPVVSIYKSEWIVNFF  302 (383)
Q Consensus       244 ~~~~~~~-------------~~~i~~--~~~~~~~~l~~sd~ai~~------SGTaTLE~al~g~P~IV~Yk~~~lt~~i  302 (383)
                      .+++.+.             +.+|.+  ..++....+..+|+|.+-      -|-+-||.|.+++|.|..-.+.-.+-..
T Consensus       279 l~~~~gl~~~~rS~~~~~~~~tdV~l~DtmGEL~l~y~~adiAFVGGSlv~~GGHN~LEpa~~~~pvi~Gp~~~Nf~ei~  358 (419)
T COG1519         279 LLKRKGLSVTRRSQGDPPFSDTDVLLGDTMGELGLLYGIADIAFVGGSLVPIGGHNPLEPAAFGTPVIFGPYTFNFSDIA  358 (419)
T ss_pred             HHHHCCCEEEEECCCCCCCCCCCEEEEECHHHHHHHHHHCCEEEECCCCCCCCCCCHHHHHHCCCCEEECCCCCCHHHHH
T ss_conf             99975981886137899988886899962868999973432799877446778988223787089788777513589999


Q ss_pred             EECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             1024676102302440784261242054898999999999844989999999999999998389999899999999986
Q gi|254780767|r  303 IFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQV  381 (383)
Q Consensus       303 ~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~  381 (383)
                      .++++..-.               +|=+ +.+.+.+.+..++.|++.|+++.++..++.....  | +-.+--+.+.++
T Consensus       359 ~~l~~~ga~---------------~~v~-~~~~l~~~v~~l~~~~~~r~~~~~~~~~~v~~~~--g-al~r~l~~l~~~  418 (419)
T COG1519         359 ERLLQAGAG---------------LQVE-DADLLAKAVELLLADEDKREAYGRAGLEFLAQNR--G-ALARTLEALKPY  418 (419)
T ss_pred             HHHHHCCCE---------------EEEC-CHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH--H-HHHHHHHHHHHC
T ss_conf             999866986---------------9977-8899999999970788999999998999999867--7-999999975511


No 65 
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding.  In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltra
Probab=98.79  E-value=9.9e-08  Score=70.98  Aligned_cols=148  Identities=20%  Similarity=0.246  Sum_probs=113.8

Q ss_pred             EECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEEC--CCCHHHHHHHHHHHCCC
Q ss_conf             8538743012305111899987640273512620166336889999996048885055205--52035788763552331
Q gi|254780767|r  198 LPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDK--EQKKQVFMTCNAAMAAS  275 (383)
Q Consensus       198 lPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~--~~~~~~l~~sd~ai~~S  275 (383)
                      +-=+|-++- +++..++++..++.++.|+.++.|......+..++....+.++...|.+..  .+..+.++.|++.+.+|
T Consensus       208 i~vgRL~~e-K~~d~LI~A~~~v~~~~P~~~L~I~G~G~~~~~L~~~i~~l~l~~~V~f~G~~~~~~~~y~~a~~~v~~S  286 (372)
T cd04949         208 ITVARLAPE-KQLDQLIKAFAKVVKQVPDATLDIYGYGDEEEKLKELIEELGLEDYVFLKGYTRDLDEVYQKAQLSLLTS  286 (372)
T ss_pred             EEEECCCCC-CCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCEEEECC
T ss_conf             999677740-2859999999999987899299999734778999999998299987998899889899997579999802


Q ss_pred             -----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCC---CCCHHHCCCCCHHHHHHHHHHHHCCH
Q ss_conf             -----1566888762753025405774100001024676102302440784---26124205489899999999984498
Q gi|254780767|r  276 -----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYP---LVPEYFNSMIRSEALVRWIERLSQDT  347 (383)
Q Consensus       276 -----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~  347 (383)
                           |.+.+|++.+|+| ||+|..+.              |.+.+|-+.+   ++|     .-+++.+++.+..+++|+
T Consensus       287 ~~EGfgl~llEAma~GlP-vIa~d~~y--------------G~~eiI~~g~nG~Lv~-----~~d~~~la~~i~~ll~~~  346 (372)
T cd04949         287 QSEGFGLSLMEALSHGLP-VISYDVNY--------------GPSEIIEDGENGYLVP-----KGDIEALAEAIIELLNDP  346 (372)
T ss_pred             CCCCCCCHHHHHHHCCCC-EEEECCCC--------------CCHHHHCCCCCEEEEC-----CCCHHHHHHHHHHHHCCH
T ss_conf             003676589999985999-99805999--------------9688845898479968-----999999999999998699


Q ss_pred             HHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999999998389
Q gi|254780767|r  348 LQRRAMLHGFENLWDRMNT  366 (383)
Q Consensus       348 ~~r~~~~~~~~~~~~~Lg~  366 (383)
                      +.+++|-++..+..++...
T Consensus       347 ~~~~~~s~~a~~~a~~fs~  365 (372)
T cd04949         347 KLLQKFSEAAYENAERYSE  365 (372)
T ss_pred             HHHHHHHHHHHHHHHHCCH
T ss_conf             9999999999999995598


No 66 
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional
Probab=98.79  E-value=9e-07  Score=64.66  Aligned_cols=314  Identities=16%  Similarity=0.121  Sum_probs=159.0

Q ss_pred             CEEEEEECCCCHHHH-HHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             459999768214789-9999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    4 LKIAVIAGEISGDLL-AGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         4 mki~i~aGE~SGD~~-~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      |||+|+---.=||+. +.-++++||+.+| +.++.-++.+..+..= +-.-++++  ++-+  ...+-..-.....++.+
T Consensus         1 MkILvi~~~~iGDvvlttP~l~aLr~~~P-~a~I~~l~~~~~~~l~-~~~P~id~--vi~~--~~~~~~~~~~~~~~l~~   74 (348)
T PRK10916          1 MKILVIGPSWVGDMMMSQSLYRTLKARYP-QAIIDVMAPAWCRPLL-SRMPEVNE--AIPM--PLGHGALEIGERRRLGH   74 (348)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHHCC-CCEEEEEECHHHHHHH-HHCCCCCE--EEEC--CCCCCCHHHHHHHHHHH
T ss_conf             96999888764699999999999998789-9889999786269999-50998448--9974--67554000679999999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCC-EEEECCCCC-CCCCCCH-------HHHHHHHHHHCCCCCCCHHH
Q ss_conf             10012888689851177657999986630134631-111002211-0036635-------57999998640156774223
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPI-INYVCPSVW-AWREGRA-------RKMCAYINQVISILPFEKEV  153 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipv-i~yv~PqvW-AWr~~R~-------k~~~~~~d~~~~ifpFE~~~  153 (383)
                      .+++.+.|.++....   ++|=+-...  ..|+|. +-|-...-| .....|.       ..+.++....     ++...
T Consensus        75 ~Lr~~~yD~~i~l~~---s~rsal~~~--lag~~~riG~~~~~r~~l~~~~~~~~~~~~~~~v~~~~~l~-----~~~~~  144 (348)
T PRK10916         75 SLREKRYDRAYVLPN---SFKSALVPF--FAGIPHRTGWRGEMRYGLLNDLRVLDKEAWPLMVERYVALA-----YDKGV  144 (348)
T ss_pred             HHHHHCCCEEEECCC---CHHHHHHHH--HCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-----HHHCC
T ss_conf             998738998999998---679999998--63777212443023444316652367433407899999877-----54022


Q ss_pred             HHCCCCCCEEECCCCCCC-CC-CCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCC--CHHHHHHHHHHCCCCCEE
Q ss_conf             200255314763882112-21-00135588897618765565059985387430123051--118999876402735126
Q gi|254780767|r  154 MQRLGGPPTTFVGHPLSS-SP-SILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILP--FFESAVASLVKRNPFFRF  229 (383)
Q Consensus       154 f~k~~~~~~~fVGHPl~d-~~-~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP--~~l~~~~~l~~~~~~~~~  229 (383)
                      .....+     ...|+.. .. ..........+..++..++++|++-|||+..+-| .+|  -|.+.++.|.++  ++++
T Consensus       145 ~~~~~~-----~p~p~~~p~l~~~~~~~~~~~~~~~~~~~~~~i~i~pGa~~~~~K-rWp~e~fa~la~~L~~~--g~~v  216 (348)
T PRK10916        145 MRTAQD-----LPQPLLWPQLQVSEGEKSYTCNQFSLSSERPIIGFCPGAEFGPAK-RWPHYHYAELAKQLIDE--GYQV  216 (348)
T ss_pred             CCCHHC-----CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCC-CCCHHHHHHHHHHHHHC--CCEE
T ss_conf             111000-----575445556678989999999864877799779981687666567-79889999999999968--9979


Q ss_pred             EECCCCCHHHHHHHHHHHCCC--CCEEE-----EECCCCHHHHHHHHHHHCC-CHHHHHHHHHHCCCEEEECCCCCCEEE
Q ss_conf             201663368899999960488--85055-----2055203578876355233-115668887627530254057741000
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDI--SPEII-----IDKEQKKQVFMTCNAAMAA-SGTVILELALCGIPVVSIYKSEWIVNF  301 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~--~~~i~-----~~~~~~~~~l~~sd~ai~~-SGTaTLE~al~g~P~IV~Yk~~~lt~~  301 (383)
                      ++...++..+..+.+......  ...+.     +.-.+.-.+++.|++.|+. ||...| ++.+|+|+|.+|-.+--.++
T Consensus       217 vl~G~~~e~~~~~~i~~~l~~~~~~~~~nl~GktsL~el~ali~~a~l~I~nDSGpmHl-AaA~g~P~valFGpT~P~~~  295 (348)
T PRK10916        217 VLFGSAKDHEAGNEILAALNTEQQAWCRNLAGETQLEQAVILIAACKAIVTNDSGLMHV-AAALNRPLVALYGPSSPDFT  295 (348)
T ss_pred             EEEECHHHHHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHCCEEEECCCHHHHH-HHHCCCCEEEEECCCCCCCC
T ss_conf             99817236999999998510331565141678899999999998559878448828999-99809988999899993314


Q ss_pred             --E---EECCCCCCEEEEHHHCCCCCCCH----HHCCCCCHHHHHHHHHHHHCC
Q ss_conf             --0---10246761023024407842612----420548989999999998449
Q gi|254780767|r  302 --F---IFYIKTWTCALPNLIVDYPLVPE----YFNSMIRSEALVRWIERLSQD  346 (383)
Q Consensus       302 --i---~~lik~~~i~LpNii~~~~ivPE----liQ~~~~~~~i~~~~~~ll~d  346 (383)
                        .   .+.+...-..-|   ..+.-.|+    .+ .+.+|+.+.+++.++|..
T Consensus       296 ~P~~~~~~vi~~~~~~~~---~~~~~c~~g~~~Cm-~~i~p~~V~~~~~~lL~~  345 (348)
T PRK10916        296 PPLSHKARVIRLITGYHK---VRKGDAAQGYHQSL-IDITPQRVLEELNALLLQ  345 (348)
T ss_pred             CCCCCCEEEEEECCCCCC---CCCCCCCCCCCCHH-HHCCHHHHHHHHHHHHHH
T ss_conf             899998489982687687---67889999854645-409999999999999841


No 67 
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases. AmsK is involved in the biosynthesis of amylovoran, which functions as a virulence factor. It functions as a glycosyl transferase which transfers galactose from UDP-galactose to a lipid-linked amylovoran-subunit precursor.  The members of this family are found mainly in bacteria and Archaea.
Probab=98.78  E-value=5.4e-06  Score=59.51  Aligned_cols=225  Identities=13%  Similarity=0.176  Sum_probs=135.2

Q ss_pred             HHHHHHHHCCCCCCEE-EECCCCCCC------CCCCHHHHHHHHHHHCCCCCCCHHHHHCC-----CCCCEEECCCCCCC
Q ss_conf             9998663013463111-100221100------36635579999986401567742232002-----55314763882112
Q gi|254780767|r  104 VAKRVRKKMPNLPIIN-YVCPSVWAW------REGRARKMCAYINQVISILPFEKEVMQRL-----GGPPTTFVGHPLSS  171 (383)
Q Consensus       104 lak~lkk~~~~ipvi~-yv~PqvWAW------r~~R~k~~~~~~d~~~~ifpFE~~~f~k~-----~~~~~~fVGHPl~d  171 (383)
                      .+..+++...++|++. .=.+-+|.=      .+-| +.+-+..|+++++=.+-.++..+.     ..+.+.+.|=+...
T Consensus       142 ~~all~~~~~~~~~~~taHg~Diy~~~~~~~~~~~~-~~~~~~~d~v~~vS~~~~~~l~~~~~~~~~ki~v~~~Gv~~~~  220 (407)
T cd04946         142 ALALLKKEYLRKRVISRAHGYDLYEDRYPSGYIPLR-RYLLSSLDAVFPCSEQGRNYLQKRYPAYKEKIKVSYLGVSDPG  220 (407)
T ss_pred             HHHHHHHHCCCCCEEEEEECHHHCCCCCCCCCHHHH-HHHHHHCCEEEEECHHHHHHHHHHCCCCCCCEEEEECCCCCCC
T ss_conf             999999863898299973030303330235304789-9998526879997778899998736997575899968967433


Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEE--ECCCCCHHHHHHHHHHHCC
Q ss_conf             21001355888976187655650599853874301230511189998764027351262--0166336889999996048
Q gi|254780767|r  172 SPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFS--LVTVSSQENLVRCIVSKWD  249 (383)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~--i~~~~~~~~~~~~~~~~~~  249 (383)
                      ..   .          .+.....+-++-=+|-.|.|. ++.+++++..+.+++|+.++.  +......++.++...++.+
T Consensus       221 ~~---~----------~~~~~~~~~i~svgrlv~~Kg-~~~li~A~~~l~~~~~~~~~~~~iiG~G~~~~~l~~~~~~l~  286 (407)
T cd04946         221 II---S----------KPSKDDTLRIVSCSYLVPVKR-VDLIIKALAALAKARPSIKIKWTHIGGGPLEDTLKELAESKP  286 (407)
T ss_pred             CC---C----------CCCCCCCEEEEEEECCCHHCC-HHHHHHHHHHHHHHCCCCEEEEEEEECCHHHHHHHHHHHHCC
T ss_conf             46---7----------888789659999617730038-899999999998658993899999826812899999999779


Q ss_pred             CCCEEEEECCC----CHHHHHH--HHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHC
Q ss_conf             88505520552----0357887--63552331-----1566888762753025405774100001024676102302440
Q gi|254780767|r  250 ISPEIIIDKEQ----KKQVFMT--CNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIV  318 (383)
Q Consensus       250 ~~~~i~~~~~~----~~~~l~~--sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~  318 (383)
                      +...|......    -.+.+..  +|+-+..|     +++.+|++.+|+|.|.. ..+               |.|-++-
T Consensus       287 l~~~v~f~G~~~~~~v~~~~~~~~~d~~~~~s~~eg~p~~~~Eama~g~pvi~t-~~~---------------g~~e~v~  350 (407)
T cd04946         287 ENISVNFTGELSNSEVYKLYKENPVDVFVNLSESEGLPVSIMEAMSFGIPVIAT-NVG---------------GTPEIVD  350 (407)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEC-CCC---------------CCHHHEE
T ss_conf             988799927899699999998569619995663346417999999749999984-799---------------9841230


Q ss_pred             CCC---CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             784---261242054898999999999844989999999999999998
Q gi|254780767|r  319 DYP---LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDR  363 (383)
Q Consensus       319 ~~~---ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~  363 (383)
                      +.+   ++|    .+.+++.+++++.++++|++.+++|..+.++..++
T Consensus       351 ~~~~g~l~~----~~~~~~~la~~i~~l~~~~~~~~~~~~~ar~~v~~  394 (407)
T cd04946         351 NGGNGLLLS----KDPTPNELVSSLSKFIDNEEEYQTMREKAREKWEE  394 (407)
T ss_pred             CCCCEEEEC----CCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
T ss_conf             698279968----99999999999999980999999999999999998


No 68 
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]
Probab=98.77  E-value=5.3e-06  Score=59.56  Aligned_cols=345  Identities=17%  Similarity=0.138  Sum_probs=163.2

Q ss_pred             CCEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECC--HHHHHCC--CEEEEC--HHHCCEEEHH---HHHH-HHH
Q ss_conf             745999976821478999-999999973899839999717--8999478--806504--4453110136---7466-459
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGG--PSLQKEG--LVSLFD--FSELSVIGIM---QVVR-HLP   71 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG--~~m~~~G--~~~~~~--~~~l~v~G~~---evl~-~~~   71 (383)
                      +|||++++.-..||+.-. .|.++|+++ +.++.|...+.  +..+++|  ++..-.  .....--+..   ..+. ++.
T Consensus         1 ~mkil~~~~~~~Ghv~p~~aL~~eL~~~-gheV~~~~~~~~~~~ve~ag~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (406)
T COG1819           1 RMKILFVVCGAYGHVNPCLALGKELRRR-GHEVVFASTGKFKEFVEAAGLAFVAYPIRDSELATEDGKFAGVKSFRRLLQ   79 (406)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHC-CCEEEEEECHHHHHHHHHHCCCCEECCCCCCHHHHHCCHHHHHHHHHHHHH
T ss_conf             9579998177643226669999999976-974999737789999998364610244666532332011233454899998


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEE--ECHHHHHHHH----------HHHHH---HHCCCC--------CCEEE-ECCCCCC
Q ss_conf             99999999986100128886898--5117765799----------99866---301346--------31111-0022110
Q gi|254780767|r   72 QFIFRINQTVELIVSSKPDVLLI--VDNPDFTHRV----------AKRVR---KKMPNL--------PIINY-VCPSVWA  127 (383)
Q Consensus        72 ~~~~~~~~~~~~i~~~~Pd~vi~--iD~pgFnl~l----------ak~lk---k~~~~i--------pvi~y-v~PqvWA  127 (383)
                      .+++...+..+.+.+..||.++-  ..+.++-.+.          +.+..   +..+-+        ++-+| +.|-.=.
T Consensus        80 ~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (406)
T COG1819          80 QFKKLIRELLELLRELEPDLVVDDARLSLGLAARLLGIPVVGINVAPYTPLPAAGLPLPPVGIAGKLPIPLYPLPPRLVR  159 (406)
T ss_pred             HHHHHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHCCCCEEEECCHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCHHHHC
T ss_conf             87766688999998746132124100012356544388788861323234403216865310144566565555332303


Q ss_pred             C----CCCCHHHHHH-----------HHHHHCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHH-HHCCCCCC
Q ss_conf             0----3663557999-----------998640156774223200255314763882112210013558889-76187655
Q gi|254780767|r  128 W----REGRARKMCA-----------YINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRN-KQRNTPSQ  191 (383)
Q Consensus       128 W----r~~R~k~~~~-----------~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~-~~~~~~~~  191 (383)
                      |    +.++.+...+           ..+....-=.++..+++..  .... -++|.....-......... .......+
T Consensus       160 ~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~d  236 (406)
T COG1819         160 PLIFARSWLPKLVVRRNLGLELGLPNIRRLFASGPLLEIAYTDVL--FPPG-DRLPFIGPYIGPLLGEAANELPYWIPAD  236 (406)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCCCEEECCCC--CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             000220355656665302456455407777426987642215644--5766-6788663656775777533466531379


Q ss_pred             CCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEE-EEECCCCHHHHHHHHH
Q ss_conf             650599853874301230511189998764027351262016633688999999604888505-5205520357887635
Q gi|254780767|r  192 WKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEI-IIDKEQKKQVFMTCNA  270 (383)
Q Consensus       192 ~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i-~~~~~~~~~~l~~sd~  270 (383)
                      +++|-+--||-..- ...+-..+++...+     +.++++.... .+    ....  +.+.++ +.......+++..||+
T Consensus       237 ~~~vyvslGt~~~~-~~l~~~~~~a~~~l-----~~~vi~~~~~-~~----~~~~--~~p~n~~v~~~~p~~~~l~~ad~  303 (406)
T COG1819         237 RPIVYVSLGTVGNA-VELLAIVLEALADL-----DVRVIVSLGG-AR----DTLV--NVPDNVIVADYVPQLELLPRADA  303 (406)
T ss_pred             CCEEEEECCCCCCH-HHHHHHHHHHHHCC-----CCEEEEECCC-CC----CCCC--CCCCCEEEECCCCHHHHHHCCCE
T ss_conf             96399955787537-88999999998549-----9649997367-64----2346--88877478615758988740798


Q ss_pred             HHCCCHHHHH-HHHHHCCCEEEECCCCCCEEEEE-ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHH
Q ss_conf             5233115668-88762753025405774100001-024676102302440784261242054898999999999844989
Q gi|254780767|r  271 AMAASGTVIL-ELALCGIPVVSIYKSEWIVNFFI-FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTL  348 (383)
Q Consensus       271 ai~~SGTaTL-E~al~g~P~IV~Yk~~~lt~~i~-~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~  348 (383)
                      +|+-.|-.|. |+...|+|+|++--.. =.+.-+ +.-...+        |..+=.    +..|++.+..++.++|.|+.
T Consensus       304 vI~hGG~gtt~eaL~~gvP~vv~P~~~-DQ~~nA~rve~~G~--------G~~l~~----~~l~~~~l~~av~~vL~~~~  370 (406)
T COG1819         304 VIHHGGAGTTSEALYAGVPLVVIPDGA-DQPLNAERVEELGA--------GIALPF----EELTEERLRAAVNEVLADDS  370 (406)
T ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCC-CHHHHHHHHHHCCC--------CEECCC----CCCCHHHHHHHHHHHHCCHH
T ss_conf             991798579999997399989827873-07879999997498--------831275----65888999999999967399


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999999999983899998999999999861
Q gi|254780767|r  349 QRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       349 ~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      ++++.    +++.+.++...+ .+.+|+.|.++.
T Consensus       371 ~~~~~----~~~~~~~~~~~g-~~~~a~~le~~~  399 (406)
T COG1819         371 YRRAA----ERLAEEFKEEDG-PAKAADLLEEFA  399 (406)
T ss_pred             HHHHH----HHHHHHHHHCCC-HHHHHHHHHHHH
T ss_conf             99999----999999765553-799999999998


No 69 
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional
Probab=98.65  E-value=7.4e-06  Score=58.62  Aligned_cols=306  Identities=11%  Similarity=0.117  Sum_probs=150.2

Q ss_pred             CEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHCC-CEEEECHHHCCEEEHHHHHHHH--HHHHHHHHH
Q ss_conf             45999976821478999-9999999738998399997178999478-8065044453110136746645--999999999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKEG-LVSLFDFSELSVIGIMQVVRHL--PQFIFRINQ   79 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G-~~~~~~~~~l~v~G~~evl~~~--~~~~~~~~~   79 (383)
                      |||+|+.--.=||+.=+ -++++||+.+| +.++.-+..+...+.= .+..  ++++=.+..-+--+..  ..++.....
T Consensus         1 MrILiIr~~~lGDvilttP~l~~Lr~~~P-~a~I~~lv~~~~~~l~~~~P~--id~vi~~~~~~~~k~~~~~~~~~~~~~   77 (322)
T PRK10964          1 MRVLIVKTSSMGDVLHTLPALTDAQQAIP-GIQFDWVVEEGFAQIPSWHSA--VDRVIPVAIRRWRKAWFSAPIKAERKA   77 (322)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHHCC-CCEEEEEECHHHHHHHHCCCC--CCEEEECCCCHHHHCCCCHHHHHHHHH
T ss_conf             97999916756899989999999999889-988999977257887510986--258874242012212231157999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCC
Q ss_conf             98610012888689851177657999986630134631111002211003663557999998640156774223200255
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGG  159 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~  159 (383)
                      ..+.++.++.|++|-.....-+-.++.++.+   +.+.-+       .|+..|-....-++++-..+.+-+. ..+++..
T Consensus        78 ~~~~lr~~~yD~vidlq~~~rsa~l~~~~~~---~~r~g~-------~~~~~r~~~~~~~~~~~~~~~~~~h-~v~r~~~  146 (322)
T PRK10964         78 FRRALQAEQYDAVIDAQGLVKSAALVTRLAH---GVKHGM-------DWQSAREPLASLFYNRKHHIAKQQH-AVERTRE  146 (322)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHHHHHHHHCC---CCEECC-------CCCCCCCCHHHHHCCCCCCCCCCCC-HHHHHHH
T ss_conf             9999874589799988531778999998636---861046-------6433444014543035306873103-9999999


Q ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCC--CHHHHHHHHHHCCCCCEEEECCC-CC
Q ss_conf             3147638821122100135588897618765565059985387430123051--11899987640273512620166-33
Q gi|254780767|r  160 PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILP--FFESAVASLVKRNPFFRFSLVTV-SS  236 (383)
Q Consensus       160 ~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP--~~l~~~~~l~~~~~~~~~~i~~~-~~  236 (383)
                      +-..-.|-|.-+..........+.... ...+.+.+.++||+.+.+  +.+|  -|.+.++.+.++  +++++++.. ++
T Consensus       147 l~~~~lg~~~p~~~~~~~~~~~~~~~~-~~~~~~~vv~~~~~s~~~--K~Wp~e~f~~La~~L~~~--g~~v~l~~G~~~  221 (322)
T PRK10964        147 LFAKSLGYSKPQTQGDYAIAQHFLTNL-PADAGPYLVFLHATTRDD--KHWPEAHWRELIGLLADS--GLRIKLPWGAPH  221 (322)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHC-CCCCCCEEEEECCCCCCC--CCCCHHHHHHHHHHHHHC--CCEEEEECCCHH
T ss_conf             999974998987502256659987412-125698499973787412--589989999999999967--997999478989


Q ss_pred             HHHHHHHHHHHCCCCCEEE--EECCCCHHHHHHHHHHHCC-CHHHHHHHHHHCCCEEEECC-CCCCEEEE--E--ECCCC
Q ss_conf             6889999996048885055--2055203578876355233-11566888762753025405-77410000--1--02467
Q gi|254780767|r  237 QENLVRCIVSKWDISPEII--IDKEQKKQVFMTCNAAMAA-SGTVILELALCGIPVVSIYK-SEWIVNFF--I--FYIKT  308 (383)
Q Consensus       237 ~~~~~~~~~~~~~~~~~i~--~~~~~~~~~l~~sd~ai~~-SGTaTLE~al~g~P~IV~Yk-~~~lt~~i--~--~lik~  308 (383)
                      .+..........+ ..++.  ..-.+.-.+++.|++.|+. ||... =+|.+|+|+|.+|- |+|--+-=  .  +-++.
T Consensus       222 e~~~~~~i~~~~~-~v~~~g~~sL~elaall~~a~l~I~nDSG~mH-lAaAlg~P~v~LFGpT~P~~~gP~g~~~~~~~~  299 (322)
T PRK10964        222 EEARAKRLAEGFD-YVEVLPKMSLEEVARVLAGAKAVVSVDTGLSH-LTAALDRPNITLYGPTDPGLIGGYGKNQHACRS  299 (322)
T ss_pred             HHHHHHHHHHCCC-CCEECCCCCHHHHHHHHHHCCEEEECCCHHHH-HHHHCCCCEEEEECCCCCCCCCCCCCCCEEEEC
T ss_conf             9999999980699-61245899999999999709999966975999-999839998999888994030788888248968


Q ss_pred             CCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             6102302440784261242054898999999999844
Q gi|254780767|r  309 WTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQ  345 (383)
Q Consensus       309 ~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~  345 (383)
                      ..-.+               .+.+++++.+.++++|.
T Consensus       300 ~~~~~---------------~~~~~~~v~~~~~~~~~  321 (322)
T PRK10964        300 EGKSM---------------ANLSAETVFQKLETLIS  321 (322)
T ss_pred             CCCCC---------------CCCCHHHHHHHHHHHHC
T ss_conf             99870---------------21999999999999745


No 70 
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326   These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. ; GO: 0016758 transferase activity transferring hexosyl groups, 0016999 antibiotic metabolic process.
Probab=98.62  E-value=1.3e-06  Score=63.56  Aligned_cols=328  Identities=13%  Similarity=0.169  Sum_probs=183.3

Q ss_pred             HHHHHH-HHHHHHHHHCCCCEEEEEECCHHHH----HCCCEEE-EC--------HHH------CCEEE-HHHHH-HHHHH
Q ss_conf             478999-9999999738998399997178999----4788065-04--------445------31101-36746-64599
Q gi|254780767|r   15 GDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQ----KEGLVSL-FD--------FSE------LSVIG-IMQVV-RHLPQ   72 (383)
Q Consensus        15 GD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~----~~G~~~~-~~--------~~~------l~v~G-~~evl-~~~~~   72 (383)
                      |++-.+ .++++|=++ +  -++....++.|+    ++|.+.+ |+        +.+      ...++ +.+++ +-|..
T Consensus         7 GHVNPtL~v~~ELV~R-G--h~VTY~~t~ef~~~v~~~GA~~~~Y~~~~~~~~~~~~~~~sa~~~~~~~~~~~~~~ll~~   83 (429)
T TIGR01426         7 GHVNPTLGVVEELVAR-G--HRVTYATTEEFADAVAAAGAEALLYGSALEGDPDMPREEESAENMTEEELLDIIEKLLDE   83 (429)
T ss_pred             CCCCCCHHHHHHHHHC-C--CEEEEECCHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             7657657899999845-9--746631788899999972985888486777654565100462103234588999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECHHHHH--HHHHHHHHHHCCCCCCEE----EECC-CCCC------------------
Q ss_conf             99999999861001288868985117765--799998663013463111----1002-2110------------------
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIVDNPDFT--HRVAKRVRKKMPNLPIIN----YVCP-SVWA------------------  127 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn--l~lak~lkk~~~~ipvi~----yv~P-qvWA------------------  127 (383)
                      -.+.+.++.+.+..-+||+|+=-=.--|+  --||+++     ++|+|.    |+++ .+|.                  
T Consensus        84 ~~~~Lp~l~~~~~~d~pDlv~yD~a~~l~~G~llA~~l-----~~P~i~~~p~fA~~~~~~~~~~avqdPtadrGeea~~  158 (429)
T TIGR01426        84 SLSLLPQLEEAYKGDRPDLVVYDIATPLWAGRLLARKL-----DVPVISSFPTFASNEEFEEMQRAVQDPTADRGEEALS  158 (429)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHHHHH-----CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999997148998789853131568999987650-----7886898654555365145677434766555420157


Q ss_pred             ------CCCCC--HH--------HHHHHHHHHCCC--------CCCC--------------HHHH----HCCCCCC-EEE
Q ss_conf             ------03663--55--------799999864015--------6774--------------2232----0025531-476
Q gi|254780767|r  128 ------WREGR--AR--------KMCAYINQVISI--------LPFE--------------KEVM----QRLGGPP-TTF  164 (383)
Q Consensus       128 ------Wr~~R--~k--------~~~~~~d~~~~i--------fpFE--------------~~~f----~k~~~~~-~~f  164 (383)
                            |...|  =+        -+.+|+.....+        =|++              .+.|    +.+ +=. =+|
T Consensus       159 p~~~~~~~~~~~~~r~seqmelfgL~~y~~~~~~ll~~~~~~~~p~~~l~~~~~dlnlv~~pk~Fq~~~e~f-Dd~tf~F  237 (429)
T TIGR01426       159 PIGEDSLEEAAIAERFSEQMELFGLAEYVARLSALLEEHGITAPPVEFLAAPRRDLNLVYTPKAFQPAGETF-DDRTFKF  237 (429)
T ss_pred             CCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCEEECCHHHCCCCEEE-CCCCCEE
T ss_conf             888256513778763357889999999999999999860798634388733789964476462112064111-5740133


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCC-HHHHHHHHHHCCCCCEEEECCCCCHHHHHHH
Q ss_conf             388211221001355888976187655650599853874301230511-1899987640273512620166336889999
Q gi|254780767|r  165 VGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPF-FESAVASLVKRNPFFRFSLVTVSSQENLVRC  243 (383)
Q Consensus       165 VGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~-~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~  243 (383)
                      ||=|+-+......   ++  -..-..++|+|.+==||=-++    .|. |.++.-+=.+..+.-+.++..+...+.   .
T Consensus       238 VGP~~g~R~~~~~---nF--w~~~~~~~pV~liSLGTvFn~----~p~~fyr~f~~AF~~~~GW~vV~~~g~~vDp---~  305 (429)
T TIGR01426       238 VGPCIGDRKEDGS---NF--WAEPEKGRPVVLISLGTVFNA----QPSKFYRTFVEAFRDLPGWHVVLSVGKGVDP---A  305 (429)
T ss_pred             CCCCCCCCCCCCC---CC--CCCCCCCCCEEEEECCHHHCC----CHHHHHHHHHHHCCCCCCCEEEEEECCCCCH---H
T ss_conf             2878876777865---57--788888884699975614412----4479999999860899870799972670264---6


Q ss_pred             HHHHCCCCCEEEEE-CCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCC
Q ss_conf             99604888505520-55203578876355233115668-88762753025405774100001024676102302440784
Q gi|254780767|r  244 IVSKWDISPEIIID-KEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYP  321 (383)
Q Consensus       244 ~~~~~~~~~~i~~~-~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~  321 (383)
                      .+...  +.++.+- .=...++|.+||+.|+=+||.|- |+...|||+|++-...=-. ..++.+       .-|=+|..
T Consensus       306 ~L~~~--P~Nv~VR~~VPq~evL~~A~lfvTHgGmnSt~EaL~~gVP~va~P~~adQ~-~~A~R~-------~ELGlg~~  375 (429)
T TIGR01426       306 DLGEL--PKNVEVRRWVPQLEVLEKADLFVTHGGMNSTMEALAAGVPLVAVPQGADQP-MTARRI-------AELGLGRV  375 (429)
T ss_pred             HHCCC--CCCEEEECCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCEEEECCCCCCH-HHHHHH-------HHCCCEEE
T ss_conf             61679--887788546562778988888863166015899996499689851788801-376575-------13562111


Q ss_pred             CCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             2612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  322 LVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       322 ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      +=+    ++.|++.|-..+.+++.|+.+++    +.+++++.+.+.|++ ++||++|..+|
T Consensus       376 l~~----e~vTa~~LR~~v~~v~~D~~~~~----~~~~~r~~~~eAGG~-~rAAdeiE~~l  427 (429)
T TIGR01426       376 LPK----EEVTAEKLREAVLAVLSDDEYLE----RLKKIRAEIREAGGA-RRAADEIEGFL  427 (429)
T ss_pred             CCC----CCCCHHHHHHHHHHHHCCHHHHH----HHHHHHHHHHHCCCH-HHHHHHHHHHH
T ss_conf             376----55278999999998605888999----999999999850453-38999999974


No 71 
>COG4671 Predicted glycosyl transferase [General function prediction only]
Probab=98.61  E-value=1.4e-06  Score=63.30  Aligned_cols=322  Identities=13%  Similarity=0.098  Sum_probs=182.3

Q ss_pred             CCEEEEEECCCCHHHH---HHHHHHHHHHHCCCCEEEEEECCHHHHH-----CCCEEE-ECHHHCCEEEHH---HHHHHH
Q ss_conf             7459999768214789---9999999997389983999971789994-----788065-044453110136---746645
Q gi|254780767|r    3 SLKIAVIAGEISGDLL---AGDLIKSLKEMVSYPINLVGVGGPSLQK-----EGLVSL-FDFSELSVIGIM---QVVRHL   70 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~---~a~li~~Lk~~~~~~~~~~giGG~~m~~-----~G~~~~-~~~~~l~v~G~~---evl~~~   70 (383)
                      -||||+-+-..+|=-|   +.++.++|.+. ..++++.-|.|--+..     +|++.+ .+.=..+--|+.   +-=-.+
T Consensus         9 ~~Ri~~Yshd~~GlGHlrR~~~Ia~aLv~d-~~~~~Il~IsG~~~~~~F~~~~gVd~V~LPsl~k~~~G~~~~~d~~~~l   87 (400)
T COG4671           9 RPRILFYSHDLLGLGHLRRALRIAHALVED-YLGFDILIISGGPPAGGFPGPAGVDFVKLPSLIKGDNGEYGLVDLDGDL   87 (400)
T ss_pred             CCEEEEEEHHHCCCHHHHHHHHHHHHHHHC-CCCCEEEEEECCCCCCCCCCCCCCCEEECCCEEECCCCCEEEEECCCCH
T ss_conf             625789860101304899999999998525-5684399995897568897745675685484574588733444568889


Q ss_pred             HHHHHHHHH-HHHHCCCCCCCEEEEECHHHHHHH-----HHHHHHHHCCCCCCEE----EECCC--CCCCCC-CCHHHHH
Q ss_conf             999999999-986100128886898511776579-----9998663013463111----10022--110036-6355799
Q gi|254780767|r   71 PQFIFRINQ-TVELIVSSKPDVLLIVDNPDFTHR-----VAKRVRKKMPNLPIIN----YVCPS--VWAWRE-GRARKMC  137 (383)
Q Consensus        71 ~~~~~~~~~-~~~~i~~~~Pd~vi~iD~pgFnl~-----lak~lkk~~~~ipvi~----yv~Pq--vWAWr~-~R~k~~~  137 (383)
                      -.+++...+ +...+..++||++|.=-+| |-+|     +-+++|...+ -++.-    -=.||  .=-||. .-...+.
T Consensus        88 ~e~~~~Rs~lil~t~~~fkPDi~IVd~~P-~Glr~EL~ptL~yl~~~~t-~~vL~lr~i~D~p~~~~~~w~~~~~~~~I~  165 (400)
T COG4671          88 EETKKLRSQLILSTAETFKPDIFIVDKFP-FGLRFELLPTLEYLKTTGT-RLVLGLRSIRDIPQELEADWRRAETVRLIN  165 (400)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCC-CCHHHHHHHHHHHHHHCCC-CCEEEHHHHHHCHHHHCCCHHHHHHHHHHH
T ss_conf             99999999999999983299789993555-4136546679999860598-625544765525444135144567999998


Q ss_pred             HHHHHHCCC-----CCCCHHH--HHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECC-CCCCHHHH
Q ss_conf             999864015-----6774223--200255314763882112210013558889761876556505998538-74301230
Q gi|254780767|r  138 AYINQVISI-----LPFEKEV--MQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGS-RAQEIYKI  209 (383)
Q Consensus       138 ~~~d~~~~i-----fpFE~~~--f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGS-R~~EI~~~  209 (383)
                      +|+|.+++-     +.++.+|  +... .-++.|+|-  +....+..+..     ....+++..|++.+|- +..  ..+
T Consensus       166 r~yD~V~v~GdP~f~d~~~~~~~~~~i-~~k~~ytG~--vq~~~~~~~~p-----~~~~pE~~~Ilvs~GGG~dG--~eL  235 (400)
T COG4671         166 RFYDLVLVYGDPDFYDPLTEFPFAPAI-RAKMRYTGF--VQRSLPHLPLP-----PHEAPEGFDILVSVGGGADG--AEL  235 (400)
T ss_pred             HHHEEEEEECCCCCCCHHHCCCCCHHH-HHHEEEEEE--EECCCCCCCCC-----CCCCCCCCEEEEECCCCHHH--HHH
T ss_conf             754079994695415732227860765-632667677--61367678898-----76787633399954887205--999


Q ss_pred             CCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHH-HCCC--CCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHH
Q ss_conf             5111899987640273512620166336889999996-0488--850552055203578876355233115668-88762
Q gi|254780767|r  210 LPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVS-KWDI--SPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALC  285 (383)
Q Consensus       210 lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~-~~~~--~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~  285 (383)
                      +-.+++++..+..-++  +..+.+.|.......+.+. ....  +..|.....+.-++++.|+.+++.+|-+|. |.-.+
T Consensus       236 i~~~l~A~~~l~~l~~--~~~ivtGP~MP~~~r~~l~~~A~~~p~i~I~~f~~~~~~ll~gA~~vVSm~GYNTvCeILs~  313 (400)
T COG4671         236 IETALAAAQLLAGLNH--KWLIVTGPFMPEAQRQKLLASAPKRPHISIFEFRNDFESLLAGARLVVSMGGYNTVCEILSF  313 (400)
T ss_pred             HHHHHHHHHHCCCCCC--CEEEEECCCCCHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHEEEECCCCHHHHHHHHC
T ss_conf             9999987550778874--33898489998899999987425699728997330399998764403520462226688737


Q ss_pred             CCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHH
Q ss_conf             753025405774100001024676102302440784261242054898999999999844989
Q gi|254780767|r  286 GIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTL  348 (383)
Q Consensus       286 g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~  348 (383)
                      |+|.+|+-++.+-..-..|--+..-.+|+..     +-|    ++.||+++++++...++-|.
T Consensus       314 ~k~aLivPr~~p~eEQliRA~Rl~~LGL~dv-----L~p----e~lt~~~La~al~~~l~~P~  367 (400)
T COG4671         314 GKPALIVPRAAPREEQLIRAQRLEELGLVDV-----LLP----ENLTPQNLADALKAALARPS  367 (400)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHCCCCEE-----ECC----CCCCHHHHHHHHHHCCCCCC
T ss_conf             9955984367873899999999986695103-----073----55896899999985426899


No 72 
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=98.56  E-value=5.1e-06  Score=59.70  Aligned_cols=153  Identities=24%  Similarity=0.174  Sum_probs=103.4

Q ss_pred             CEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCC----HHHHHHHHHHHCCCCCEEEE-ECCCCHHHHHH
Q ss_conf             50599853874301230511189998764027351262016633----68899999960488850552-05520357887
Q gi|254780767|r  193 KKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSS----QENLVRCIVSKWDISPEIII-DKEQKKQVFMT  267 (383)
Q Consensus       193 ~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~----~~~~~~~~~~~~~~~~~i~~-~~~~~~~~l~~  267 (383)
                      ++|+ +=| |-.-+|. +..+++++..+.++.|+.++.+....+    .....+..+++.++..+|.+ ...+-.++|.+
T Consensus       294 ~~v~-~vg-Rv~p~Kd-i~tlI~A~~~v~~~~p~~rl~I~Gp~d~~~~y~~ec~~lv~~lgL~~~V~F~G~~dv~~~l~~  370 (475)
T cd03813         294 PVVG-LIG-RVVPIKD-IKTFIRAAAIVRKKIPDAEGWVIGPTDEDPEYAEECRELVESLGLEDNVKFTGFQNVKEYLPK  370 (475)
T ss_pred             CEEE-EEE-ECCCCCC-HHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHH
T ss_conf             8899-997-0111669-999999999999868983999977998885899999999998299872798387898999985


Q ss_pred             HHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCC--CCCCHHHCCCCCHHHHHHHH
Q ss_conf             63552331-----156688876275302540577410000102467610230244078--42612420548989999999
Q gi|254780767|r  268 CNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDY--PLVPEYFNSMIRSEALVRWI  340 (383)
Q Consensus       268 sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~--~ivPEliQ~~~~~~~i~~~~  340 (383)
                      +|+.+.+|     |.+.||++.+|+|.| .-.++.....+.-    .    .|-..|+  .+||     --+++.+++++
T Consensus       371 ~Dv~vl~S~~Eg~plvllEAmA~G~PvV-aTdVGg~~e~v~~----~----~~~~~G~~G~lvp-----~~d~~~LA~ai  436 (475)
T cd03813         371 LDVLVLTSISEGQPLVILEAMAAGIPVV-ATDVGSCRELIEG----A----DDEALGPAGEVVP-----PADPEALARAI  436 (475)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHCCCCEE-ECCCCCCHHHHCC----C----CCCCCCCCEEEEC-----CCCHHHHHHHH
T ss_conf             7999965733467579999997699889-7269981887538----6----6567788548969-----99999999999


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9984498999999999999999
Q gi|254780767|r  341 ERLSQDTLQRRAMLHGFENLWD  362 (383)
Q Consensus       341 ~~ll~d~~~r~~~~~~~~~~~~  362 (383)
                      ..++.|++.|++|-++..+--+
T Consensus       437 ~~Ll~d~~~r~~~g~~ar~rv~  458 (475)
T cd03813         437 LRLLKDPELRRAMGEAGRKRVE  458 (475)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHH
T ss_conf             9997399999999999999999


No 73 
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family; InterPro: IPR011875    This entry describes Corynebacterium glutamicum GlgA and closely related proteins in other species. This enzyme is required for glycogen biosynthesis and appears to replace the distantly related IPR011835 from INTERPRO, family of ADP-glucose type glycogen synthase in Corynebacterium glutamicum, Mycobacterium tuberculosis, Bifidobacterium longum, and Streptomyces coelicolor ..
Probab=98.51  E-value=2.6e-06  Score=61.57  Aligned_cols=332  Identities=17%  Similarity=0.199  Sum_probs=200.3

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCHHHHHC--CCEEEECHHH-CCEEEH--HHHHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             8999999999973899839999717899947--8806504445-311013--6746645999999999986100128886
Q gi|254780767|r   17 LLAGDLIKSLKEMVSYPINLVGVGGPSLQKE--GLVSLFDFSE-LSVIGI--MQVVRHLPQFIFRINQTVELIVSSKPDV   91 (383)
Q Consensus        17 ~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~--G~~~~~~~~~-l~v~G~--~evl~~~~~~~~~~~~~~~~i~~~~Pd~   91 (383)
                      +|.-.|.++|.++.  ++.+..+|+++-++.  .+-.-++.+. |.|.|.  ++-|..=     +--+..+.++.+--|+
T Consensus        20 VHv~~L~~~L~~l~--~vdVr~fG~~rteadiPaiPna~~~~gsL~v~~Y~~~~~L~~G-----ldPran~aL~tfSvDL   92 (416)
T TIGR02149        20 VHVEELARELARLV--DVDVRCFGDKRTEADIPAIPNAFFSEGSLKVLGYRPWSELKEG-----LDPRANKALKTFSVDL   92 (416)
T ss_pred             HHHHHHHHHHHHHC--CEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHCCC-----CCHHHHHHHCCHHHHH
T ss_conf             11888999998653--4004643887442334566622168983288740787432256-----7722575402311578


Q ss_pred             EEEECHHHH--------HHHHHHHHHHHCCCCCCE---EEECCCCCCCCCCCHHHH--------------HHHHHH----
Q ss_conf             898511776--------579999866301346311---110022110036635579--------------999986----
Q gi|254780767|r   92 LLIVDNPDF--------THRVAKRVRKKMPNLPII---NYVCPSVWAWREGRARKM--------------CAYINQ----  142 (383)
Q Consensus        92 vi~iD~pgF--------nl~lak~lkk~~~~ipvi---~yv~PqvWAWr~~R~k~~--------------~~~~d~----  142 (383)
                      ++.=|.-+=        ==-||-+|=|..+|+|.+   |=-=|    -|+|....+              -+..|.    
T Consensus        93 ~m~~d~~~~~vvHsHTWYa~LAG~LAk~Lyd~PlVvTaHSLEP----LRPWK~EQLGgGY~lSsW~EktA~~aAd~vIAV  168 (416)
T TIGR02149        93 AMANDVEDADVVHSHTWYAALAGHLAKLLYDVPLVVTAHSLEP----LRPWKKEQLGGGYKLSSWAEKTAIEAADRVIAV  168 (416)
T ss_pred             HHHHHHCCCCEEECHHHHHHHHHHHHHHHCCCCEEEEEECCCC----CCCCHHHHCCCCCCCCHHHHHHHHHHCCCEEEH
T ss_conf             8761100271553207888789999999669983997303788----871317565897420247888899850406531


Q ss_pred             -------HCCCCCCCHHHHHCCCCCCEEECCCCCCCCCC-CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHH
Q ss_conf             -------40156774223200255314763882112210-0135588897618765565059985387430123051118
Q gi|254780767|r  143 -------VISILPFEKEVMQRLGGPPTTFVGHPLSSSPS-ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFE  214 (383)
Q Consensus       143 -------~~~ifpFE~~~f~k~~~~~~~fVGHPl~d~~~-~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l  214 (383)
                             ||..+|-    .+. ..+.|.|=|==+.+.-+ ...++...+++.|++.++|.+++- | |-+ =.+-+|-++
T Consensus       169 S~amr~DiL~~YP~----lD~-~kv~Vv~NGId~~~y~~~~~~~~~~v~~~~Gid~~rP~~lFV-G-RIt-RQKGv~~L~  240 (416)
T TIGR02149       169 SGAMREDILKVYPD----LDP-EKVHVVYNGIDTKEYKPAADDDGNKVLDRYGIDRSRPYVLFV-G-RIT-RQKGVPHLL  240 (416)
T ss_pred             HHHCHHHHHCCCCC----CCC-CCEEEEECCCCHHHHCCCCCCCHHHHHHHHCCCCCCCEEEEE-E-EEE-CCCCHHHHH
T ss_conf             11033558315868----884-646888647645760688887411346632679988878985-2-020-316558999


Q ss_pred             HHHHHHHHCCCCCEEEECC----CCCHHHHHHHHHHHCCCC-CEE-E----EECCCCHHHHHHHHHHHCCC-----HHHH
Q ss_conf             9998764027351262016----633688999999604888-505-5----20552035788763552331-----1566
Q gi|254780767|r  215 SAVASLVKRNPFFRFSLVT----VSSQENLVRCIVSKWDIS-PEI-I----IDKEQKKQVFMTCNAAMAAS-----GTVI  279 (383)
Q Consensus       215 ~~~~~l~~~~~~~~~~i~~----~~~~~~~~~~~~~~~~~~-~~i-~----~~~~~~~~~l~~sd~ai~~S-----GTaT  279 (383)
                      ++++.+.+   +.|.++.+    +|+..+.++..+++...+ ..| .    +...+-.++++.|++=+|-|     |-+.
T Consensus       241 ~A~~~~~~---dvqvVLCAgapDTPEv~~Ev~~~~a~l~~~R~gv~WI~~ml~~~~~~~L~~~A~vFvCPSvYEPLGIvN  317 (416)
T TIGR02149       241 KAVHLISK---DVQVVLCAGAPDTPEVAEEVRQAVAKLDREREGVIWIEKMLPKEELVELLSNAEVFVCPSVYEPLGIVN  317 (416)
T ss_pred             HHHHHCCC---CCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHCCCEEECCCCCCCCCHHH
T ss_conf             99962552---035987067678720689999999988761698386356588789999984694786484425420556


Q ss_pred             HHHHHHCCCEEEECCCCCCEEEEE-----ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHH-
Q ss_conf             888762753025405774100001-----02467610230244078426124205489899999999984498999999-
Q gi|254780767|r  280 LELALCGIPVVSIYKSEWIVNFFI-----FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAM-  353 (383)
Q Consensus       280 LE~al~g~P~IV~Yk~~~lt~~i~-----~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~-  353 (383)
                      ||+|++++| ||.=+++.|-.-+.     .||...-      +.+-.-.|.  ..+.-.+.||++++.++.|++.-++| 
T Consensus       318 LEAMAC~tp-VVAS~~GGIpEVV~dg~TG~LV~~~~------lhdGtGtP~--d~d~f~~~LA~ai~~ll~dp~~A~k~G  388 (416)
T TIGR02149       318 LEAMACGTP-VVASAVGGIPEVVVDGETGFLVPIDD------LHDGTGTPD--DDDKFEADLAKAIDALLADPELAKKMG  388 (416)
T ss_pred             HHHHHCCCC-EEECCCCCCCCEEECCCCCCCCCCCC------CCCCCCCCC--CCCHHHHHHHHHHHHHHCCHHHHHHHC
T ss_conf             878850786-34403689552683374431247014------557788888--740568999999999742957898834


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             999999999838999989999999998
Q gi|254780767|r  354 LHGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       354 ~~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      .++.+...+.++...-|.++. ++-.+
T Consensus       389 ~aGr~R~~~~FSW~~iA~kT~-~~Y~~  414 (416)
T TIGR02149       389 EAGRKRAVEEFSWESIAKKTV-ELYRK  414 (416)
T ss_pred             HHHHHHHHHCCCHHHHHHHHH-HHHHH
T ss_conf             434655421257578999999-99874


No 74 
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology.  The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
Probab=98.50  E-value=3.7e-05  Score=54.01  Aligned_cols=218  Identities=16%  Similarity=0.155  Sum_probs=122.8

Q ss_pred             EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5999976821478999-999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    5 KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      ||+|+.-..=||+.-+ .++++||+++| +.++.-++.+..++. ++..-.++++-   ..+- +......+...++...
T Consensus         1 kILii~~~~iGD~i~~~p~i~~lk~~~P-~~~I~~l~~~~~~~l-~~~~p~id~vi---~~~~-~~~~~~~~~~~~~~~~   74 (279)
T cd03789           1 RILVIRLSWIGDVVLATPLLRALKARYP-DARITVLAPPWFAPL-LELMPEVDRVI---VLPK-KHGKLGLGARRRLARA   74 (279)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCC-CCEEEEEECHHHHHH-HHHCCCCCEEE---EECC-CCCCCCHHHHHHHHHH
T ss_conf             9899947850399999999999999887-998999989368999-96399857999---9535-4333478999999999


Q ss_pred             CCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEE
Q ss_conf             00128886898511776579999866301346311110022110036635579999986401567742232002553147
Q gi|254780767|r   84 IVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTT  163 (383)
Q Consensus        84 i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~  163 (383)
                      +++.+.|+++-.-.   +.+.+-.+..  .++|..+-       |+.                   +.. +         
T Consensus        75 l~~~~~D~~i~~~~---~~~~~~~~~~--~~~~~~~g-------~~~-------------------~~~-~---------  113 (279)
T cd03789          75 LRRRRYDLAIDLQG---SLRSALLPFL--AGAPRRIG-------FDG-------------------ERR-R---------  113 (279)
T ss_pred             HHHCCCCEEEECCC---CHHHHHHHHH--CCCCEEEE-------CCC-------------------HHH-C---------
T ss_conf             87649989998985---4589999998--49997996-------781-------------------342-0---------


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCC--CHHHHHHHHHHCCCCCEEEECCCCCHHHHH
Q ss_conf             638821122100135588897618765565059985387430123051--118999876402735126201663368899
Q gi|254780767|r  164 FVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILP--FFESAVASLVKRNPFFRFSLVTVSSQENLV  241 (383)
Q Consensus       164 fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP--~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~  241 (383)
                                           .......+++|++.|||+..  .+.+|  -+.+.++.+.++  ++++++...++..+..
T Consensus       114 ---------------------~~~~~~~~~~i~i~~ga~~~--~K~wp~~~~~~l~~~l~~~--~~~ivl~g~~~e~~~~  168 (279)
T cd03789         114 ---------------------GLLTDVVKPVVVLPPGASGP--AKRWPAERFAALADRLLAR--GARVVLTGGPAERELA  168 (279)
T ss_pred             ---------------------CCCCCCCCCEEEEECCCCCC--CCCCCHHHHHHHHHHHHHC--CCEEEEECCHHHHHHH
T ss_conf             ---------------------33114799989995898973--4579899999999999858--9959993486689999


Q ss_pred             HHHHHHCCCCCEEEE----ECCCCHHHHHHHHHHHCCC-HHHHHHHHHHCCCEEEECCC
Q ss_conf             999960488850552----0552035788763552331-15668887627530254057
Q gi|254780767|r  242 RCIVSKWDISPEIII----DKEQKKQVFMTCNAAMAAS-GTVILELALCGIPVVSIYKS  295 (383)
Q Consensus       242 ~~~~~~~~~~~~i~~----~~~~~~~~l~~sd~ai~~S-GTaTLE~al~g~P~IV~Yk~  295 (383)
                      +......+....+..    .-.+...+++.||+.|+.. |+.. =+|++|+|+|++|-.
T Consensus       169 ~~i~~~~~~~~~~~l~g~~sl~el~~li~~a~l~I~~DTg~~H-lAaa~~~p~i~ifG~  226 (279)
T cd03789         169 EEIAAALGGPRVVNLAGKTSLRELAALLARADLVVTNDSGPMH-LAAALGTPTVALFGP  226 (279)
T ss_pred             HHHHHHCCCCCEEECCCCCCHHHHHHHHHHCCEEEECCCHHHH-HHHHCCCCEEEEECC
T ss_conf             9999967999758368999999999999846833756877999-999849998999899


No 75 
>PRK10125 predicted glycosyl transferase; Provisional
Probab=98.37  E-value=0.00023  Score=48.75  Aligned_cols=183  Identities=10%  Similarity=-0.001  Sum_probs=94.6

Q ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHH
Q ss_conf             31476388211221001355888976187655650599853874301230511189998764027351262016633688
Q gi|254780767|r  160 PPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQEN  239 (383)
Q Consensus       160 ~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~  239 (383)
                      .+++-+-||+=...  .....+ ........+++.|+....+-..+.+. .-.+++++..+   ..+...++........
T Consensus       212 ~~v~vIpNgID~~~--~~~~~~-~~~~~~~~~~~~i~~~a~~~~~~~k~-~~~ll~~l~~l---~~~~~l~~~G~~~~~~  284 (405)
T PRK10125        212 GRCRIINNGIDMAT--EAILAE-LPPVRETQGKPRIAVVAHDLRYDGKT-DQQLVREMMAL---GDKIELHTFGKFSPFT  284 (405)
T ss_pred             CCEEEECCCCCCCC--CCCCHH-HHHHCCCCCCCEEEEEECCCCCCCHH-HHHHHHHHHHC---CCCEEEEEEECCCCCC
T ss_conf             98678389978543--444304-55404378997699995454456333-89999999844---8970899972576446


Q ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEE
Q ss_conf             999999604888505520552035788763552331-----156688876275302540577410000102467610230
Q gi|254780767|r  240 LVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALP  314 (383)
Q Consensus       240 ~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~Lp  314 (383)
                        ..   + -.....+....+..+++++||+-+..|     |++.+|++.+|+| ||.++++.+...+..  +.      
T Consensus       285 --~~---~-v~~lg~~~d~~~La~~YsaAd~~v~ps~~e~~~~~~~Ea~acg~p-vv~~~~~g~~~~~~~--~~------  349 (405)
T PRK10125        285 --AG---N-VVNHGFETDKRKLMSALNQMDALVFSSRVDNYPLILCEALSIGVP-VIATHSDAAREVLQK--SG------  349 (405)
T ss_pred             --CC---C-EEECCCCCCHHHHHHHHHHCCEEEECCHHHCCCHHHHHHHHCCCC-EEEECCCCCHHHEEC--CC------
T ss_conf             --88---7-464687589999999996378897274675465089999974998-898359997365115--87------


Q ss_pred             HHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             2440784261242054898999999999844989999999999999998389999899999999
Q gi|254780767|r  315 NLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIV  378 (383)
Q Consensus       315 Nii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I  378 (383)
                           --++     ..-..+.+++.+...+.+..+.....+..++..++..    ...+|.+.+
T Consensus       350 -----g~~~-----~~~d~~~la~~i~~~~~~~~~~~~~~~~~~~~~~~fs----~~~~a~~Y~  399 (405)
T PRK10125        350 -----GKTV-----SEEEVLQLAQLSKPEIAQAVFGTTLAEFSQRSRAAYS----GQQMLEEYV  399 (405)
T ss_pred             -----CEEE-----CCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCC----HHHHHHHHH
T ss_conf             -----4596-----6889999999899998460467789999999998679----999999999


No 76 
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
Probab=98.34  E-value=6.1e-05  Score=52.56  Aligned_cols=90  Identities=20%  Similarity=0.265  Sum_probs=62.9

Q ss_pred             HHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEE-----CCCCHHHHHHHHHHHCCC-----HH
Q ss_conf             30511189998764027351262016633688999999604888505520-----552035788763552331-----15
Q gi|254780767|r  208 KILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIID-----KEQKKQVFMTCNAAMAAS-----GT  277 (383)
Q Consensus       208 ~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~-----~~~~~~~l~~sd~ai~~S-----GT  277 (383)
                      +....+++++..+.++.++.++++.......+..............+...     .++....++.||+.+.+|     |.
T Consensus       117 K~~~~li~a~~~l~~~~~~~~l~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~v~pS~~E~~~~  196 (229)
T cd01635         117 KGLDDLIEAFALLKERGPDLKLVIAGDGPEREYLEELLAALLLLDRVIFLGGLDPEELLALLLAAADVFVLPSLREGFGL  196 (229)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHCCCCCCEEECCCCCCHHHHHHHHHHCCEEEECCCCCCCCH
T ss_conf             29999999999988678994899996880688999999972887746323622106789999970680660566678888


Q ss_pred             HHHHHHHHCCCEEEECCCCCC
Q ss_conf             668887627530254057741
Q gi|254780767|r  278 VILELALCGIPVVSIYKSEWI  298 (383)
Q Consensus       278 aTLE~al~g~P~IV~Yk~~~l  298 (383)
                      +.+|++.+|+|.| ++.....
T Consensus       197 ~~~EA~a~G~pvi-~~~~gg~  216 (229)
T cd01635         197 VVLEAMACGLPVI-ATDVGGP  216 (229)
T ss_pred             HHHHHHHCCCCEE-ECCCCCC
T ss_conf             9999998299899-8789983


No 77 
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
Probab=98.06  E-value=0.00024  Score=48.59  Aligned_cols=163  Identities=12%  Similarity=0.122  Sum_probs=99.2

Q ss_pred             HHHHHHHCCCCCCCCE-EEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHHHHCCCCCEEE
Q ss_conf             5888976187655650-59985387430123051118999876402735126201663--36889999996048885055
Q gi|254780767|r  179 YSQRNKQRNTPSQWKK-ILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS--SQENLVRCIVSKWDISPEII  255 (383)
Q Consensus       179 ~~~~~~~~~~~~~~~~-I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~--~~~~~~~~~~~~~~~~~~i~  255 (383)
                      +...++++|+..+... +.++- ||-.+ .+.+.++++++..+.++  +.+|++....  ..+..+......++.+....
T Consensus       281 k~~l~~~~gl~~d~~~pl~~~v-gRl~~-qKG~dll~~a~~~~~~~--~~~~vi~G~G~~~~e~~~~~l~~~~~~~~~~~  356 (476)
T cd03791         281 KAALQEELGLPVDPDAPLFGFV-GRLTE-QKGIDLLLEALPELLEL--GGQLVILGSGDPEYEEALRELAARYPGRVAVL  356 (476)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEE-ECCCC-CCCHHHHHHHHHHHHHC--CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999999598978998689994-23520-24899999999999963--98899994697789999999997689959999


Q ss_pred             EECCC--CHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHC
Q ss_conf             20552--035788763552331-----15668887627530254057741000010246761023024407842612420
Q gi|254780767|r  256 IDKEQ--KKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFN  328 (383)
Q Consensus       256 ~~~~~--~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ  328 (383)
                      ...++  ...+++.||+.++.|     |-+.||++.+|+|.|+ -+++.|.-.+.-.-...           +--.=|+-
T Consensus       357 ~~~~e~l~~~lya~aD~~l~PS~~EP~Gl~qleAm~~GtppIa-~~tGGL~dtV~d~~~~~-----------~~~tGf~f  424 (476)
T cd03791         357 IGYDEALAHLIYAGADFFLMPSRFEPCGLTQMYAMRYGTVPIV-RATGGLADTVIDYNEDT-----------GEGTGFVF  424 (476)
T ss_pred             EECCHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHCCCCEEE-CCCCCCCCEEECCCCCC-----------CCCCEEEE
T ss_conf             8068788999998499974255457854899999866997598-06999865100366677-----------77745886


Q ss_pred             CCCCHHHHHHHHHH---HHCCHHHHHHHHHHH
Q ss_conf             54898999999999---844989999999999
Q gi|254780767|r  329 SMIRSEALVRWIER---LSQDTLQRRAMLHGF  357 (383)
Q Consensus       329 ~~~~~~~i~~~~~~---ll~d~~~r~~~~~~~  357 (383)
                      +..+++.++.++.+   +.+|++..+++..+.
T Consensus       425 ~~~~~~~l~~ai~~al~~~~~~~~~~~l~~~a  456 (476)
T cd03791         425 EGYNADALLAALRRALALYRDPEAWRKLQRNA  456 (476)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             79999999999999999857999999999988


No 78 
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
Probab=98.04  E-value=0.0015  Score=43.45  Aligned_cols=255  Identities=16%  Similarity=0.222  Sum_probs=135.8

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHH--HHHHHHHHHHHHCCCCCCEEEE-CCC--------CC------------CCCCCC-
Q ss_conf             99998610012888689851177--6579999866301346311110-022--------11------------003663-
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPD--FTHRVAKRVRKKMPNLPIINYV-CPS--------VW------------AWREGR-  132 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pg--Fnl~lak~lkk~~~~ipvi~yv-~Pq--------vW------------AWr~~R-  132 (383)
                      +.-..+.+....||++  ||.-|  |.++++|.+.    ++||+.|+ -|+        |+            |++..+ 
T Consensus        96 ~~l~~eal~~~~pdvf--iDt~g~af~~pl~k~~~----~~~V~~Y~HyP~is~Dml~~v~~~~~~~nn~~~ia~~~~~s  169 (419)
T cd03806          96 MILGLEALLKLVPDIF--IDTMGYPFTYPLVRLLG----GCPVGAYVHYPTISTDMLQKVRSREASYNNSATIARSPVLS  169 (419)
T ss_pred             HHHHHHHHHHCCCCEE--EECCCCHHHHHHHHHCC----CCCEEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHCCCHHH
T ss_conf             9999999964699889--96786321678999737----98469997288762779998861232234202432232778


Q ss_pred             -HHHH------------HHHHHHHCCCCCCCHHHHHCCCC--CCEEECCCCCCCCCCCCCCHHHHHHHCCCC--CCCCEE
Q ss_conf             -5579------------99998640156774223200255--314763882112210013558889761876--556505
Q gi|254780767|r  133 -ARKM------------CAYINQVISILPFEKEVMQRLGG--PPTTFVGHPLSSSPSILEVYSQRNKQRNTP--SQWKKI  195 (383)
Q Consensus       133 -~k~~------------~~~~d~~~~ifpFE~~~f~k~~~--~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~--~~~~~I  195 (383)
                       +|.+            -++.|.+++.=-|-...+++.=+  .+++-| .|=.|.       +. .......  ...+.+
T Consensus       170 ~~K~lY~~~f~~ly~~~~~~ad~v~vNS~~T~~~i~~~w~~~~~~~Vv-YPP~d~-------~~-~~~~~~~~~~~~~~i  240 (419)
T cd03806         170 KAKLLYYRLFAFLYGLAGSFADVVMVNSTWTRNHIRSLWKRNTKPSIV-YPPCDV-------EE-LLKLPLDEKTRENQI  240 (419)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHCCCCCCCCC-CCCCCH-------HH-HCCCCCCCCCCCCEE
T ss_conf             999999999999999972577499985786999999983888886414-799776-------77-453665423576679


Q ss_pred             EEEECCCCCCHHHHCCCHHHHHHHHHHCCC-----CCEEEECCCC---CHHH---HHHHHHHHCCCCCEEEEE----CCC
Q ss_conf             998538743012305111899987640273-----5126201663---3688---999999604888505520----552
Q gi|254780767|r  196 LLLPGSRAQEIYKILPFFESAVASLVKRNP-----FFRFSLVTVS---SQEN---LVRCIVSKWDISPEIIID----KEQ  260 (383)
Q Consensus       196 ~llPGSR~~EI~~~lP~~l~~~~~l~~~~~-----~~~~~i~~~~---~~~~---~~~~~~~~~~~~~~i~~~----~~~  260 (383)
                      .-+  +| =|=+++.++.+++..++.++.+     +.+.+++...   +..+   .++....+.+++.+|.+.    .++
T Consensus       241 lSi--~r-frpeKn~~L~i~af~~l~~~~~~~~~~~~~Lvi~Gg~R~~ed~~~~~~L~~la~~l~l~~~V~f~~~~s~~e  317 (419)
T cd03806         241 LSI--AQ-FRPEKNHPLQLRAFAKLLKRLPEEIKEKIKLVLIGSCRNEDDEKRVEDLKLLAKELGLEDKVEFVVNAPFEE  317 (419)
T ss_pred             EEE--EC-CCCCCCHHHHHHHHHHHHHHCCHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHH
T ss_conf             998--64-554568699999999998746301056855999948876556999999999999729988769981599899


Q ss_pred             CHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHH
Q ss_conf             035788763552331-----156688876275302540577410000102467610230244078426124205489899
Q gi|254780767|r  261 KKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEA  335 (383)
Q Consensus       261 ~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~  335 (383)
                      ..+.|+.|.+.|-|-     |-+.+|+++.|+|+|+.=.-+|..-.+.-.            .+.+  .=|+-+  +++.
T Consensus       318 ~~~lL~~a~~~l~T~~nEHFGI~pVEaMaaG~pvvA~nSGGP~edIV~~~------------~~~~--tGfL~~--~~~e  381 (419)
T cd03806         318 LLEELSTASIGLHTMWNEHFGIGVVEYMAAGLIPLAHASGGPLLDIVVPW------------DGGP--TGFLAS--TAEE  381 (419)
T ss_pred             HHHHHHHCEEEEECCCCCCCCCHHHHHHHCCCCEEEECCCCCCCCEEEEC------------CCCC--CCCCCC--CHHH
T ss_conf             99999739798855732566858999986699579978889753077605------------8998--511279--8799


Q ss_pred             HHHHHHHHHCCH-HHHHHHHHHHHHHHHHHC
Q ss_conf             999999984498-999999999999999838
Q gi|254780767|r  336 LVRWIERLSQDT-LQRRAMLHGFENLWDRMN  365 (383)
Q Consensus       336 i~~~~~~ll~d~-~~r~~~~~~~~~~~~~Lg  365 (383)
                      -++++.++++.+ +.+.++..+.+...++.+
T Consensus       382 ~a~a~~~~l~~~~~~~~~~~~~ar~~~~rFS  412 (419)
T cd03806         382 YAEAIEKILSLSEEERLRIRRAARSSVKRFS  412 (419)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             9999999981998789999999999998468


No 79 
>pfam01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
Probab=97.72  E-value=0.00051  Score=46.49  Aligned_cols=103  Identities=17%  Similarity=0.253  Sum_probs=65.4

Q ss_pred             CCCCCEEEEEECCCCCCHHHHCC--CHHHHHHHHHHCCCCCEEEECCCCCH-HHHH-HHHHHHCCCCCEEEE---ECCCC
Q ss_conf             65565059985387430123051--11899987640273512620166336-8899-999960488850552---05520
Q gi|254780767|r  189 PSQWKKILLLPGSRAQEIYKILP--FFESAVASLVKRNPFFRFSLVTVSSQ-ENLV-RCIVSKWDISPEIII---DKEQK  261 (383)
Q Consensus       189 ~~~~~~I~llPGSR~~EI~~~lP--~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~-~~~~~~~~~~~~i~~---~~~~~  261 (383)
                      ..++++|++.|||+..  .+.+|  -|.+.++.+.+++  ..+++...++. +... +..............   .-.+.
T Consensus       104 ~~~~~~i~i~pga~~~--~K~Wp~e~f~~L~~~l~~~~--~~vvl~gg~~~~e~~~~~~i~~~~~~~~~~l~g~~sL~el  179 (249)
T pfam01075       104 NGGRPYIAFCPGASRP--AKRWPAEHFAELAQALQERG--WQVVLFGGAEDREEEIAKRLAAGLRTPCVNLLGKTSLEQA  179 (249)
T ss_pred             CCCCCEEEEECCCCCC--CCCCCHHHHHHHHHHHHHCC--CCEEEEECCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHH
T ss_conf             2599989997387885--67799999999999999669--9569973867899999999986389986862699999999


Q ss_pred             HHHHHHHHHHHCC-CHHHHHHHHHHCCCEEEECCCC
Q ss_conf             3578876355233-1156688876275302540577
Q gi|254780767|r  262 KQVFMTCNAAMAA-SGTVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       262 ~~~l~~sd~ai~~-SGTaTLE~al~g~P~IV~Yk~~  296 (383)
                      -.+++.||+.|+. ||... =++++|+|+|.+|-.+
T Consensus       180 ~ali~~a~l~I~nDSGp~H-iAaA~g~Pti~ifGpT  214 (249)
T pfam01075       180 AALLAGADLVVGNDSGLMH-LAAALDRPVIGLYGPT  214 (249)
T ss_pred             HHHHHHCCEEEECCCHHHH-HHHHCCCCEEEEECCC
T ss_conf             9999850668857985999-9998399889997889


No 80 
>pfam00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase.
Probab=97.71  E-value=0.0052  Score=39.83  Aligned_cols=105  Identities=12%  Similarity=0.009  Sum_probs=62.9

Q ss_pred             CCCHHHHHHH--HHHHCCCHHHHH-HHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHH
Q ss_conf             5203578876--355233115668-8876275302540577410000102467610230244078426124205489899
Q gi|254780767|r  259 EQKKQVFMTC--NAAMAASGTVIL-ELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEA  335 (383)
Q Consensus       259 ~~~~~~l~~s--d~ai~~SGTaTL-E~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~  335 (383)
                      -...++|++.  ++-|+-.|-.+. |++..|+|||++-=..= ...-++.+.-.-+|+.           +--.++|.++
T Consensus       331 ~PQ~dILaHp~vklFITHgG~~S~~Eai~~GVP~v~iP~f~D-Q~~Na~~~~~~G~g~~-----------l~~~~lt~~~  398 (501)
T pfam00201       331 LPQNDLLGHPKTRAFVTHAGSNGVYEAICHGVPMVGMPLFGD-QMDNAKHMEAKGAAVT-----------LNVLTMTSED  398 (501)
T ss_pred             CCHHHHHCCCCCEEEEECCCHHHHHHHHHCCCCEEEECCCCC-HHHHHHHHHHCCCEEE-----------EECCCCCHHH
T ss_conf             882667619871189965873069999985989897156344-6999999997797899-----------6321199999


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             9999999844989999999999999998389999899999999
Q gi|254780767|r  336 LVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIV  378 (383)
Q Consensus       336 i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I  378 (383)
                      +.+++.++++|+.++++...-.+-++++   +-.+-++|...+
T Consensus       399 l~~ai~~vl~n~~Y~~na~~~s~~~~d~---P~~p~~~av~w~  438 (501)
T pfam00201       399 LLNALKTVINDPSYKENIMRLSSIHHDQ---PVKPLDRAVFWI  438 (501)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHHHHCC---CCCHHHHHHHHH
T ss_conf             9999999970988999999999998659---999899999999


No 81 
>pfam04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerisation of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
Probab=97.60  E-value=0.0016  Score=43.26  Aligned_cols=179  Identities=11%  Similarity=0.085  Sum_probs=95.7

Q ss_pred             HHHCCCCCCCCEEEEEECCCCCCHHHH----CCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             976187655650599853874301230----5111899987640273512620166336889999996048885055205
Q gi|254780767|r  183 NKQRNTPSQWKKILLLPGSRAQEIYKI----LPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDK  258 (383)
Q Consensus       183 ~~~~~~~~~~~~I~llPGSR~~EI~~~----lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~  258 (383)
                      ++++|+++++++|+..|-=|...-...    .+.-.+.+.+..++  ++.+++=.-+.........  ............
T Consensus         2 k~~lgl~~~kkvILYaPT~R~~~~~~~~~~~~~~~~~~l~~~l~~--n~~liik~Hp~~~~~~~~~--~~~~~~~~~~~~   77 (186)
T pfam04464         2 REELGIPKDKKVILYAPTFRDDGYYSAGSILFNLDLEKLLEKLGE--NYVILVKLHPLVSNSIINK--RYDSDVIDVSDY   77 (186)
T ss_pred             HHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCC--CEEEEEEECHHHHCCHHHH--CCCCCEEECCCC
T ss_conf             264199998979998697338866554443230139999987276--8399997266764000220--257767978898


Q ss_pred             CCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHH
Q ss_conf             52035788763552331156688876275302540577410000102467610230244078426124205489899999
Q gi|254780767|r  259 EQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVR  338 (383)
Q Consensus       259 ~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~  338 (383)
                      .+.+++|..||+.|+=--++..|.++++.| ||.|.-.+=.|.-.+-.-..+   ....-|..        --+.+.+..
T Consensus        78 ~di~~ll~~aDiLITDYSSi~fD~lll~kP-ii~~~~D~~~Y~~~rg~~~d~---~~~~~g~~--------v~~~~eL~~  145 (186)
T pfam04464        78 SDIQDLFLASDILITDYSSVFFDFALLDKP-IIFYAPDLEEYRELRGFYFDY---EKEAPGPV--------VKTFEELLD  145 (186)
T ss_pred             CCHHHHHHHHCEEEEEHHHHHHHHHHHCCC-EEEEECCHHHHHHCCCCCCCH---HHCCCCCE--------ECCHHHHHH
T ss_conf             589999998436776468899999987997-899818789997525861058---78078762--------598999999


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHC--CCCCHHHHHHHHHHH
Q ss_conf             999984498999999999999999838--999989999999998
Q gi|254780767|r  339 WIERLSQDTLQRRAMLHGFENLWDRMN--TKKPAGHMAAEIVLQ  380 (383)
Q Consensus       339 ~~~~ll~d~~~r~~~~~~~~~~~~~Lg--~~~~a~~~AA~~I~~  380 (383)
                      ++...+.++....   +..++..+++.  ..|.+++++++.|.+
T Consensus       146 ~i~~~~~~~~~~~---~~~~~~~~~~~~~~DG~s~eRv~~~I~~  186 (186)
T pfam04464       146 ALKNYMENDEEYA---EKRRAFRDKFFPYDDGKSSERVLNRIFK  186 (186)
T ss_pred             HHHHHHHCCHHHH---HHHHHHHHHHCCCCCCCHHHHHHHHHHC
T ss_conf             9999875776779---9999999982887588089999999839


No 82 
>pfam03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
Probab=97.41  E-value=0.00089  Score=44.87  Aligned_cols=106  Identities=15%  Similarity=0.242  Sum_probs=70.2

Q ss_pred             EEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECC-HHHHHCCCEEEECHHHCCEEE----HHHHHHHHHHHHHHHHH
Q ss_conf             999976821478999-999999973899839999717-899947880650444531101----36746645999999999
Q gi|254780767|r    6 IAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGG-PSLQKEGLVSLFDFSELSVIG----IMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         6 i~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG-~~m~~~G~~~~~~~~~l~v~G----~~evl~~~~~~~~~~~~   79 (383)
                      |++++|.+.||++.+ .|.++|+++ ++++.   +|. ++|++.=.+.-+++..++.-|    .+..++...++.+.+.+
T Consensus         1 Ilia~GGTGGHv~Palala~~L~~~-g~~v~---igt~~~~e~~v~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~   76 (136)
T pfam03033         1 VLLAGGGTRGHVFPAVALAWALRRR-GHEVR---LGTPPGLEEFVEEAGLPFVPIGGDGLRRKSLKNLKEPLEGGRALRQ   76 (136)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHC-CCEEE---ECCCCCHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9899441579999999999999985-99771---2158028888753598189962798546759999999999999999


Q ss_pred             HHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCC-EE
Q ss_conf             9861001288868985-1177657999986630134631-11
Q gi|254780767|r   80 TVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPI-IN  119 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipv-i~  119 (383)
                      ....+++.+||+||.. .|+.+-.-+|.++.    ++|+ +|
T Consensus        77 ~~~~l~~~kp~~vig~GGy~s~p~~~aa~~~----~ip~~ih  114 (136)
T pfam03033        77 AKEILKEFKPDLVIGFGGYVAVPALIAAPLA----GIPLIVH  114 (136)
T ss_pred             HHHHHHHCCCCEEECCCCCCCHHHHHHHHHC----CCCEEEE
T ss_conf             9999985699889743885422899999983----9988998


No 83 
>pfam06258 DUF1022 Protein of unknown function (DUF1022). This family consists of several hypothetical eukaryotic and prokaryotic proteins. The function of this family is unknown.
Probab=97.29  E-value=0.0071  Score=38.94  Aligned_cols=224  Identities=13%  Similarity=0.109  Sum_probs=108.0

Q ss_pred             ECHHHCCEEEHHHHHHHH--HHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHC-CCCCCEEEECCCCCCCC
Q ss_conf             044453110136746645--999999999986100128886898511776579999866301-34631111002211003
Q gi|254780767|r   53 FDFSELSVIGIMQVVRHL--PQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKM-PNLPIINYVCPSVWAWR  129 (383)
Q Consensus        53 ~~~~~l~v~G~~evl~~~--~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~-~~ipvi~yv~PqvWAWr  129 (383)
                      +...++.+..++..++.+  +........-...+..-.||++|..--  -....+..+|++. .++.+||.--|.++.  
T Consensus        18 ~~~~~i~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~p~PdliIs~Gr--~t~~~~~~lkr~~~~~~~~I~i~~P~~~~--   93 (308)
T pfam06258        18 YEIREVRVRKPWRWLPRRLPAPLWAILGPFAPALEPPWPDLVIGAGR--QTHPLLRLLRRLSGGKTKTVQIMDPRLPL--   93 (308)
T ss_pred             CEEEEEECCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCEEEECCC--HHHHHHHHHHHHCCCCCEEEEEECCCCCC--
T ss_conf             71799952867775676578504554234541115899988997881--47999999999749996799981899881--


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCCC--CCCCCCCCCCHHHHHHHCCCCCCCCEEE-EEECCCCC-C
Q ss_conf             663557999998640156774223200255314763882--1122100135588897618765565059-98538743-0
Q gi|254780767|r  130 EGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHP--LSSSPSILEVYSQRNKQRNTPSQWKKIL-LLPGSRAQ-E  205 (383)
Q Consensus       130 ~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHP--l~d~~~~~~~~~~~~~~~~~~~~~~~I~-llPGSR~~-E  205 (383)
                              +.+|.+++  | |.+-..+-.| -....|-|  +.+.- .......+ .+.... .++.++ |..|+-+. .
T Consensus        94 --------~~FDliv~--P-~HD~~~~g~N-Vi~t~gal~~i~~~~-l~~~~~~~-~~~~~~-~~p~i~vLIGG~sk~~~  158 (308)
T pfam06258        94 --------GRFDLVIA--P-EHDGVPPGPN-VLLTVGALHRVTPQR-LAEAAAAW-PELAAL-PRPRVAVLVGGPSKHFR  158 (308)
T ss_pred             --------CCCCCEEC--C-CCCCCCCCCC-EEEECCCCCCCCHHH-HHHHHHHH-HHHCCC-CCCEEEEEECCCCCCCC
T ss_conf             --------34771025--7-4558889997-896257555478778-87777665-540247-78769999655787888


Q ss_pred             HHH-HCCCHHHHHHHHHHCCCCCEEEECCCC-CHHHHHHHHHHHCCCCCEEEEECCC----CHHHHHHHHHHHCCCHHHH
Q ss_conf             123-051118999876402735126201663-3688999999604888505520552----0357887635523311566
Q gi|254780767|r  206 IYK-ILPFFESAVASLVKRNPFFRFSLVTVS-SQENLVRCIVSKWDISPEIIIDKEQ----KKQVFMTCNAAMAASGTVI  279 (383)
Q Consensus       206 I~~-~lP~~l~~~~~l~~~~~~~~~~i~~~~-~~~~~~~~~~~~~~~~~~i~~~~~~----~~~~l~~sd~ai~~SGTaT  279 (383)
                      ... .+--+.+.+..+.+.+ +.++.+.... +-+...............+.+..+.    ....|+.||..++|+-.++
T Consensus       159 ~~~~~~~~l~~~i~~l~~~~-~~~l~it~SRRTP~~~~~~l~~~~~~~~~~~~~~~~~~Npy~~~L~~Ad~iiVT~DSvS  237 (308)
T pfam06258       159 WDADAARRLLEQLQALLEAY-GGSLLITTSRRTPEAAEAALRKLLGPRPGLYVWDGTGPNPYFGFLAWADAVVVTADSVS  237 (308)
T ss_pred             CCHHHHHHHHHHHHHHHHHC-CCEEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHCCEEEEECCHHH
T ss_conf             89999999999999999877-97299994688969999999986089972898279886458999985886899067188


Q ss_pred             H--HHHHHCCCEEEECCCCC
Q ss_conf             8--88762753025405774
Q gi|254780767|r  280 L--ELALCGIPVVSIYKSEW  297 (383)
Q Consensus       280 L--E~al~g~P~IV~Yk~~~  297 (383)
                      +  |++..|.|.-| +.+.+
T Consensus       238 MisEA~~tGkPV~i-~~l~~  256 (308)
T pfam06258       238 MVSEAAATGAPVGV-LPLEG  256 (308)
T ss_pred             HHHHHHHCCCCEEE-EECCC
T ss_conf             99999864997799-96776


No 84 
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane]
Probab=97.23  E-value=0.021  Score=35.83  Aligned_cols=256  Identities=16%  Similarity=0.160  Sum_probs=133.7

Q ss_pred             CEEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEE-HHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999-999999973899839999717899947880650444531101-3674664599999999998
Q gi|254780767|r    4 LKIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIG-IMQVVRHLPQFIFRINQTV   81 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G-~~evl~~~~~~~~~~~~~~   81 (383)
                      |||+.++-.--|..|-+ .|.+.|-. ..+.....+-                ..++-.- ||-..--++-....+....
T Consensus         1 ~ki~aisD~RtGnt~QaiaLa~~l~r-~eyttk~l~~----------------~~l~~lP~~wl~~yp~~~~~~l~~~~~   63 (329)
T COG3660           1 MKIWAISDGRTGNTHQAIALAEQLTR-SEYTTKLLEY----------------NNLAKLPNFWLAYYPIHILRELFGPRL   63 (329)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEEEC----------------CCCCCCCHHHHHCCCCHHHHHHHCCCC
T ss_conf             93489615877638999999998604-6437899512----------------200127446651276276787636700


Q ss_pred             HHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHH----C
Q ss_conf             6100128886898511776-5799998663013463111100221100366355799999864015677422320----0
Q gi|254780767|r   82 ELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQ----R  156 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~----k  156 (383)
                      ..-.+.+||++|..   |+ ...++-++||+.-|++++|.--|.+    +.|      .+|.+++  | +.++-+    +
T Consensus        64 ~r~p~~~Pdl~I~a---Grrta~l~~~lkk~~~~~~vVqI~~Prl----p~~------~fDlviv--p-~HD~~~~~s~~  127 (329)
T COG3660          64 SRKPEQRPDLIITA---GRRTAPLAFYLKKKFGGIKVVQIQDPRL----PYN------HFDLVIV--P-YHDWREELSDQ  127 (329)
T ss_pred             CCCCCCCCCEEEEC---CCCHHHHHHHHHHHCCCCEEEEEECCCC----CCC------CCEEEEC--C-CHHHHHHHHCC
T ss_conf             01755798558861---5210078999998618953899507999----853------0217842--6-02466653115


Q ss_pred             CCCCCEEECC--CCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEEC-CCCCCHHHHCCCHHHHHHHHHHCC--CCCEEEE
Q ss_conf             2553147638--8211221001355888976187655650599853-874301230511189998764027--3512620
Q gi|254780767|r  157 LGGPPTTFVG--HPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPG-SRAQEIYKILPFFESAVASLVKRN--PFFRFSL  231 (383)
Q Consensus       157 ~~~~~~~fVG--HPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPG-SR~~EI~~~lP~~l~~~~~l~~~~--~~~~~~i  231 (383)
                      .+++ -.-+|  |++.+..  ....-+..+.+. +..++.+++|=| +-++ -..+=..-.+.+..+.+..  -...|++
T Consensus       128 ~~Ni-lpi~Gs~h~Vt~~~--lAa~~e~~~~~~-p~~rq~vAVlVGg~nk~-f~~~~d~a~q~~~~l~k~l~~~g~~~li  202 (329)
T COG3660         128 GPNI-LPINGSPHNVTSQR--LAALREAFKHLL-PLPRQRVAVLVGGNNKA-FVFQEDKAHQFASLLVKILENQGGSFLI  202 (329)
T ss_pred             CCCE-EECCCCCCCCCHHH--HHHHHHHHHHHC-CCCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             7845-54268877565777--564588878637-78774499996678877-7667789999999999998747851899


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEEEC------CCCHHHHHHHHHHHCCCHHHHH--HHHHHCCCEEEECCCCC
Q ss_conf             166336889999996048885055205------5203578876355233115668--88762753025405774
Q gi|254780767|r  232 VTVSSQENLVRCIVSKWDISPEIIIDK------EQKKQVFMTCNAAMAASGTVIL--ELALCGIPVVSIYKSEW  297 (383)
Q Consensus       232 ~~~~~~~~~~~~~~~~~~~~~~i~~~~------~~~~~~l~~sd~ai~~SGTaTL--E~al~g~P~IV~Yk~~~  297 (383)
                      ....-..+..++.+++.-.....+...      ....+.|+++|.-|++.-.+++  |+|..|.|.-+.|-.++
T Consensus       203 sfSRRTp~~~~s~l~~~l~s~~~i~w~~~d~g~NPY~~~La~Adyii~TaDSinM~sEAasTgkPv~~~~~~~~  276 (329)
T COG3660         203 SFSRRTPDTVKSILKNNLNSSPGIVWNNEDTGYNPYIDMLAAADYIISTADSINMCSEAASTGKPVFILEPPNF  276 (329)
T ss_pred             EEECCCCHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHCCEEEEECCHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             96068917899999713566844573798789881688885213378704301245787604997599806986


No 85 
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type; InterPro: IPR011835    This family consists of glycogen (or starch) synthases that use ADP-glucose (2.4.1.21 from EC), rather than UDP-glucose (2.4.1.11 from EC) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate.; GO: 0009011 starch synthase activity, 0009250 glucan biosynthetic process.
Probab=96.91  E-value=0.041  Score=33.91  Aligned_cols=304  Identities=15%  Similarity=0.139  Sum_probs=177.7

Q ss_pred             CEEEEEECCHH-HHHCCCEEEECHHHCCEE-EHHHHHHHHHHHHHHHHHHHHHC----CCCCCC-EEEEECHHHHHHHHH
Q ss_conf             83999971789-994788065044453110-13674664599999999998610----012888-689851177657999
Q gi|254780767|r   33 PINLVGVGGPS-LQKEGLVSLFDFSELSVI-GIMQVVRHLPQFIFRINQTVELI----VSSKPD-VLLIVDNPDFTHRVA  105 (383)
Q Consensus        33 ~~~~~giGG~~-m~~~G~~~~~~~~~l~v~-G~~evl~~~~~~~~~~~~~~~~i----~~~~Pd-~vi~iD~pgFnl~la  105 (383)
                      ++.++-|+.+. .-..+-+...|.+   -- +..|-..++-.|-+..-++...+    ..++|| +|.+=|..-=  -+.
T Consensus        87 ~~~~yfi~~~~~~f~R~~~~Ygd~~---g~~d~~D~~~RF~~F~~Aa~e~~~~~~~~~~~~~PDN~vH~HDWhta--L~P  161 (517)
T TIGR02095        87 GVPVYFIDNPSNLFDRPGRIYGDDN---GQPDYPDNAERFAFFSRAAAELLSGLLLLPLGWQPDNVVHAHDWHTA--LVP  161 (517)
T ss_pred             CEEEEEECCHHHHCCCCCCCCCCCC---CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCHHHH--HHH
T ss_conf             7149996071551468686548888---87578750899999999999997412123344688807996576899--999


Q ss_pred             HHHHHHC-----CCCCCE---E------EECC-CCCCC--------------------CCCCHHHHH---HHHHHHCCCC
Q ss_conf             9866301-----346311---1------1002-21100--------------------366355799---9998640156
Q gi|254780767|r  106 KRVRKKM-----PNLPII---N------YVCP-SVWAW--------------------REGRARKMC---AYINQVISIL  147 (383)
Q Consensus       106 k~lkk~~-----~~ipvi---~------yv~P-qvWAW--------------------r~~R~k~~~---~~~d~~~~if  147 (383)
                      -++|...     ..+|++   |      ..++ +.-.|                    ..+++..||   .+.|++-+.=
T Consensus       162 ~llk~~~~~~~f~~~~~v~TIHNl~yQG~fp~~~~~~~~glp~~~~~~~~~e~~D~p~~~~~~nflKgGi~~ad~vtTVS  241 (517)
T TIGR02095       162 ALLKEVYRNNGFKRIKTVFTIHNLAYQGVFPAGDLFSLLGLPPELFHMEGLEFRDNPVNYGRLNFLKGGIVYADRVTTVS  241 (517)
T ss_pred             HHHHHHCCCCCCCCCCEEEEEECHHHCCCCCHHHHHHHHCCCHHHCCCCCHHCCCCCCCCCHHHHHHHHHHCCCCCCCCC
T ss_conf             99997405688834546787403212667887899876278866817410110568857861777767873488103786


Q ss_pred             CCCHHHHHC----------------------------CCCCCEEECCCCCCCCC-------------CCCCC-HHHHHHH
Q ss_conf             774223200----------------------------25531476388211221-------------00135-5888976
Q gi|254780767|r  148 PFEKEVMQR----------------------------LGGPPTTFVGHPLSSSP-------------SILEV-YSQRNKQ  185 (383)
Q Consensus       148 pFE~~~f~k----------------------------~~~~~~~fVGHPl~d~~-------------~~~~~-~~~~~~~  185 (383)
                      |=    |.+                            .+|+++. +=||-.|..             ...++ +....++
T Consensus       242 Pt----YA~EI~t~pe~G~gL~g~l~~~~~~~~l~GIlNGID~~-~WNP~tD~~L~~~Ys~~~~D~~~K~~ncK~aLq~~  316 (517)
T TIGR02095       242 PT----YAREILTPPEFGCGLDGVLKARVRSGKLRGILNGIDTE-VWNPATDPYLKANYSADDLDLSGKAKNCKEALQEE  316 (517)
T ss_pred             HH----HHHHHCCCCCCCCCHHHHHHHHHCCCCCCEEECCCCCC-CCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHH
T ss_conf             06----89972688444524699984032057731133233434-46853254334357843215666788758999998


Q ss_pred             CCCCCC-CCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHH--HHCCCCCEEEEECCC
Q ss_conf             187655-65059985387430123051118999876402735126201663--3688999999--604888505520552
Q gi|254780767|r  186 RNTPSQ-WKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS--SQENLVRCIV--SKWDISPEIIIDKEQ  260 (383)
Q Consensus       186 ~~~~~~-~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~--~~~~~~~~~~--~~~~~~~~i~~~~~~  260 (383)
                      +|++.+ +..-++---||-.+ .+-.+++++++.++.++....||++..+.  +.++.++...  .+++.+..+.+..++
T Consensus       317 lGL~~~Y~~~Pl~~~isRL~~-QKG~Dl~~~a~~~ll~~~~~~Qlv~lG~Gdp~le~~l~~la~~~~~p~~~~~~~~yde  395 (517)
T TIGR02095       317 LGLPVDYDDVPLFGVISRLVE-QKGVDLLLAALPELLELGDFGQLVVLGTGDPELEEALRELADHERYPGKVRVIIGYDE  395 (517)
T ss_pred             HCCCCCCCCCCEEEEEECCCC-CCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEEECCH
T ss_conf             198878888537999822562-4427899999999971179668999704887999999999999637894899962587


Q ss_pred             --CHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCH
Q ss_conf             --035788763552331-----1566888762753025405774100001024676102302440784261242054898
Q gi|254780767|r  261 --KKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRS  333 (383)
Q Consensus       261 --~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~  333 (383)
                        ++.+++.||+-|+.|     |=.=|.++-.|++-||- +|+.|.=-+.      -.+-.|.=+=.+.--=|..++.++
T Consensus       396 ~LAh~iyAgaD~~lmPSrFEPCGL~Ql~amRYGt~PiVr-~tGGL~DTV~------d~~~~~~~aP~~~~tGF~F~~~~~  468 (517)
T TIGR02095       396 ALAHRIYAGADFFLMPSRFEPCGLTQLYAMRYGTVPIVR-RTGGLADTVV------DADPENLAAPAGSGTGFLFEEYDP  468 (517)
T ss_pred             HHHHHHHHCCCEEECCCCCCCCHHHHHHHHHCCCCEEEE-CCCCCCEEEE------CCCCCCCCCCCCCCCCEEECCCCH
T ss_conf             999989723776880785573125799897349953871-5889520100------387764447787765417236888


Q ss_pred             HHHHHHHHHH---HC-CHHHHHHHH
Q ss_conf             9999999998---44-989999999
Q gi|254780767|r  334 EALVRWIERL---SQ-DTLQRRAML  354 (383)
Q Consensus       334 ~~i~~~~~~l---l~-d~~~r~~~~  354 (383)
                      +.+..++.+=   +. +++.-+++.
T Consensus       469 ~~L~~a~~rAl~lY~~~~~~w~~l~  493 (517)
T TIGR02095       469 EALLAALSRALRLYRQDPELWKALQ  493 (517)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             9999999999998723978999999


No 86 
>KOG1111 consensus
Probab=96.77  E-value=0.0063  Score=39.25  Aligned_cols=106  Identities=18%  Similarity=0.282  Sum_probs=80.7

Q ss_pred             CCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEE----ECCCCHHHH
Q ss_conf             5565059985387430123051118999876402735126201663368899999960488850552----055203578
Q gi|254780767|r  190 SQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIII----DKEQKKQVF  265 (383)
Q Consensus       190 ~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~----~~~~~~~~l  265 (383)
                      ++..++.+---||- =-++-...+++.+.++.+++|+.+|++..-......+++..+++..+-.+..    ..++-.++|
T Consensus       191 ~S~~i~~ivv~sRL-vyrKGiDll~~iIp~vc~~~p~vrfii~GDGPk~i~lee~lEk~~l~~rV~~lG~v~h~~Vr~vl  269 (426)
T KOG1111         191 PSADIITIVVASRL-VYRKGIDLLLEIIPSVCDKHPEVRFIIIGDGPKRIDLEEMLEKLFLQDRVVMLGTVPHDRVRDVL  269 (426)
T ss_pred             CCCCEEEEEEEEEE-EECCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHH
T ss_conf             88870699997411-11242678999999997359873699956886502199999985004805886146617888887


Q ss_pred             HHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCC
Q ss_conf             8763552331-----1566888762753025405774
Q gi|254780767|r  266 MTCNAAMAAS-----GTVILELALCGIPVVSIYKSEW  297 (383)
Q Consensus       266 ~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~  297 (383)
                      .+-|.-+-+|     |++-+|+|-+|.| ||.-+.+.
T Consensus       270 ~~G~IFlntSlTEafc~~ivEAaScGL~-VVsTrVGG  305 (426)
T KOG1111         270 VRGDIFLNTSLTEAFCMVIVEAASCGLP-VVSTRVGG  305 (426)
T ss_pred             HCCCEEECCHHHHHHHHHHHHHHHCCCE-EEEEECCC
T ss_conf             6385796207888889999998707977-99751488


No 87 
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane]
Probab=96.74  E-value=0.04  Score=33.96  Aligned_cols=224  Identities=11%  Similarity=0.037  Sum_probs=117.8

Q ss_pred             HHHHCCCCCCCHHHHHCCCCC---CEEECCCCCCCCCCCCCC----HHHHHHHCCCCCCCCEEEEEECCCCCC-----HH
Q ss_conf             986401567742232002553---147638821122100135----588897618765565059985387430-----12
Q gi|254780767|r  140 INQVISILPFEKEVMQRLGGP---PTTFVGHPLSSSPSILEV----YSQRNKQRNTPSQWKKILLLPGSRAQE-----IY  207 (383)
Q Consensus       140 ~d~~~~ifpFE~~~f~k~~~~---~~~fVGHPl~d~~~~~~~----~~~~~~~~~~~~~~~~I~llPGSR~~E-----I~  207 (383)
                      .|...+--|++...|++.-|+   +..=.|+|..|.......    .......++++.++++|+--|-=|.++     -.
T Consensus       149 ~dy~~~~~~~~~~if~~~f~~~~~~i~~~G~Pr~D~~~~~~~~~~~~~~~~~~~~~~~~k~vIlyaPTfr~~~~~~~~~~  228 (388)
T COG1887         149 WDYLISPNPESTAIFAEAFNIDKENILETGYPRNDKLFDEAGKTEDILLIQLALPLPQDKKVILYAPTFRDNDVLIGTQF  228 (388)
T ss_pred             CCCEECCCCHHHHHHHHHHCCCCCCEEECCCCCCHHHHHHCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHH
T ss_conf             03031178106689998705330004433658505654412214667887760477555776996576578855433011


Q ss_pred             HHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEE-EEECCCCHHHHHHHHHHHCCCHHHHHHHHHHC
Q ss_conf             30511189998764027351262016633688999999604888505-52055203578876355233115668887627
Q gi|254780767|r  208 KILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEI-IIDKEQKKQVFMTCNAAMAASGTVILELALCG  286 (383)
Q Consensus       208 ~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i-~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g  286 (383)
                      ..+++-....+..... .++.+++-.-|-..+......  ...+... +....+..+++..||+.|+==-++-.|.+++.
T Consensus       229 ~~~~~~~~~~~~~l~~-~~~~ii~k~Hp~is~~~~~~~--~~~~~~~~vs~~~di~dll~~sDiLITDySSv~fdf~~l~  305 (388)
T COG1887         229 FNLDIDIEKLKEKLGE-NEYVIIVKPHPLISDKIDKRY--ALDDFVLDVSDNADINDLLLVSDILITDYSSVIFDFMLLD  305 (388)
T ss_pred             HCCHHHHHHHHHHHCC-CCEEEEEECCHHHCCCCHHHH--CCCCCEEECCCCHHHHHHHHHCCEEEECCCCHHHHHHHHC
T ss_conf             0001459999876166-876999955853404210002--0366046546634499998754888851630046688655


Q ss_pred             CCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53025405774100001024676102302440784261242054898999999999844989999999999999998389
Q gi|254780767|r  287 IPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNT  366 (383)
Q Consensus       287 ~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~  366 (383)
                      .|+ +.|..+.=.|.-.+-.--+|-        .+.-.|+++   |-.++.+++...+.+++.+..-...+.+..... .
T Consensus       306 KPi-ify~~D~~~y~~~rg~~~d~~--------~~~Pg~~~~---~~~~li~ai~~~~~~~~~~~~k~~~~~~~~~~~-~  372 (388)
T COG1887         306 KPI-IFYTYDLEQYDELRGFYLDYK--------FEAPGEVVE---TQEELIDAIKPYDEDGNYDLEKLRVFNDKFNSY-E  372 (388)
T ss_pred             CCE-EEEECCCHHHHHCCCHHHHHH--------HCCCCCHHC---CHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC-C
T ss_conf             967-999647047554011244577--------619951103---689999987753102215688898777775123-4


Q ss_pred             CCCHHHHHHHHHH
Q ss_conf             9998999999999
Q gi|254780767|r  367 KKPAGHMAAEIVL  379 (383)
Q Consensus       367 ~~~a~~~AA~~I~  379 (383)
                      .|.++++--+.+.
T Consensus       373 dg~ss~ri~~~i~  385 (388)
T COG1887         373 DGRSSERILKLIF  385 (388)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             7307789999985


No 88 
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II; InterPro: IPR011910    This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria.; GO: 0016757 transferase activity transferring glycosyl groups, 0009103 lipopolysaccharide biosynthetic process.
Probab=96.51  E-value=0.017  Score=36.35  Aligned_cols=313  Identities=14%  Similarity=0.154  Sum_probs=177.3

Q ss_pred             EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5999976821478999-999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    5 KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      ||+||+=-==||+-=| .|=+.||+++| ++.+.-+.=.--+-. ++.-=.+++.-.+    +++|=--=+....++-+.
T Consensus         1 kILvIGPsWVGDmvMaQ~Lf~~Lk~~yP-~~~IDV~APaW~~Pl-L~RMPEi~~~~~~----PlgHGaL~l~~R~rlg~~   74 (361)
T TIGR02195         1 KILVIGPSWVGDMVMAQSLFRLLKKRYP-DAVIDVLAPAWCKPL-LERMPEIRQAIDM----PLGHGALELTERYRLGKS   74 (361)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHHHH-HCCCCHHHHHHCC----CCCCCCCHHHHHHHHHHH
T ss_conf             9357438736555676899999998589-838972075330133-3127015787458----878762126767899999


Q ss_pred             CCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCC-CCCC-------------HHHHHHHHHHHCCCCCC
Q ss_conf             001288868985117765799998663013463111100221100-3663-------------55799999864015677
Q gi|254780767|r   84 IVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAW-REGR-------------ARKMCAYINQVISILPF  149 (383)
Q Consensus        84 i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAW-r~~R-------------~k~~~~~~d~~~~ifpF  149 (383)
                      ++.++.|-+|.         |=-.+|...  ||..==| |+=-=| |+-|             +|+.....=+-++-+=+
T Consensus        75 LR~~~YD~AiV---------LPNSlKSAL--iPfFA~I-P~RtGw~GEmRYGLLND~r~LdGkak~~~P~m~~rY~ALAy  142 (361)
T TIGR02195        75 LREERYDQAIV---------LPNSLKSAL--IPFFAGI-PLRTGWRGEMRYGLLNDIRALDGKAKERLPLMIERYIALAY  142 (361)
T ss_pred             HHHCCCCEEEE---------CCCCHHHHH--HHHHCCC-CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             97558988998---------677216676--3676188-61235563235666644220677111433579999998864


Q ss_pred             CHHHHHCCCCCCEEEC--CCCCCCCCCCCCCHHHHHHHCC----CCC-CCCEEEEEECCCCCCHHHHCCC--HHHHHHHH
Q ss_conf             4223200255314763--8821122100135588897618----765-5650599853874301230511--18999876
Q gi|254780767|r  150 EKEVMQRLGGPPTTFV--GHPLSSSPSILEVYSQRNKQRN----TPS-QWKKILLLPGSRAQEIYKILPF--FESAVASL  220 (383)
Q Consensus       150 E~~~f~k~~~~~~~fV--GHPl~d~~~~~~~~~~~~~~~~----~~~-~~~~I~llPGSR~~EI~~~lP~--~l~~~~~l  220 (383)
                      +++..++...++..|-  =.|-+.-  ....+.....+++    +.. ++|+|++.||+=..+-|| +|-  |.+.|+++
T Consensus       143 ~K~~i~~~~~LP~sf~plp~P~L~~--~~~~~~~~~~kF~k~taL~~P~rP~ialCPGAEfGpAKR-WP~~HyA~LA~~~  219 (361)
T TIGR02195       143 DKDVIQKGADLPESFQPLPRPQLQI--DPAEQAAALAKFGKQTALDTPERPIIALCPGAEFGPAKR-WPAEHYAELAKKL  219 (361)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEE--CHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC-CCHHHHHHHHHHH
T ss_conf             0344677655761011377745254--788999999985122126677887687587766775567-8538999999999


Q ss_pred             HHCCCCCEEEECCCCCHHHHHHH-HHHHCCCC-----CEE--EEECCCCHHHHHHHHHHHCC-CHHHHHHHHHHCCCEEE
Q ss_conf             40273512620166336889999-99604888-----505--52055203578876355233-11566888762753025
Q gi|254780767|r  221 VKRNPFFRFSLVTVSSQENLVRC-IVSKWDIS-----PEI--IIDKEQKKQVFMTCNAAMAA-SGTVILELALCGIPVVS  291 (383)
Q Consensus       221 ~~~~~~~~~~i~~~~~~~~~~~~-~~~~~~~~-----~~i--~~~~~~~~~~l~~sd~ai~~-SGTaTLE~al~g~P~IV  291 (383)
                      .... .+++++...+..+....+ +.+.....     .+.  .+.-++.-++++.|.++|+= ||=.. =+|.+++|.|-
T Consensus       220 ~~~G-gy~V~lFGS~kD~~~~~~fI~~~~~~~~~~~~~NLaG~T~L~EAvdLia~a~avV~NDSGLMH-VAAAL~rPlVA  297 (361)
T TIGR02195       220 IAQG-GYQVVLFGSKKDKPVGDEFIEALAPGELREYCDNLAGETSLDEAVDLIALAKAVVSNDSGLMH-VAAALNRPLVA  297 (361)
T ss_pred             HHCC-CCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCEEEECCHHHHH-HHHHCCCCEEE
T ss_conf             8706-918998428455789999999863446889974104788888999998715601215606799-99962798899


Q ss_pred             ECC------CCCCEEEE--EE---CCCCCCEEEEHHHCCCCCCCH-HHC--CCCCHHHHHHHHHHHH
Q ss_conf             405------77410000--10---246761023024407842612-420--5489899999999984
Q gi|254780767|r  292 IYK------SEWIVNFF--IF---YIKTWTCALPNLIVDYPLVPE-YFN--SMIRSEALVRWIERLS  344 (383)
Q Consensus       292 ~Yk------~~~lt~~i--~~---lik~~~i~LpNii~~~~ivPE-liQ--~~~~~~~i~~~~~~ll  344 (383)
                      +|=      |.||+..-  .+   +++.....-    .++.-.|+ ..|  .+.+|+.+..++.+++
T Consensus       298 lYGsTsP~fTPPLs~ka~~~~Gnal~~~~cspc----~~rk~c~~Gh~~cL~~l~P~~V~~~l~~Ll  360 (361)
T TIGR02195       298 LYGSTSPDFTPPLSEKAEVVRGNALLNLECSPC----FKRKECPYGHHQCLIDLSPEQVLEALEELL  360 (361)
T ss_pred             EECCCCCCCCCCHHHHCEEEECCCEECCCCCCC----CCCCCCCCCHHHHHHHCCHHHHHHHHHHHC
T ss_conf             736856888887444110013101006732454----356536511477886069889999999744


No 89 
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
Probab=96.29  E-value=0.046  Score=33.55  Aligned_cols=126  Identities=14%  Similarity=0.222  Sum_probs=81.6

Q ss_pred             HCCCHHHHHHHHHH------CCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEE-----ECCCCHHHHHHHHHHHCC---
Q ss_conf             05111899987640------2735126201663368899999960488850552-----055203578876355233---
Q gi|254780767|r  209 ILPFFESAVASLVK------RNPFFRFSLVTVSSQENLVRCIVSKWDISPEIII-----DKEQKKQVFMTCNAAMAA---  274 (383)
Q Consensus       209 ~lP~~l~~~~~l~~------~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~-----~~~~~~~~l~~sd~ai~~---  274 (383)
                      -+-++++|.+...+      ..|++.+++-.-...++...+.+++.... +|.+     ..++...++..||+.++-   
T Consensus       246 DF~iLl~AL~~Yd~~~~~~~~~p~ll~iITGKGP~K~~y~~~I~~~~l~-~V~i~t~wL~~eDYP~lL~~ADLGVsLHtS  324 (415)
T cd03816         246 DFGILLDALVAYEKSAATGPKLPKLLCIITGKGPLKEKYLERIKELKLK-KVTIRTPWLSAEDYPKLLASADLGVSLHTS  324 (415)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCC-CEEEEECCCCHHHHHHHHHCCCCCEEECCC
T ss_conf             5678999999997653214789987999968853089999999862888-219972578878899987415347242126


Q ss_pred             -CHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCC------CHHHHHHHHHHHHCC-
Q ss_conf             -115668887627530254057741000010246761023024407842612420548------989999999998449-
Q gi|254780767|r  275 -SGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMI------RSEALVRWIERLSQD-  346 (383)
Q Consensus       275 -SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~------~~~~i~~~~~~ll~d-  346 (383)
                       ||        +..||=|+=              .--.|||=+-.+.+.++||++++.      +++++++.+..++.| 
T Consensus       325 SSG--------lDLPMKVVD--------------MfG~GlPV~A~~f~~i~ELVk~~~NG~~F~~~~eL~~~l~~l~~~~  382 (415)
T cd03816         325 SSG--------LDLPMKVVD--------------MFGCGLPVCALDFKCIDELVKHGENGLVFGDSEELAEQLIDLLSNF  382 (415)
T ss_pred             CCC--------CCCCHHHHH--------------HCCCCCCEEEECCCCHHHHHCCCCCCCEECCHHHHHHHHHHHHHCC
T ss_conf             876--------677702101--------------0268875798337517877226878766578999999999998559


Q ss_pred             --HHHHHHHHHHH
Q ss_conf             --89999999999
Q gi|254780767|r  347 --TLQRRAMLHGF  357 (383)
Q Consensus       347 --~~~r~~~~~~~  357 (383)
                        .+..+.+++++
T Consensus       383 p~~~~l~~lk~~a  395 (415)
T cd03816         383 PNRGKLNSLKKGA  395 (415)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             9668999999777


No 90 
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB. The CsaB protein (cell surface anchoring B) of Bacillus anthracis adds a pyruvoyl group to peptidoglycan-associated polysaccharide. This addition is required for proteins with an S-layer homology domain (pfam00395) to bind. Within the larger group of proteins described by pfam04230, this model represents a distinct clade that nearly exactly follows the phylogenetic distribution of the S-layer homology domain (pfam00395).
Probab=95.85  E-value=0.17  Score=29.88  Aligned_cols=195  Identities=16%  Similarity=0.164  Sum_probs=97.9

Q ss_pred             CCCEEEE------ECHHHH-----HHHHHHHHHHHCCCCCCEEE---ECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHH
Q ss_conf             8886898------511776-----57999986630134631111---002211003663557999998640156774223
Q gi|254780767|r   88 KPDVLLI------VDNPDF-----THRVAKRVRKKMPNLPIINY---VCPSVWAWREGRARKMCAYINQVISILPFEKEV  153 (383)
Q Consensus        88 ~Pd~vi~------iD~pgF-----nl~lak~lkk~~~~ipvi~y---v~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~  153 (383)
                      +-|++|.      -|..++     -+.+...+|.  .|.|++.|   |.|--=-|.++-++.+-+.+|.+.+==+.-.++
T Consensus        64 ~~d~~I~GGG~llqD~ts~~s~~yy~~~~~la~~--~gkpv~~~gqgiGP~~~~~~r~l~r~~l~~~~~i~vRD~~S~~~  141 (298)
T TIGR03609        64 RADVVIWGGGSLLQDVTSFRSLLYYLGLMRLARL--FGKPVILWGQGIGPLRRRLSRWLVRRVLRGCRAISVRDAASYRL  141 (298)
T ss_pred             HCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH--CCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEECCHHHHHH
T ss_conf             7799998585414588754347899999999998--29988999426887678789999999984199999778888999


Q ss_pred             HHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             20025531476388211221001355888976187655650599853874301230511189998764027351262016
Q gi|254780767|r  154 MQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       154 f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      .++. |+++...+-|........  .     ......+++.|++-+=+-..-=......+.+++..+.++.......+|.
T Consensus       142 l~~l-Gv~~~l~~D~af~l~~~~--~-----~~~~~~~~~~i~v~~r~~~~~~~~~~~~~~~~l~~l~~~~g~~V~~lp~  213 (298)
T TIGR03609       142 LKRL-GIPAELAADPVWLLPPEP--W-----PGGEPLPEPVIVVSLRPWPLLDVSRLLRLLRALDRLQRDTGAFVLFLPF  213 (298)
T ss_pred             HHHC-CCCEEEECCEEECCCCCC--C-----CCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             9974-998489677132057755--4-----4444567998999978888789999999999999999835986999968


Q ss_pred             CCC-HHHHHHHHHHHCCCCCEEEEE--CCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEE
Q ss_conf             633-688999999604888505520--55203578876355233115668887627530254
Q gi|254780767|r  234 VSS-QENLVRCIVSKWDISPEIIID--KEQKKQVFMTCNAAMAASGTVILELALCGIPVVSI  292 (383)
Q Consensus       234 ~~~-~~~~~~~~~~~~~~~~~i~~~--~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~  292 (383)
                      ..+ .....+...........+...  ..+....++.||++|++-=-+..-+++.|+|+|.+
T Consensus       214 ~~~~D~~~~~~l~~~~~~~~~i~~~~~~~e~~~~i~~~~~vI~~RlH~~I~A~~~gvP~i~i  275 (298)
T TIGR03609       214 QQPQDLPLARALRDQLLGPAEVLSPLDPEELLGLFASARLVIGMRLHALILAAAAGVPFVAL  275 (298)
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHCCEEEEECCHHHHHHHHCCCCEEEE
T ss_conf             87854999999997578863653789999999999609989980708999999779998995


No 91 
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5.1.3.14 from EC catalyses the production of UDP-ManNAc from UDP-GlcNAc. Some of the enzymes is this family are bifunctional. In microorganisms the epimerase is involved in in the synthesis of the capsule precursor UDP-ManNAcA , . The protein from rat liver displays both epimerase and kinase activity .; GO: 0008761 UDP-N-acetylglucosamine 2-epimerase activity, 0006047 UDP-N-acetylglucosamine metabolic process, 0009103 lipopolysaccharide biosynthetic process.
Probab=95.71  E-value=0.19  Score=29.52  Aligned_cols=347  Identities=14%  Similarity=0.072  Sum_probs=190.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC-CHHHHHCCCEEEEC---HH-HCCEEEHHHHH-HHHHHHHHHH
Q ss_conf             4599997682147899999999997389983999971-78999478806504---44-53110136746-6459999999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG-GPSLQKEGLVSLFD---FS-ELSVIGIMQVV-RHLPQFIFRI   77 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG-G~~m~~~G~~~~~~---~~-~l~v~G~~evl-~~~~~~~~~~   77 (383)
                      ||+.++-|-..--+--+.+++++++.  |++++.-+- |.+-...-.+..++   +. .-.-+++...= .+-...-+..
T Consensus         1 ~~~~~~~g~~p~~~~~~p~~~~~~~~--p~~~~~~~~~~~h~~~~~~~~~~~~~~~~~p~~~~~~~~~g~~~~~~~~~~l   78 (380)
T TIGR00236         1 LKVLIVLGTRPEAIKLAPLIRALLKD--PGIDWKVLHTGQHRDEEMLDQVLDLFSLPNPDYDLNIGSPGQTLGEITGGLL   78 (380)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHC--CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             91255406762035665789998626--8852256750320014678999988622575444423576630477888888


Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC--CCCCCCCCCHHHHHHHHHHHCCC--CCCCHH-
Q ss_conf             9998610012888689851177657999986630134631111002--21100366355799999864015--677422-
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP--SVWAWREGRARKMCAYINQVISI--LPFEKE-  152 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P--qvWAWr~~R~k~~~~~~d~~~~i--fpFE~~-  152 (383)
                      ..+.+.+.+.+||+++.-  .+-|--+|..+-.-...+|+-|.-+-  +.-.+.++--..-+...+++..+  -|-|.. 
T Consensus        79 ~~~~~~~~~~~p~~~~~~--gd~~~~~~~~l~~~~~~~~~gh~~~gl~~~~~~~p~p~~~~~~~~~~~~~~~~~p~~~~~  156 (380)
T TIGR00236        79 EGLEELLLEEKPDVVLVQ--GDTTTTLAGALAAFYLQIPVGHVEAGLRTGDLYSPFPEELNRVLTGHIAKLHFAPTELAK  156 (380)
T ss_pred             HHHHHHHHHCCCCEEEEE--CCCHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             767888641488678971--662146777887776530101332011124455776056777898877764203215667


Q ss_pred             --HH-HCCCCCCEEECCCCCCCCCCCCCCHH-HHHHHCCCCC------CCCEEEEEECCCCCCHH--HHCCCHHHHHHHH
Q ss_conf             --32-00255314763882112210013558-8897618765------56505998538743012--3051118999876
Q gi|254780767|r  153 --VM-QRLGGPPTTFVGHPLSSSPSILEVYS-QRNKQRNTPS------QWKKILLLPGSRAQEIY--KILPFFESAVASL  220 (383)
Q Consensus       153 --~f-~k~~~~~~~fVGHPl~d~~~~~~~~~-~~~~~~~~~~------~~~~I~llPGSR~~EI~--~~lP~~l~~~~~l  220 (383)
                        .. +....-....+||-..|......... ......+...      .+..+.++-+.|...+.  .-+.-+++++..+
T Consensus       157 ~~l~~~~~~~~~~~~~g~~~~d~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~  236 (380)
T TIGR00236       157 ENLLREGVEPGKIFVTGNTVIDALLTNLEIAEPSSPVLSEFGENYPFVPDDRVLLLTLHRRENVGNPEPLENILEAILEI  236 (380)
T ss_pred             HHHHHCCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCEEEEEEHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             77763055545057622056777877665421015502342256773204544465400110467601468999999998


Q ss_pred             HHCCCCCEEEECCCCCHHHHHH--HHHHHCCCCCEEEEEC----CCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECC
Q ss_conf             4027351262016633688999--9996048885055205----520357887635523311566888762753025405
Q gi|254780767|r  221 VKRNPFFRFSLVTVSSQENLVR--CIVSKWDISPEIIIDK----EQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYK  294 (383)
Q Consensus       221 ~~~~~~~~~~i~~~~~~~~~~~--~~~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk  294 (383)
                      ...+++...+.|.-+.......  ......+...++.+..    -+....+..|.+.++-||-..-|+..+|.|.++.-.
T Consensus       237 ~~~~~~~~~~~p~h~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~l~d~gg~~~~~~~~~~p~~~~~~  316 (380)
T TIGR00236       237 LEEFPDVAIVFPVHPNPKVREPEFGLYKALGDAKRVFLIEPLGYLDFLLLLSNAYLILTDSGGLQEEAPSLGKPVLVLRD  316 (380)
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHCCEEEEECCCCCCHHHHHCCCCEEEEEC
T ss_conf             74124303566214564210023104666325663577551347888887532416873477630011212774377503


Q ss_pred             CCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             77410000102467610230244078426124205489899999999984498999999999999999838999989999
Q gi|254780767|r  295 SEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMA  374 (383)
Q Consensus       295 ~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~A  374 (383)
                      +.---..+              -+|...   ++  -.+.+++......+++|++.++++.+.    ..-.|... ++++.
T Consensus       317 ~~~~p~~~--------------~~g~~~---l~--g~~~~~~~~~~~~~l~~p~~~~~~~~~----~~p~g~g~-~~~~~  372 (380)
T TIGR00236       317 TTERPEAV--------------EAGTNK---LV--GTDKEKITKAAGRLLSDPDEYRKMSNA----ENPYGDGE-ASERI  372 (380)
T ss_pred             CCCCCCHH--------------HCCCEE---EE--CCCHHHHHHHHHHHHCCHHHHHHHHHH----CCCCCCCH-HHHHH
T ss_conf             56664201--------------003200---10--466788999999873172678888641----26567741-46899


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780767|r  375 AEIV  378 (383)
Q Consensus       375 A~~I  378 (383)
                      .+.+
T Consensus       373 ~~~~  376 (380)
T TIGR00236       373 VEEL  376 (380)
T ss_pred             HHHH
T ss_conf             9998


No 92 
>KOG0853 consensus
Probab=95.37  E-value=0.25  Score=28.74  Aligned_cols=154  Identities=13%  Similarity=0.132  Sum_probs=84.3

Q ss_pred             CCCHHHHHHHHHHCC-----CCCEEEECC-------CCC---HHHHHHHHHHHCCCCCEE-EE----ECCCCHHHHHHHH
Q ss_conf             511189998764027-----351262016-------633---688999999604888505-52----0552035788763
Q gi|254780767|r  210 LPFFESAVASLVKRN-----PFFRFSLVT-------VSS---QENLVRCIVSKWDISPEI-II----DKEQKKQVFMTCN  269 (383)
Q Consensus       210 lP~~l~~~~~l~~~~-----~~~~~~i~~-------~~~---~~~~~~~~~~~~~~~~~i-~~----~~~~~~~~l~~sd  269 (383)
                      ..+++.+..++.+.-     ++.+..+..       .++   ....+...+.++++..+. ..    .....+.+.+.+.
T Consensus       288 ~~l~l~a~~~~~~~i~~~~~~~~hl~~~g~~G~d~~~sen~~~~~el~~lie~~~l~g~~v~f~~s~~~~~~yrl~adt~  367 (495)
T KOG0853         288 QDLALPAFTLLHDSIPEPSISSEHLVVAGSRGYDERDSENVEYLKELLSLIEEYDLLGQFVWFLPSTTRVAKYRLAADTK  367 (495)
T ss_pred             CEEEHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCC
T ss_conf             46644447764003578887711699943787644553558999999999997276665699845776388899987443


Q ss_pred             HHHCC-----CHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHH
Q ss_conf             55233-----1156688876275302540577410000102467610230244078426124205489899999999984
Q gi|254780767|r  270 AAMAA-----SGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLS  344 (383)
Q Consensus       270 ~ai~~-----SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll  344 (383)
                      .++.+     -|-+++|++.+|+|++.+-.-++.. .+.           |-..|--+=|    ++--+..+++.+.++.
T Consensus       368 ~v~~qPa~E~FGiv~IEAMa~glPvvAt~~GGP~E-iV~-----------~~~tG~l~dp----~~e~~~~~a~~~~kl~  431 (495)
T KOG0853         368 GVLYQPANEHFGIVPIEAMACGLPVVATNNGGPAE-IVV-----------HGVTGLLIDP----GQEAVAELADALLKLR  431 (495)
T ss_pred             EEEECCCCCCCCCEEHHHHHCCCCEEEECCCCCEE-EEE-----------CCCCCEEECC----CHHHHHHHHHHHHHHH
T ss_conf             57726888775633398785599889966999657-898-----------4885044577----4577899999999981


Q ss_pred             CCHHHHHHHH-HHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             4989999999-99999999838999989999999998
Q gi|254780767|r  345 QDTLQRRAML-HGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       345 ~d~~~r~~~~-~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      .|++.+.+|- ++++.+.++... ..-+++.+..+.+
T Consensus       432 ~~p~l~~~~~~~G~krV~e~fs~-~~~~~ri~~~~~~  467 (495)
T KOG0853         432 RDPELWARMGKNGLKRVKEMFSW-QHYSERIASVLGK  467 (495)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_conf             39899999988788999998707-7799999998775


No 93 
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center
Probab=95.34  E-value=0.1  Score=31.23  Aligned_cols=184  Identities=15%  Similarity=0.139  Sum_probs=98.2

Q ss_pred             CCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCC------CCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCE
Q ss_conf             88689851177657999986630134631111002211003------663557999998640156774223200255314
Q gi|254780767|r   89 PDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWR------EGRARKMCAYINQVISILPFEKEVMQRLGGPPT  162 (383)
Q Consensus        89 Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr------~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~  162 (383)
                      .+.++....| +...+...++    +..+||++.=-.=||.      ...-+.+.+-.|.+++.=+-=.+-+++. +-++
T Consensus       102 ~~~ilw~~~P-~~~~~~~~l~----~~~vVYdcvDd~~~~~~~~~~~~~~e~~l~~~ad~v~~ts~~L~~~~~~~-~~~~  175 (373)
T cd04950         102 GRPILWYYTP-YTLPVAALLQ----ASLVVYDCVDDLSAFPGGPPELLEAERRLLKRADLVFTTSPSLYEAKRRL-NPNV  175 (373)
T ss_pred             CCEEEEECCC-CHHHHHHHCC----CCCEEEEEECCHHHCCCCCHHHHHHHHHHHHHCCEEEECCHHHHHHHHHC-CCCE
T ss_conf             9739998173-0688987537----88389995061221379868999999999997799998599999988746-9998


Q ss_pred             EECCCCCCCC--CCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHH
Q ss_conf             7638821122--10013558889761876556505998538743012305111899987640273512620166336889
Q gi|254780767|r  163 TFVGHPLSSS--PSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENL  240 (383)
Q Consensus       163 ~fVGHPl~d~--~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~  240 (383)
                      ++++|=. |.  +........ .........+++|+....- ..  .    +=.+.+..+.+.+|+..|++...... ..
T Consensus       176 ~~i~nGv-D~~~F~~~~~~~~-~~~~~~~~~~p~igy~G~i-~~--~----~D~~ll~~~a~~~p~~~~~liGp~~~-~~  245 (373)
T cd04950         176 VLVPNGV-DYEHFAAARDPPP-PPADLAALPRPVIGYYGAI-AE--W----LDLELLEALAKARPDWSFVLIGPVDV-SI  245 (373)
T ss_pred             EEECCEE-CHHHHHHHCCCCC-CCHHHCCCCCCEEEEEECC-CC--C----CCHHHHHHHHHHCCCCEEEEEECCCC-CC
T ss_conf             9988821-7888410015768-8045504799889999257-52--1----48999999999889968999943887-55


Q ss_pred             HHHHHHHCCCCCEEEEEC----CCCHHHHHHHHHHHCC----------CHHHHHHHHHHCCCEEEE
Q ss_conf             999996048885055205----5203578876355233----------115668887627530254
Q gi|254780767|r  241 VRCIVSKWDISPEIIIDK----EQKKQVFMTCNAAMAA----------SGTVILELALCGIPVVSI  292 (383)
Q Consensus       241 ~~~~~~~~~~~~~i~~~~----~~~~~~l~~sd~ai~~----------SGTaTLE~al~g~P~IV~  292 (383)
                      ....+...   .+|....    ++....++++|+++..          |-.=..|.+++|+| ||.
T Consensus       246 ~~~~l~~~---~Nv~~lG~~~~~~lp~~l~~~Dv~l~P~~~~~~t~~~~P~Kl~EYlA~G~P-VVs  307 (373)
T cd04950         246 DPSALLRL---PNVHYLGPKPYKELPAYLAGFDVAILPFRLNELTRATSPLKLFEYLAAGKP-VVA  307 (373)
T ss_pred             CHHHHHCC---CCEEECCCCCHHHHHHHHHHCCEEEEECCCCHHHHCCCCCHHHHHHHCCCC-EEE
T ss_conf             83456259---987984898999999999857877741205545424686379999866998-896


No 94 
>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis]
Probab=94.53  E-value=0.42  Score=27.26  Aligned_cols=269  Identities=16%  Similarity=0.227  Sum_probs=117.3

Q ss_pred             CEEEEEEC---CCCH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEE-ECHHHCCE----EE-HHHHHHHHHHH
Q ss_conf             45999976---8214-7899999999997389983999971789994788065-04445311----01-36746645999
Q gi|254780767|r    4 LKIAVIAG---EISG-DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSL-FDFSELSV----IG-IMQVVRHLPQF   73 (383)
Q Consensus         4 mki~i~aG---E~SG-D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~-~~~~~l~v----~G-~~evl~~~~~~   73 (383)
                      ||++++-.   +-.| +..-..+.+.|++. .|++++.-||-.-  ....+.. ...+....    .| .-.+++...+-
T Consensus         1 m~~~L~g~~g~gN~Gdeail~all~~l~~~-~~~~~~~~~~~~p--~~i~~p~~~~~~p~~~~~~l~g~~k~v~R~~~k~   77 (385)
T COG2327           1 MKALLLGYYGFGNIGDEAILKALLDMLRRL-NPDAKVLVMGRRP--PVIVDPVFLSANPEGSAAGLNGRVKSVLRRRLKH   77 (385)
T ss_pred             CEEEEEEEECCCCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCC--CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             926888300478764599999999999853-8664435650478--6001313552786667203438899999975515


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEE------C---------HHHHHHHHHHHHHHHCCCCCCEEE---ECCCCCCCCCCCHHH
Q ss_conf             9999999861001288868985------1---------177657999986630134631111---002211003663557
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIV------D---------NPDFTHRVAKRVRKKMPNLPIINY---VCPSVWAWREGRARK  135 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~i------D---------~pgFnl~lak~lkk~~~~ipvi~y---v~PqvWAWr~~R~k~  135 (383)
                       ..+..+...+  .+.|++|-.      |         |-|+ +.+|..+     +.|++.|   +.|-.    ..--++
T Consensus        78 -~~~~~il~~l--~~~d~~I~~Gg~l~~d~~~~~~~~~~~~~-~~la~l~-----~kp~~~~g~svGP~~----~~~s~~  144 (385)
T COG2327          78 -PGLVSILSAL--GKADLIIIGGGGLLQDVTSSRSIIYYGGS-ILLARLA-----GKPTFFFGQSVGPLK----HPLSRQ  144 (385)
T ss_pred             -CCHHHHHHHH--HHCCEEEECCCCCCCCCCCCCEEHHHHHH-HHHHHHC-----CCCEEEEECCCCCCC----CHHHHH
T ss_conf             -3089999985--01788998485301576566121106889-9999975-----998799955678766----777999


Q ss_pred             HHHHHHHHCC----CCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEE-EECCCC-CCHHH-
Q ss_conf             9999986401----5677422320025531476388211221001355888976187655650599-853874-30123-
Q gi|254780767|r  136 MCAYINQVIS----ILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILL-LPGSRA-QEIYK-  208 (383)
Q Consensus       136 ~~~~~d~~~~----ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~l-lPGSR~-~EI~~-  208 (383)
                      +..++-...+    ==|+-.++.+. -|+++..+.-|-........+....    ......+.+++ +=|=+. .+-.+ 
T Consensus       145 ~~~~~~~~~s~i~vRD~~S~~llk~-~gi~a~l~~D~Af~L~~~~~~~~~~----~~~~~~~~~~i~lr~~~~~~t~~~~  219 (385)
T COG2327         145 LLNYVLGGCSAISVRDPVSYELLKQ-LGINARLVTDPAFLLPASSQNATAS----DVEAREKTVAITLRGLHPDNTAQRS  219 (385)
T ss_pred             HHHHHHCCCCEEEEECHHHHHHHHH-CCCCEEEECCCCEECCCCCCCCCCC----CCCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             9998856774899836875999998-0998376058402234544465521----1003455379994146775156678


Q ss_pred             HCCCHHHHHHHH-HHCCCCCEEEECCC--CCHHHHHHHHHHHCCCCCEEEEECCCC----HHHHHHHHHHHCCCHHHHHH
Q ss_conf             051118999876-40273512620166--336889999996048885055205520----35788763552331156688
Q gi|254780767|r  209 ILPFFESAVASL-VKRNPFFRFSLVTV--SSQENLVRCIVSKWDISPEIIIDKEQK----KQVFMTCNAAMAASGTVILE  281 (383)
Q Consensus       209 ~lP~~l~~~~~l-~~~~~~~~~~i~~~--~~~~~~~~~~~~~~~~~~~i~~~~~~~----~~~l~~sd~ai~~SGTaTLE  281 (383)
                      .+-...++++.. .+............  .+.......+........++....+..    -..+.+||++|+.==-.+.=
T Consensus       220 ~~~~~~~~l~~~~~~~~~~~~i~~~~~~~s~d~~va~~i~~~~~~~~~i~~~~d~~~~~~~~~l~~~dl~Vg~R~HsaI~  299 (385)
T COG2327         220 ILKYVNEALDLVERQVKALWRITLIDYGASDDLAVADAIAQLVLDSAEILVSSDEYAEELGGILAACDLIVGMRLHSAIM  299 (385)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHCCCCEEEEEHHHHHHH
T ss_conf             99989999999998641044887320455421678999876438720068614327889887751574598621689999


Q ss_pred             HHHHCCCEEEEC
Q ss_conf             876275302540
Q gi|254780767|r  282 LALCGIPVVSIY  293 (383)
Q Consensus       282 ~al~g~P~IV~Y  293 (383)
                      ++..|+|.|-++
T Consensus       300 al~~g~p~i~i~  311 (385)
T COG2327         300 ALAFGVPAIAIA  311 (385)
T ss_pred             HHHCCCCEEEEE
T ss_conf             986599758986


No 95 
>PRK10017 putative pyruvyl transferase; Provisional
Probab=94.37  E-value=0.45  Score=27.03  Aligned_cols=324  Identities=11%  Similarity=0.106  Sum_probs=146.4

Q ss_pred             CEEEEEE----CCCCHHHHHHHHHHHHHHHCCCCEEEEEECC-HHHHH--CCCEEEEC-----HHHCC-EEEHHH----H
Q ss_conf             4599997----6821478999999999973899839999717-89994--78806504-----44531-101367----4
Q gi|254780767|r    4 LKIAVIA----GEISGDLLAGDLIKSLKEMVSYPINLVGVGG-PSLQK--EGLVSLFD-----FSELS-VIGIMQ----V   66 (383)
Q Consensus         4 mki~i~a----GE~SGD~~~a~li~~Lk~~~~~~~~~~giGG-~~m~~--~G~~~~~~-----~~~l~-v~G~~e----v   66 (383)
                      |||.|+.    |-..-+-.-..+++.|++. .|++++.=+.. |.-.+  .+.+...|     +...+ .-|+..    +
T Consensus         1 MkIvI~G~yg~~N~GDeAIL~siI~~Lr~~-~p~~~I~VlS~~P~~t~~~~~~~~~~d~~~~~~~~~~~~~~~~~r~~~~   79 (426)
T PRK10017          1 MKLLILGNHTCGNRGDSAILRGLLDAINIL-NPHAEVDVMSRYPVSSSWLLNRPVMGDPLFLQMKQHNSAAGVVGRVKKV   79 (426)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHHHH-CCCCCEEEEECCCCCHHHHCCCCCCCCHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             979998360798742799999999999975-8999689995897511332166423532666665412332024567889


Q ss_pred             HHHHH------------------HHHHHHHHHHHHCCCCCCCEEEEE------C-H--HHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             66459------------------999999999861001288868985------1-1--7765799998663013463111
Q gi|254780767|r   67 VRHLP------------------QFIFRINQTVELIVSSKPDVLLIV------D-N--PDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        67 l~~~~------------------~~~~~~~~~~~~i~~~~Pd~vi~i------D-~--pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      +++..                  .+.+.+.+..+.++  +-|++|.+      | |  +.|..-+...+.    +.|++.
T Consensus        80 i~~~~~~~i~~~~v~~~g~l~~~~~~~~~~~~~~~L~--~~D~vIs~GGs~~~D~yg~~~~~~~L~a~l~----kKpv~~  153 (426)
T PRK10017         80 LRRRYQHQVLLSRVTDTGKLRNIAIAQGFTDFVRLLS--GYDAIIQVGGSFFVDLYGVPQFEHALCTFMA----KKPLFM  153 (426)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH--HCCEEEEECCCCCCCCCCCCHHHHHHHHHHC----CCCEEE
T ss_conf             9875314667766325641100022244579999986--5478997177620147685216899999973----996899


Q ss_pred             E---ECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH---HHHHCCCCCC---EEECCCCCCCCCCCCC---CHHHHHHHCC
Q ss_conf             1---0022110036635579999986401567742---2320025531---4763882112210013---5588897618
Q gi|254780767|r  120 Y---VCPSVWAWREGRARKMCAYINQVISILPFEK---EVMQRLGGPP---TTFVGHPLSSSPSILE---VYSQRNKQRN  187 (383)
Q Consensus       120 y---v~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~---~~f~k~~~~~---~~fVGHPl~d~~~~~~---~~~~~~~~~~  187 (383)
                      |   |.|=-=.|..+   .++..+.+.-.|+-=|.   ++.++. |++   ++.+--|-+-......   ......+-++
T Consensus       154 ~aQgIGP~~~~~~~~---l~~~vl~~~d~ItvRD~~S~~~L~~l-Gv~~~~i~~taDpAF~l~~~~~~~~~~~~~~~~l~  229 (426)
T PRK10017        154 IGHSVGPFQDEQFNQ---LANYVFGHCDALILRESVSLDLMKRS-NITTAKVEHGVDTAWLVDHHTEDFTASYAVQHWLD  229 (426)
T ss_pred             EECCCCCCCCHHHHH---HHHHHHHCCCEEEECCHHHHHHHHHC-CCCCCCEEEECCCCEECCCCCCCCCCCHHHHHHCC
T ss_conf             904468808788999---99999841978997658789999985-99978628945821102565433221235564136


Q ss_pred             CCCCCCEEEEEE----CC--CCC-CHHHHCCCHHHHHHHHHHCCCCCEEEECCC--C--CHHHH--HHHHHHHCCCCCEE
Q ss_conf             765565059985----38--743-012305111899987640273512620166--3--36889--99999604888505
Q gi|254780767|r  188 TPSQWKKILLLP----GS--RAQ-EIYKILPFFESAVASLVKRNPFFRFSLVTV--S--SQENL--VRCIVSKWDISPEI  254 (383)
Q Consensus       188 ~~~~~~~I~llP----GS--R~~-EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~--~--~~~~~--~~~~~~~~~~~~~i  254 (383)
                      ....+++|++--    +.  |.. .-...-..+.++++.+.++.....|+-++.  +  +.++.  .....+....+..+
T Consensus       230 ~~~~~~~VgisVr~~~~~~~~~~~~~~~y~~a~a~~~d~l~~~G~~Vv~lp~~~~i~~~~~dD~~~~~~i~~~m~~~~~~  309 (426)
T PRK10017        230 VAAQQKTVAITLRELAPFDKRLGTTQQAYEKAFAGVVNRILDEGYQVIALSTCTGIDSYNKDDRMVALNLRQHISDPARY  309 (426)
T ss_pred             CCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             56668779999703663011244108999999999999999779879996056687777802599999999972687636


Q ss_pred             EEECC-----CCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEE-CCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHC
Q ss_conf             52055-----203578876355233115668887627530254-057741000010246761023024407842612420
Q gi|254780767|r  255 IIDKE-----QKKQVFMTCNAAMAASGTVILELALCGIPVVSI-YKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFN  328 (383)
Q Consensus       255 ~~~~~-----~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~-Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ  328 (383)
                      .+..+     +...+++.||+.|.+==-++-=++..|+|+|.+ |- .-...+    .  .-+|||+...+       + 
T Consensus       310 ~il~~~~~~~E~~~ii~~~dl~IG~RLHslIfA~~~gvP~i~IsYd-~K~~g~----~--~~lGl~~~~~d-------i-  374 (426)
T PRK10017        310 HVVMDELNDLEMGKILGACELTVGTRLHSAIISMNFATPAIAINYE-HKSAGI----M--QQLGLPEMAID-------I-  374 (426)
T ss_pred             EEECCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEEC-HHHHHH----H--HHCCCCHHEEC-------H-
T ss_conf             9838999989999999739229988899999999759996984022-878999----9--97599300303-------7-


Q ss_pred             CCCCHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             5489899999999984498999999
Q gi|254780767|r  329 SMIRSEALVRWIERLSQDTLQRRAM  353 (383)
Q Consensus       329 ~~~~~~~i~~~~~~ll~d~~~r~~~  353 (383)
                      +..+++.|...+...+.|-+..++.
T Consensus       375 ~~~~~~~l~~~~~~~~~~~~~~~~~  399 (426)
T PRK10017        375 RHLLDGSLQAMVADTLGQLPALNAR  399 (426)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             7669278999999999769999999


No 96 
>PRK11083 DNA-binding response regulator CreB; Provisional
Probab=94.16  E-value=0.5  Score=26.76  Aligned_cols=81  Identities=20%  Similarity=0.372  Sum_probs=55.2

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973899839999717899947880650444531101367466459999999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |+++||+++--|+.   .+..+...|+..   ++++.+....                                   .+.
T Consensus         1 M~~~kILiVEDd~~---l~~~l~~~L~~~---g~~v~~~~~~-----------------------------------~~a   39 (229)
T PRK11083          1 MQQPTILLVEDEQA---IADTLVYALQSE---GFTVEWFERG-----------------------------------LPA   39 (229)
T ss_pred             CCCCEEEEEECCHH---HHHHHHHHHHHC---CCEEEEECCH-----------------------------------HHH
T ss_conf             99999999969999---999999999988---9999998999-----------------------------------999


Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             86100128886898-5117765-799998663013463111100
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+.+..++||+||+ +.-||.| +-+++.+|+...++|+|..-+
T Consensus        40 l~~~~~~~~DlvilDi~LP~~~G~~l~~~iR~~~~~~pII~lta   83 (229)
T PRK11083         40 LDKLRQQPPDLVILDVGLPDISGFELCRQLRAFHPALPVIFLTA   83 (229)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99997189989997388999876889999997089972999836


No 97 
>PHA01630 putative group 1 glycosyl transferase
Probab=94.05  E-value=0.52  Score=26.61  Aligned_cols=147  Identities=14%  Similarity=0.173  Sum_probs=89.2

Q ss_pred             HHHHHHCCCCCCCHHHHHCCCCC----CEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCH
Q ss_conf             99986401567742232002553----14763882112210013558889761876556505998538743012305111
Q gi|254780767|r  138 AYINQVISILPFEKEVMQRLGGP----PTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFF  213 (383)
Q Consensus       138 ~~~d~~~~ifpFE~~~f~k~~~~----~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~  213 (383)
                      +.+|.+.+---.-++.|.+. |+    ++.-|-|++-...-....        ...+-.-+++++|-|-.   ++.-.++
T Consensus        95 ~~~D~ivv~SqWS~naf~~s-gl~I~~PiY~IpHn~nprm~~~~~--------kek~~~~Vl~~l~HS~~---RKG~Di~  162 (333)
T PHA01630         95 QPVDEIVVPSQWSKNAFYTS-GLKIPQPIYVIPHNLNPRMFEYKP--------KEKPHPCVLAILPHSWD---RKGGDIV  162 (333)
T ss_pred             CCCCEEEECCHHHHHHHHHC-CCCCCCCEEECCCCCCHHHHHCCH--------HHCCCCEEEEECCCCCC---CCCCHHH
T ss_conf             87540674244436578752-899998627645679935640763--------21887569998566545---4656889


Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCC-CEEEEECCCCHHHHHHHHHHHCCC--H---HHHHHHHHHCC
Q ss_conf             89998764027351262016633688999999604888-505520552035788763552331--1---56688876275
Q gi|254780767|r  214 ESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDIS-PEIIIDKEQKKQVFMTCNAAMAAS--G---TVILELALCGI  287 (383)
Q Consensus       214 l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~-~~i~~~~~~~~~~l~~sd~ai~~S--G---TaTLE~al~g~  287 (383)
                      ..+++++++..-++-|.+-...-.+..+.      +++ ...-+..++.++.++.||+-+-.|  |   -..+|+-.+|+
T Consensus       163 ~~v~~elqke~~d~Y~Lvkssn~~d~Rl~------~l~gvk~plp~dd~~~lf~~~Di~f~p~RGGaFEi~~iEAl~~gl  236 (333)
T PHA01630        163 VKIFHELQNEGYDFYFLIKSSNMLDPRLF------GLNGVKTPLPDDDIYSLFAGCDILFYPVRGGAFEIPVIEALALGL  236 (333)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCCCCCEEE------CCCCCCCCCCCHHHHHHHHHCCEEEEECCCCEEECCHHHHHHCCC
T ss_conf             99999998457856999984155673021------233544789816789987406379984158603431799987079


Q ss_pred             CEEEECCCCCCEEEE
Q ss_conf             302540577410000
Q gi|254780767|r  288 PVVSIYKSEWIVNFF  302 (383)
Q Consensus       288 P~IV~Yk~~~lt~~i  302 (383)
                      |.|+.=+-.|-.|+.
T Consensus       237 ~~v~te~GaWsE~~~  251 (333)
T PHA01630        237 DVVVTEKGAWSEWVL  251 (333)
T ss_pred             CEEECCCCCHHHHCC
T ss_conf             767627864065247


No 98 
>PHA01633 putative glycosyl transferase group 1
Probab=93.71  E-value=0.36  Score=27.65  Aligned_cols=148  Identities=16%  Similarity=0.171  Sum_probs=82.2

Q ss_pred             CCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCC----CEEEECCCCCHHHHHHHHHHHCCCCCEEEEE-------C
Q ss_conf             5565059985387430123051118999876402735----1262016633688999999604888505520-------5
Q gi|254780767|r  190 SQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPF----FRFSLVTVSSQENLVRCIVSKWDISPEIIID-------K  258 (383)
Q Consensus       190 ~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~----~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~-------~  258 (383)
                      ++..-.++.-|-.+   ++++.+|+++...|..++|+    +.|.+..   .++.     .+...+.++...       +
T Consensus       146 pdt~kfgvvsg~tk---rknidl~lq~~n~lntkypd~ak~ihffvis---hedf-----~k~evpanvhfva~fg~q~~  214 (335)
T PHA01633        146 PDTIKFGIVSGLTK---RKNMDLMLQVFNELNTKYPDIAKKIHFFVIS---HKQF-----TQLEVPANVHFVAEFGHNSR  214 (335)
T ss_pred             CCCEEEEEEECCCC---CCCHHHHHHHHHHHHCCCCCHHHCEEEEEEE---HHHH-----HHCCCCCCEEEHHHHCCCCH
T ss_conf             86445546644432---3445699999988630188766714799962---6776-----54248740310676477848


Q ss_pred             CCCHHHHHHHHHHHCCCHH-----HHHHHHHHCCCEEEECCCCCCEE---EEE-ECCCCCCEEEEHHHCCCCCCCHHHCC
Q ss_conf             5203578876355233115-----66888762753025405774100---001-02467610230244078426124205
Q gi|254780767|r  259 EQKKQVFMTCNAAMAASGT-----VILELALCGIPVVSIYKSEWIVN---FFI-FYIKTWTCALPNLIVDYPLVPEYFNS  329 (383)
Q Consensus       259 ~~~~~~l~~sd~ai~~SGT-----aTLE~al~g~P~IV~Yk~~~lt~---~i~-~lik~~~i~LpNii~~~~ivPEliQ~  329 (383)
                      ++....+.+.|+.++.|||     -.||.+.+|+|.|- --..+++.   |-. .+++...+  -| -.+++--.-.--.
T Consensus       215 e~i~afy~amdf~~vpsg~egfglpvlesmamgtpvih-q~ipp~~eftswq~n~l~k~~kv--ee-y~~kehaqkwki~  290 (335)
T PHA01633        215 EYIFAFYGAMDFTIVPSGTEGFGMPVLESMAMGTPVIH-QLMPPLDEFTSWQWNLLIKSSKV--EE-YYDKEHGQKWKIH  290 (335)
T ss_pred             HHHHHHHHHCEEEECCCCCCCCCCHHHHHHHCCCHHHH-HCCCCCHHHHHHHHHHHHHHHHH--HH-HHHHHHHHHEEEE
T ss_conf             99999860030687358866458267877603763376-40798003203422542103078--88-7756654310567


Q ss_pred             CCCHHHHHHHHHH--HHCCHHHHHH
Q ss_conf             4898999999999--8449899999
Q gi|254780767|r  330 MIRSEALVRWIER--LSQDTLQRRA  352 (383)
Q Consensus       330 ~~~~~~i~~~~~~--ll~d~~~r~~  352 (383)
                      +++++.++.++..  ..+|.+.|..
T Consensus       291 rfq~ed~a~ail~a~~~qdreers~  315 (335)
T PHA01633        291 KFQIEDMANAIILAFELQDREERSM  315 (335)
T ss_pred             ECCHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             2488899999999876035788889


No 99 
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism]
Probab=93.01  E-value=0.49  Score=26.78  Aligned_cols=15  Identities=27%  Similarity=0.590  Sum_probs=6.3

Q ss_pred             EEEEEEC-CHHHHHCC
Q ss_conf             3999971-78999478
Q gi|254780767|r   34 INLVGVG-GPSLQKEG   48 (383)
Q Consensus        34 ~~~~giG-G~~m~~~G   48 (383)
                      -|+.|+| +.-|.+.|
T Consensus       109 ~EL~~~GAnQaI~Q~~  124 (566)
T COG1165         109 PELRGCGANQAIDQTG  124 (566)
T ss_pred             HHHHCCCCCHHHHHHH
T ss_conf             7885479850212320


No 100
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane]
Probab=92.15  E-value=0.99  Score=24.76  Aligned_cols=151  Identities=21%  Similarity=0.223  Sum_probs=85.8

Q ss_pred             EEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHHHHHHHHCCCCCEEEEEC----CCCHHHHHHH
Q ss_conf             05998538743012305111899987640273512620166336-889999996048885055205----5203578876
Q gi|254780767|r  194 KILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLVRCIVSKWDISPEIIIDK----EQKKQVFMTC  268 (383)
Q Consensus       194 ~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~~~~~~~~~~~~~i~~~~----~~~~~~l~~s  268 (383)
                      .+.+.-|. -.+ .+..+.+++++..+....++..+.+...... ................+....    ++...+++.|
T Consensus       200 ~~i~~~g~-~~~-~k~~~~~i~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~~~~~~~~~  277 (381)
T COG0438         200 FVVLYVGR-LDP-EKGLDLLIEAAAKLKKRGPDIKLVIVGDGPERREELEKLAKKLGLEDNVKFLGYVPDEELAELLASA  277 (381)
T ss_pred             EEEEEECC-CCC-CCCHHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHC
T ss_conf             79999648-865-4799999999998532158648999995341288999999970888878991778989999999728


Q ss_pred             HHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHH
Q ss_conf             3552331-----15668887627530254057741000010246761023024407842612420548989999999998
Q gi|254780767|r  269 NAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERL  343 (383)
Q Consensus       269 d~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~l  343 (383)
                      ++.+..|     |.+.+|++..|+|. |....+.....+....           .|- +++    . -.++.+++.+..+
T Consensus       278 ~~~v~ps~~e~~~~~~~Ea~a~g~pv-i~~~~~~~~~~~~~~~-----------~g~-~~~----~-~~~~~~~~~i~~~  339 (381)
T COG0438         278 DVFVLPSLSEGFGLVLLEAMAAGTPV-IASDVGGIPEVVEDGE-----------TGL-LVP----P-GDVEELADALEQL  339 (381)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHCCEE-EECCCCCHHHHHCCCC-----------EEE-EEC----C-CCHHHHHHHHHHH
T ss_conf             09991786445588999999849869-9958998688430697-----------069-988----9-9999999999999


Q ss_pred             HCCHHHHHHHHH-HHHHHHHHH
Q ss_conf             449899999999-999999983
Q gi|254780767|r  344 SQDTLQRRAMLH-GFENLWDRM  364 (383)
Q Consensus       344 l~d~~~r~~~~~-~~~~~~~~L  364 (383)
                      +++.+.++.+.+ ..+...+..
T Consensus       340 ~~~~~~~~~~~~~~~~~~~~~~  361 (381)
T COG0438         340 LEDPELREELGEAARERVEEEF  361 (381)
T ss_pred             HHCHHHHHHHHHHHHHHHHHHC
T ss_conf             8697999999999999999866


No 101
>pfam05159 Capsule_synth Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.
Probab=92.05  E-value=0.27  Score=28.45  Aligned_cols=98  Identities=18%  Similarity=0.218  Sum_probs=58.2

Q ss_pred             EEEEECCC--CCCHHHHCC---CHHHHHHHHHHCCCCCEEEECCCCCHHHH--HHHHHHHCCC-CCEEEEECCCCHHHHH
Q ss_conf             59985387--430123051---11899987640273512620166336889--9999960488-8505520552035788
Q gi|254780767|r  195 ILLLPGSR--AQEIYKILP---FFESAVASLVKRNPFFRFSLVTVSSQENL--VRCIVSKWDI-SPEIIIDKEQKKQVFM  266 (383)
Q Consensus       195 I~llPGSR--~~EI~~~lP---~~l~~~~~l~~~~~~~~~~i~~~~~~~~~--~~~~~~~~~~-~~~i~~~~~~~~~~l~  266 (383)
                      ..|+|+=-  .+-|..+.|   .+.+++....+.+|+.+.++=.-|.....  .......... ...+.....+..+++.
T Consensus       119 ~vLvplQv~~D~qI~~~s~~~~~~~~vl~sfa~~~Pda~lv~K~HP~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~~Ll~  198 (268)
T pfam05159       119 IVLVPLQVFDDSSIRLGSAVIDFFLEVLESFAEENPDAQIIIKPHPDVLGGNKYGLITELPGLERVDVIVHDVNLISLLR  198 (268)
T ss_pred             EEEEECCCCCCHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHCCCCEEEEECCCCHHHHHH
T ss_conf             89993678746666369965899999999999878898399968987546776454575455688199936999999998


Q ss_pred             HHHHHHCCCHHHHHHHHHHCCCEEEE
Q ss_conf             76355233115668887627530254
Q gi|254780767|r  267 TCNAAMAASGTVILELALCGIPVVSI  292 (383)
Q Consensus       267 ~sd~ai~~SGTaTLE~al~g~P~IV~  292 (383)
                      .|+.+++.+-|+-+|+.+.|+|.+++
T Consensus       199 ~~~~VvtvnSt~G~eALl~gkpV~~~  224 (268)
T pfam05159       199 HVDEVVTITSTVGFEALLLGKPVITL  224 (268)
T ss_pred             HCCEEEEECCHHHHHHHHCCCCEEEE
T ss_conf             57999996556899999859973894


No 102
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism]
Probab=91.66  E-value=1.1  Score=24.41  Aligned_cols=153  Identities=14%  Similarity=0.115  Sum_probs=96.4

Q ss_pred             CCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHHHHCCCCCEE
Q ss_conf             35588897618765565059985387430123051118999876402735126201663--3688999999604888505
Q gi|254780767|r  177 EVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS--SQENLVRCIVSKWDISPEI  254 (383)
Q Consensus       177 ~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~--~~~~~~~~~~~~~~~~~~i  254 (383)
                      .++....++.+++.+.+.-.+.--||--+ .+-+..+++++..+.+..  .++++...+  ..+..+....+.++...-+
T Consensus       277 ~nk~~L~~~~gL~~~~~~pl~~~vsRl~~-QKG~dl~~~~i~~~l~~~--~~~vilG~gd~~le~~~~~la~~~~~~~~~  353 (487)
T COG0297         277 ENKVALQERLGLDVDLPGPLFGFVSRLTA-QKGLDLLLEAIDELLEQG--WQLVLLGTGDPELEEALRALASRHPGRVLV  353 (487)
T ss_pred             HHHHHHHHHHCCCCCCCCCEEEEEECCCC-CCCHHHHHHHHHHHHHHC--CEEEEEECCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             89999999809877999758999422420-134558999999999708--369998268278999999999866760999


Q ss_pred             EE--ECCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEE-ECCCCCCEEEEHHHCCCCCCCHH
Q ss_conf             52--0552035788763552331-----1566888762753025405774100001-02467610230244078426124
Q gi|254780767|r  255 II--DKEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFI-FYIKTWTCALPNLIVDYPLVPEY  326 (383)
Q Consensus       255 ~~--~~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~-~lik~~~i~LpNii~~~~ivPEl  326 (383)
                      .+  ...-...+++.||+-+..|     |-.-++++..|++ .|+.+|..|.--+. +-.-       + +.+  +--=|
T Consensus       354 ~i~~~~~la~~i~agaD~~lmPSrfEPcGL~ql~amryGtv-pIv~~tGGLadTV~~~~~~-------~-~~~--~gtGf  422 (487)
T COG0297         354 VIGYDEPLAHLIYAGADVILMPSRFEPCGLTQLYAMRYGTL-PIVRETGGLADTVVDRNEW-------L-IQG--VGTGF  422 (487)
T ss_pred             EEEECHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHCCCC-CEECCCCCCCCEECCCCCH-------H-CCC--CEEEE
T ss_conf             96336899999984498999577676875899999871884-4675468865410376611-------0-037--50379


Q ss_pred             HCCCCCHHHHHHHHHHH
Q ss_conf             20548989999999998
Q gi|254780767|r  327 FNSMIRSEALVRWIERL  343 (383)
Q Consensus       327 iQ~~~~~~~i~~~~~~l  343 (383)
                      +-...|++.+..++.+-
T Consensus       423 ~f~~~~~~~l~~al~rA  439 (487)
T COG0297         423 LFLQTNPDHLANALRRA  439 (487)
T ss_pred             EEECCCHHHHHHHHHHH
T ss_conf             98269989999999999


No 103
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional
Probab=90.40  E-value=0.68  Score=25.86  Aligned_cols=44  Identities=14%  Similarity=0.126  Sum_probs=32.6

Q ss_pred             EEEECHHHCCEEEHHHHH-HHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             065044453110136746-645999999999986100128886898
Q gi|254780767|r   50 VSLFDFSELSVIGIMQVV-RHLPQFIFRINQTVELIVSSKPDVLLI   94 (383)
Q Consensus        50 ~~~~~~~~l~v~G~~evl-~~~~~~~~~~~~~~~~i~~~~Pd~vi~   94 (383)
                      ++-||...=+.||+.+-+ .+++.+-+.-+++.+.|.++ |+.++.
T Consensus         3 ~~~~~~~~~~~~~l~~~Ir~~~~~Lt~sEk~IA~yIL~~-~~~v~~   47 (293)
T PRK11337          3 QSEFDSALPNGIGLAPYIRMKQEGMTENESRVVDWLLKP-GNLSCA   47 (293)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHCC-HHHHHH
T ss_conf             200576699877899999997764499999999999829-899976


No 104
>pfam08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
Probab=89.77  E-value=1.6  Score=23.31  Aligned_cols=146  Identities=16%  Similarity=0.209  Sum_probs=73.9

Q ss_pred             EEEECCCCHHHHH-HHHHHHHHHHCCCCEEEEEECCHHHHHCCCEE-------EECHHHCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             9997682147899-99999999738998399997178999478806-------504445311013674664599999999
Q gi|254780767|r    7 AVIAGEISGDLLA-GDLIKSLKEMVSYPINLVGVGGPSLQKEGLVS-------LFDFSELSVIGIMQVVRHLPQFIFRIN   78 (383)
Q Consensus         7 ~i~aGE~SGD~~~-a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~-------~~~~~~l~v~G~~evl~~~~~~~~~~~   78 (383)
                      ++++|- .|+..- -+|+++++++.. ...+..--++.+....++.       +.....--.+|- .-+..++++.+.+-
T Consensus         2 ~vv~GS-GGHt~eml~L~~~l~~~~~-~~~yvv~~~D~~s~~~~~~~~~~~~~i~~~~r~R~v~q-s~~~s~~~~~~~~~   78 (166)
T pfam08660         2 CVVLGS-GGHTAEMLRLLPFLKNLED-PRRYVVTETDKDSLSKASKFEKSRGGILKIPRAREVGQ-SYLRSIFTTLRNLL   78 (166)
T ss_pred             EEEEEC-HHHHHHHHHHHHHHHHCCC-CCEEEEECCCHHHHHHHHHCCCCCCEEEECCCEEECCC-HHHHHHHHHHHHHH
T ss_conf             999948-2789999999998775689-73899988980789998860555523764463157385-56745999999999


Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHH---HHHHHHHC-CCCCCEEEEC------CCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             99861001288868985117765799---99866301-3463111100------22110036635579999986401567
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRV---AKRVRKKM-PNLPIINYVC------PSVWAWREGRARKMCAYINQVISILP  148 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~l---ak~lkk~~-~~ipvi~yv~------PqvWAWr~~R~k~~~~~~d~~~~ifp  148 (383)
                      +....+.+.+||++|+- -||-.+++   |+.+|-.. .+.++||.=+      |+.    .  .|.+..+.|..++=.|
T Consensus        79 ~s~~il~k~kPdvii~t-G~g~~vp~~~~a~ll~~~~~~~~k~i~iES~~r~~~~sl----t--gkll~~~ad~f~vqW~  151 (166)
T pfam08660        79 SALKLLRRERPDVILCN-GPGTCVPFCLAAKLLKILGLKGTKIVYIESFARVKTLSL----S--GKLLYPLADRFIVQWP  151 (166)
T ss_pred             HHHHHHHHHCCCEEEEC-CCCEEEHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCH----H--HHHHHHHCCEEEEECH
T ss_conf             99999985399899977-996030999999999864015885899984421378647----7--7769986898898379


Q ss_pred             CCHHHHHCCCCCCEEECCC
Q ss_conf             7422320025531476388
Q gi|254780767|r  149 FEKEVMQRLGGPPTTFVGH  167 (383)
Q Consensus       149 FE~~~f~k~~~~~~~fVGH  167 (383)
                      --.+.|.     ++.|+|.
T Consensus       152 ~l~~~yp-----~a~y~G~  165 (166)
T pfam08660       152 ELKKKYP-----KAIYYGR  165 (166)
T ss_pred             HHHHHCC-----CCEEEEC
T ss_conf             9994689-----9779703


No 105
>PRK10840 transcriptional regulator RcsB; Provisional
Probab=89.68  E-value=1.7  Score=23.26  Aligned_cols=81  Identities=22%  Similarity=0.296  Sum_probs=44.4

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973899839999717899947880650444531101367466459999999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |++|||+|+=-.   .+.-..|-.-| +. .+++++.|-.++.                                  .++
T Consensus         1 M~~irIlIvDDh---~lvr~Gl~~~L-~~-~~~~~vvg~a~~~----------------------------------~~~   41 (216)
T PRK10840          1 MNNMNVIIADDH---PIVLFGIRKSL-EQ-IEWVNVVGEFEDS----------------------------------TAL   41 (216)
T ss_pred             CCCCEEEEECCH---HHHHHHHHHHH-CC-CCCCEEEEEECCH----------------------------------HHH
T ss_conf             998889998897---99999999998-15-9996899987999----------------------------------999


Q ss_pred             HHHCCCCCCCEEEE-ECHHHH----HHHHHHHHHHHCCCCCCEEE
Q ss_conf             86100128886898-511776----57999986630134631111
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDF----THRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgF----nl~lak~lkk~~~~ipvi~y  120 (383)
                      .+.+...+||++++ ++-||-    -+.+.+.+|++.++++++-+
T Consensus        42 ~~~~~~~~pDvvllDl~mpg~~~~dGl~~~~~i~~~~p~~~vivl   86 (216)
T PRK10840         42 INNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVL   86 (216)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             999862398989982677999887899999999985899808998


No 106
>PRK13114 consensus
Probab=89.49  E-value=1.7  Score=23.17  Aligned_cols=122  Identities=17%  Similarity=0.217  Sum_probs=69.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC----H------HH
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04----4------45
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD----F------SE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~----~------~~   57 (383)
                      -|+.||-++=|.- ..++++|-+. +-|  +.=+|         ||--|++....+         ++    +      ..
T Consensus        17 ~yitaG~P~~~~t-~~~i~~l~~~-GaD--iiEiGiPFSDP~ADGpvIq~A~~rAL~~G~~l~~~f~~v~~~r~~~~~~P   92 (266)
T PRK13114         17 AFITGGDPTPGDT-AANLDALVAG-GAD--VIELGMPFTDPMADGPAIQAANLRSLAAGTTTADIFRIAAEFRQRHPEVP   92 (266)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCC--EEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             8870718998999-9999999976-999--99979998886776899999999999869979999999999874189988


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHH
Q ss_conf             3110136746645999999999986100128886898511776-579999866301346311110022110036635579
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKM  136 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~  136 (383)
                      +-+||.+..+-+     .-.++..+.+++..-|.+|.+|-|-= .-.+.+.+++.  |+..|+.|+|+-   .+.|++++
T Consensus        93 ivlM~Y~N~i~~-----~G~~~F~~~~~~aGvdG~IipDLP~eE~~~~~~~~~~~--gi~~I~liaPtt---~~~Ri~~i  162 (266)
T PRK13114         93 LVLMGYANPMVR-----RGPDWFAAECKKAGVDGVICVDIPPEEDAELGPALRAA--GIDPIRLATPTT---DAARLPAV  162 (266)
T ss_pred             EEEEEEHHHHHH-----HHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHH
T ss_conf             799863019998-----64999999999749977984589978889999999974--997267756999---79999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780767|r  137 CAYIN  141 (383)
Q Consensus       137 ~~~~d  141 (383)
                      .+..+
T Consensus       163 ~~~a~  167 (266)
T PRK13114        163 LEGAS  167 (266)
T ss_pred             HHHCC
T ss_conf             97389


No 107
>PRK13134 consensus
Probab=87.73  E-value=1.6  Score=23.45  Aligned_cols=122  Identities=20%  Similarity=0.292  Sum_probs=68.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHC-------CCEE--EECH---------HHC
Q ss_conf             99997682147899999999997389983999971---------7899947-------8806--5044---------453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKE-------GLVS--LFDF---------SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~-------G~~~--~~~~---------~~l   58 (383)
                      -|+.||-+|=+.- ..++++|.+. +  +.+.=+|         ||--|++       |.+.  ++++         ..+
T Consensus        23 ~yitaG~P~~e~s-~~~i~~l~~~-G--aDiiEiGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~~~~~~~pi   98 (257)
T PRK13134         23 PFLTAGFPTSERF-WDELEALDAA-G--ADIIEVGVPFSDPVADGPVVAAASQRALESGVTLRWIMDGLAARKGRLRAGL   98 (257)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8870707997999-9999999977-9--9999978988887655899999999999679987899999998744689998


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHH-HHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             11013674664599999999998610012888689851177-65799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPD-FTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pg-Fnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      =+||.+..+.+|     -.++..+.+++..-|.+|..|-|- -+-.+...+++.  |+..|++|+|+-   .+.|++.+.
T Consensus        99 vlMtY~N~i~~y-----G~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~--gi~~I~lvaPtt---~~~Ri~~i~  168 (257)
T PRK13134         99 VLMGYLNPFMQY-----GFERFVRDAADAGVAGCIIPDLPLDEDADLRALLAAR--GMDLIALVGPNT---GEGRMREYA  168 (257)
T ss_pred             EEEECCHHHHHH-----HHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEECCCCC---CHHHHHHHH
T ss_conf             998534599974-----6899999998679875994699977889999999975--982699638999---999999999


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780767|r  138 AYIN  141 (383)
Q Consensus       138 ~~~d  141 (383)
                      +..+
T Consensus       169 ~~s~  172 (257)
T PRK13134        169 AVAS  172 (257)
T ss_pred             HHCC
T ss_conf             6288


No 108
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I; InterPro: IPR011908    This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria .; GO: 0016757 transferase activity transferring glycosyl groups, 0009103 lipopolysaccharide biosynthetic process.
Probab=87.72  E-value=2.3  Score=22.41  Aligned_cols=270  Identities=14%  Similarity=0.178  Sum_probs=156.1

Q ss_pred             EEEEEECCCCHHHH-HHHHHHHHHHHCCCC-----EEEEEECCHHHHHCCCEEEECHHH----CCEEEHHHHHHHH--HH
Q ss_conf             59999768214789-999999999738998-----399997178999478806504445----3110136746645--99
Q gi|254780767|r    5 KIAVIAGEISGDLL-AGDLIKSLKEMVSYP-----INLVGVGGPSLQKEGLVSLFDFSE----LSVIGIMQVVRHL--PQ   72 (383)
Q Consensus         5 ki~i~aGE~SGD~~-~a~li~~Lk~~~~~~-----~~~~giGG~~m~~~G~~~~~~~~~----l~v~G~~evl~~~--~~   72 (383)
                      ||+|+=--+=||+. -.-.+..+++..| |     ++|.=+.     ++|+=-+...+.    +--+-+=-.-|++  ..
T Consensus         1 ~ILIVktSSlGDviH~~Pa~~d~~r~~P-~iyPqr~~idWvV-----EE~FA~i~~~hp~V~~vi~~alRRWRK~lfs~~   74 (359)
T TIGR02193         1 KILIVKTSSLGDVIHTLPALTDIKRALP-DIYPQRVEIDWVV-----EEGFADIVRLHPAVDEVIPVALRRWRKTLFSAA   74 (359)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCC-CCCCCEEEEEEEE-----ECCHHHHHHHCHHHHCCCCCCHHHHCCCCCCHH
T ss_conf             9578986101225455448999998578-9874347898876-----142110344153460000341112012748874


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECHHHH--HHHHHHHHH-HHCCCC-------C---C--E-----EEECCCCCCCCCCC
Q ss_conf             9999999986100128886898511776--579999866-301346-------3---1--1-----11002211003663
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIVDNPDF--THRVAKRVR-KKMPNL-------P---I--I-----NYVCPSVWAWREGR  132 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~iD~pgF--nl~lak~lk-k~~~~i-------p---v--i-----~yv~PqvWAWr~~R  132 (383)
                      .++.++.+++.++..+.|+|  ||..|.  +=-+|+.++ ....|.       |   .  +     |=|+|+.=||.+.|
T Consensus        75 ~~~e~~~l~~~Lr~~~YD~V--iD~QGL~KSA~~a~~a~~g~~~G~d~~SarEpYE~lA~lFY~~~~~v~~~~hav~R~R  152 (359)
T TIGR02193        75 TWREIKALRALLRAERYDAV--IDAQGLIKSALVARMARAGPRHGFDRRSAREPYERLASLFYNKRVSVSYQQHAVERNR  152 (359)
T ss_pred             HHHHHHHHHHHCCCCCCCEE--ECCHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCHHHHHHCCCCEECCCCCCHHHHHH
T ss_conf             89999999985200248824--5112468999999997065625158887655664122220135020786773889889


Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHCC--CCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHC
Q ss_conf             5579999986401567742232002--55314763882112210013558889761876556505998538743012305
Q gi|254780767|r  133 ARKMCAYINQVISILPFEKEVMQRL--GGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKIL  210 (383)
Q Consensus       133 ~k~~~~~~d~~~~ifpFE~~~f~k~--~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~l  210 (383)
                       +.+...+-...--..-+.+|.-..  .+....+.||=.         ..+.+..+.++.+.+++.+|.|+=+.  .+.+
T Consensus       153 -~L~a~aLGY~~~~i~~~~d~Gl~~~~~a~~~~~~~~~~---------~~~~~r~l~~~k~~py~vllHaTSR~--dK~W  220 (359)
T TIGR02193       153 -KLFALALGYAPPEIAETIDFGLARRARAFSVAFLGLAL---------PLELVRALELDKDAPYAVLLHATSRD--DKKW  220 (359)
T ss_pred             -HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH---------HHHHCCEEEEECCCCCEEEEECCCCC--CCCC
T ss_conf             -99999818888875553200222654333311122001---------33201000110788968982144500--2358


Q ss_pred             CC--HHHHHHHHHHCCCC-CEEEECCCCCHHHH-HHHHHHHCCCCCEEEE-EC---CCCHHHHHHHHHHHCC-CHHHHHH
Q ss_conf             11--18999876402735-12620166336889-9999960488850552-05---5203578876355233-1156688
Q gi|254780767|r  211 PF--FESAVASLVKRNPF-FRFSLVTVSSQENL-VRCIVSKWDISPEIII-DK---EQKKQVFMTCNAAMAA-SGTVILE  281 (383)
Q Consensus       211 P~--~l~~~~~l~~~~~~-~~~~i~~~~~~~~~-~~~~~~~~~~~~~i~~-~~---~~~~~~l~~sd~ai~~-SGTaTLE  281 (383)
                      |.  +.++++.|.+.+ + ++.++|=.++.+.. -+.+....+...++++ ..   .+.-..+..++++|.. +|=+.| 
T Consensus       221 P~~~W~~l~~~L~e~~-gy~~~~LpWgn~~E~~~A~~la~~~~~~~~v~VlPk~~L~~va~~l~~a~avVGvDTGL~HL-  298 (359)
T TIGR02193       221 PEERWRELARLLLEER-GYLQIVLPWGNDAEKARAERLAEALPGAEDVVVLPKMSLAEVAALLAGADAVVGVDTGLTHL-  298 (359)
T ss_pred             CHHHHHHHHHHHHCCC-CCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCEEEEECCHHHHHH-
T ss_conf             6789999999970569-92798726998689999999986043031467758999899999881770799725248999-


Q ss_pred             HHHHCCCEEEECCCC
Q ss_conf             876275302540577
Q gi|254780767|r  282 LALCGIPVVSIYKSE  296 (383)
Q Consensus       282 ~al~g~P~IV~Yk~~  296 (383)
                      ++++++|+|.+|..+
T Consensus       299 A~Al~kP~v~lY~~T  313 (359)
T TIGR02193       299 AAALDKPTVTLYGAT  313 (359)
T ss_pred             HHHHCCCEEEEECCC
T ss_conf             998479769873587


No 109
>PRK10046 dpiA two-component response regulator DpiA; Provisional
Probab=87.65  E-value=2.3  Score=22.38  Aligned_cols=80  Identities=13%  Similarity=0.149  Sum_probs=52.1

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             87459999768214789999999999738998399997178999478806504445311013674664599999999998
Q gi|254780767|r    2 NSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTV   81 (383)
Q Consensus         2 ~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~   81 (383)
                      .+|||+|+=-|+.    -+.+++..-++.+ +++..|..+..                                  .+..
T Consensus         3 ~~i~VLIVEDd~~----v~~~l~~~L~~~~-gf~~V~~A~~~----------------------------------~eA~   43 (225)
T PRK10046          3 APLTLLIVEDETP----LAEMHAEYIRHIP-GFSQILLAGNL----------------------------------AQAR   43 (225)
T ss_pred             CCCEEEEEECCHH----HHHHHHHHHHHCC-CCEEEEEECCH----------------------------------HHHH
T ss_conf             9886999959899----9999999997289-95499998999----------------------------------9999


Q ss_pred             HHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             6100128886898-5117765-7999986630134631111
Q gi|254780767|r   82 ELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        82 ~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      +.+..++||+|++ |--||.| +-+.+.+++.++.+|||-.
T Consensus        44 ~~l~~~~pDLvLLDi~LPd~~Glell~~lr~~~~~~~VI~i   84 (225)
T PRK10046         44 MMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFT   84 (225)
T ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             99973599999982898999799999999964879988999


No 110
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional
Probab=87.54  E-value=1.1  Score=24.53  Aligned_cols=30  Identities=13%  Similarity=0.256  Sum_probs=18.1

Q ss_pred             HHHHH-HHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             36746-6459999999999861001288868
Q gi|254780767|r   63 IMQVV-RHLPQFIFRINQTVELIVSSKPDVL   92 (383)
Q Consensus        63 ~~evl-~~~~~~~~~~~~~~~~i~~~~Pd~v   92 (383)
                      +.+-+ .+++.+-+.-+++.+.|.++...++
T Consensus         3 il~rI~~~~~~Lt~~Ek~iA~yIl~n~~~v~   33 (284)
T PRK11302          3 TLEKIQSRLEHLSKSERKVAEVILASPQTAI   33 (284)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHCCHHHHH
T ss_conf             8999999886459999999999980989997


No 111
>pfam04413 Glycos_transf_N 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
Probab=86.79  E-value=2.5  Score=22.07  Aligned_cols=146  Identities=21%  Similarity=0.299  Sum_probs=77.0

Q ss_pred             EEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEE-EE---CCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             999976821478999-99999997389983999-97---17899947880650444531101367466459999999999
Q gi|254780767|r    6 IAVIAGEISGDLLAG-DLIKSLKEMVSYPINLV-GV---GGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         6 i~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~-gi---GG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |++=| -.=|+..++ .|+++|+++.+ +.++. -.   .|-.+...-   ..+    .+.-+.     +|  +-....+
T Consensus        24 IWiHa-aSvGE~~~~~~li~~l~~~~p-~~~iliT~~T~sg~~~~~~~---~~~----~~~~~y-----lP--~D~~~~~   87 (186)
T pfam04413        24 IWLHA-ASVGEVLAALPLIEALKARYP-GLRILVTTTTPTGAELARKL---LPD----RVIHQY-----LP--LDLPGAV   87 (186)
T ss_pred             EEEEE-CCHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCHHHHHHHHH---CCC----CCEEEE-----CC--CCCHHHH
T ss_conf             99983-988999999999999998689-96299983581699999986---789----807997-----77--6777999


Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE---ECCC---CCCCCCCCHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             8610012888689851177657999986630134631111---0022---110036635579999986401567742232
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY---VCPS---VWAWREGRARKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y---v~Pq---vWAWr~~R~k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      .+.+...+||++|++.+- +=-.+-..++++  |||++-.   ++++   -|.|-.+=.+.+-+.+|++++-=.-..+-|
T Consensus        88 ~~fl~~~~P~~~i~~e~E-iWPnli~~~~~~--~ip~~linar~s~~s~~~~~~~~~~~~~~l~~~~~i~~qs~~~~~r~  164 (186)
T pfam04413        88 RRFLKHWRPDLLVIVETE-LWPNLIAAAKKR--GIPVVLVNARLSERSARRYRRFPGLFRPLLRRFDLILAQSEEDAERF  164 (186)
T ss_pred             HHHHHHHCCCEEEEEECC-HHHHHHHHHHHC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHH
T ss_conf             999998599889998613-209999999987--99999997776864222688899999999984599996899999999


Q ss_pred             HCCCCC---CEEECCCCCCC
Q ss_conf             002553---14763882112
Q gi|254780767|r  155 QRLGGP---PTTFVGHPLSS  171 (383)
Q Consensus       155 ~k~~~~---~~~fVGHPl~d  171 (383)
                      .+. |+   ++...|+.=.|
T Consensus       165 ~~l-G~~~~~v~v~GnlKfd  183 (186)
T pfam04413       165 RAL-GAPPDRVEVTGNLKFD  183 (186)
T ss_pred             HHC-CCCHHHEEEECCCCCC
T ss_conf             984-9983578991877667


No 112
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.45  E-value=2.6  Score=21.95  Aligned_cols=284  Identities=15%  Similarity=0.196  Sum_probs=125.2

Q ss_pred             HHHHHHHHHCCCCEEEEEEC--CHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE---E
Q ss_conf             99999997389983999971--789994788065044453110136746645999999999986100128886898---5
Q gi|254780767|r   21 DLIKSLKEMVSYPINLVGVG--GPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI---V   95 (383)
Q Consensus        21 ~li~~Lk~~~~~~~~~~giG--G~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~---i   95 (383)
                      -++++|+.. +..+-|+-.|  |..--..+     +-.    -|-.+++..-+    .-......++.++||.++.   .
T Consensus        22 ~~~~~l~~~-g~kvlflE~~~~~~~k~rd~-----~~~----~~~~~~~~~~~----~e~~~~~~i~~fk~d~iv~~~~~   87 (373)
T COG4641          22 GLLRALKMD-GMKVLFLESGDFWDYKNRDI-----DAE----DGCTEAFYKDQ----PELESLLYIREFKPDIIVNMSGD   87 (373)
T ss_pred             HHHHHHHHC-CCEEEEEECCCHHHHHCCCC-----CCC----CCHHHEEECCC----HHHHHHHHHHHCCCCEEEEECCC
T ss_conf             999999856-55489983262775406445-----676----56001000574----78999998986287479995156


Q ss_pred             CHHHHHHHHHH--HHHHHCCCCCC-EEEECCCCCCCCCCCHHHHHHHHHH-----HCCCCCC---------CHHHHHCCC
Q ss_conf             11776579999--86630134631-1110022110036635579999986-----4015677---------422320025
Q gi|254780767|r   96 DNPDFTHRVAK--RVRKKMPNLPI-INYVCPSVWAWREGRARKMCAYINQ-----VISILPF---------EKEVMQRLG  158 (383)
Q Consensus        96 D~pgFnl~lak--~lkk~~~~ipv-i~yv~PqvWAWr~~R~k~~~~~~d~-----~~~ifpF---------E~~~f~k~~  158 (383)
                      |.|++-.....  .+++.  ++|+ ++|+.--+=      ...+.+...+     -+.+|.+         -..+|++..
T Consensus        88 ~~~~~~~~~~~~a~l~~~--~l~~~~w~te~p~~------~~~~~~~~~~~~~~~~l~~fd~v~~~g~~l~~~~yyq~~~  159 (373)
T COG4641          88 DQPDEESTIDLWAWLKRK--CLPVIVWYTEDPYD------TDIFSQVAEEQLARRPLFIFDNVLSFGGGLVANKYYQEGG  159 (373)
T ss_pred             CCCCCEEHHHHHHHHHCC--CCCEEEEEECCCHH------HHHHHHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHHHHHC
T ss_conf             664410017999985267--86269997146002------4666530177761055513342331264078899987623


Q ss_pred             CCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCC-EEEEEECCC----CCCHHHHCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             53147638821122100135588897618765565-059985387----4301230511189998764027351262016
Q gi|254780767|r  159 GPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWK-KILLLPGSR----AQEIYKILPFFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       159 ~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~-~I~llPGSR----~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      +.++.+++.+.=+....  +.       ..+.... -+++. |++    -+|++.   .+++.+..+....   .|..-.
T Consensus       160 ~~~~~~~~~a~d~~~~~--~i-------~~da~~~~dL~~i-gn~~pDr~e~~ke---~~~~ps~kl~v~r---r~~~~g  223 (373)
T COG4641         160 ARNCYYLPWAVDDSLFH--PI-------PPDASYDVDLNLI-GNPYPDRVEEIKE---FFVEPSFKLMVDR---RFYVLG  223 (373)
T ss_pred             CCCEECCCCCCCCHHCC--CC-------CCCCCCEEEEEEE-CCCCCCHHHHHHH---HHHCCCHHHHCCC---EEEECC
T ss_conf             55113057567823206--69-------8541301336773-5888557899999---8615201110065---345507


Q ss_pred             CCCHHHHH--------HHHHHHCCC--CCEEEEECCCCHHHHHHHHHHHCCC--HHHHHHHHHHCCCEEEECCCCCCEEE
Q ss_conf             63368899--------999960488--8505520552035788763552331--15668887627530254057741000
Q gi|254780767|r  234 VSSQENLV--------RCIVSKWDI--SPEIIIDKEQKKQVFMTCNAAMAAS--GTVILELALCGIPVVSIYKSEWIVNF  301 (383)
Q Consensus       234 ~~~~~~~~--------~~~~~~~~~--~~~i~~~~~~~~~~l~~sd~ai~~S--GTaTLE~al~g~P~IV~Yk~~~lt~~  301 (383)
                       ++..+.+        .+.......  ...-.....+..--+..++.+-+-+  -+.|-|+|.+|.|++.-|...    .
T Consensus       224 -~~y~~~~~~~~~~~~~~yIg~~~~~~~v~~~~~~~~~~~n~~r~~~~~~l~~~~~RvFeiagc~~~liT~~~~~----~  298 (373)
T COG4641         224 -PRYPDDIWGRTWEPNVQYIGYYNPKDGVPNAFKRDDVTLNINRASIANALFSPTNRVFEIAGCGGFLITDYWKD----L  298 (373)
T ss_pred             -CCCCHHHHCCCCCCHHHHHHCCCCCCHHHHCCCCCCEEEEECHHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHH----H
T ss_conf             -76523442113365666633268500000003554435641378887614785056888761587501542788----9


Q ss_pred             EEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHH
Q ss_conf             0102467610230244078426124205489899999999984498999999-9999999998
Q gi|254780767|r  302 FIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAM-LHGFENLWDR  363 (383)
Q Consensus       302 i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~-~~~~~~~~~~  363 (383)
                      =.++..-+.           ++     --.+++.+...+..++..++.|+++ ..++++++..
T Consensus       299 e~~f~pgk~-----------~i-----v~~d~kdl~~~~~yll~h~~erkeiae~~ye~V~~~  345 (373)
T COG4641         299 EKFFKPGKD-----------II-----VYQDSKDLKEKLKYLLNHPDERKEIAECAYERVLAR  345 (373)
T ss_pred             HHHCCCCHH-----------EE-----EECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             872598602-----------58-----963789999999998448306899998669999874


No 113
>PRK13112 consensus
Probab=85.87  E-value=1.8  Score=23.01  Aligned_cols=121  Identities=17%  Similarity=0.275  Sum_probs=67.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHC-------CCEE------EE------CHHH
Q ss_conf             99997682147899999999997389983999971---------7899947-------8806------50------4445
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKE-------GLVS------LF------DFSE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~-------G~~~------~~------~~~~   57 (383)
                      -|+.+|.+|=|.- -.++++|-+. +  +.+.=+|         ||--|++       |++.      +-      +-..
T Consensus        22 ~yitaG~P~~~~s-~~~l~~l~~~-G--aDiiElGiPFSDPvADGPvIQ~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~P   97 (279)
T PRK13112         22 TYFMGGDPDLETS-LKIMKALPKA-G--ADIIELGMPFSDPMADGPAIQAAGLRALKAGQTLAKTLYLAREFRKDDDTTP   97 (279)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             8860738997899-9999999877-9--9989978998986665799999999999769968899999998513489988


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHH
Q ss_conf             3110136746645999999999986100128886898511776-579999866301346311110022110036635579
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKM  136 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~  136 (383)
                      +-.||.+..+.++.     .++..+.+++..-|.+|.+|-|-= .-.+.+.++++  |+..|+.|+|+-   .+.|++++
T Consensus        98 ivlM~Y~N~i~~~G-----~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~--~i~~I~lvaPtt---~~eRi~~i  167 (279)
T PRK13112         98 IVLMGYYNPIYIYG-----VERFLTDAKAAGVDGLIVVDLPPEMDAELCIPAMKA--GINFIRLATPTT---DDKRLPKV  167 (279)
T ss_pred             EEEEEECHHHHHHC-----HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHH
T ss_conf             79985124998847-----999999999739987984699978889999999857--834699825899---89999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780767|r  137 CAYI  140 (383)
Q Consensus       137 ~~~~  140 (383)
                      .+..
T Consensus       168 ~~~s  171 (279)
T PRK13112        168 LANT  171 (279)
T ss_pred             HHCC
T ss_conf             8527


No 114
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain; InterPro: IPR012822    This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (IPR012821 from INTERPRO), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant sucrose phosphate synthase (SPS). At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase..
Probab=85.55  E-value=2.3  Score=22.37  Aligned_cols=251  Identities=19%  Similarity=0.229  Sum_probs=127.4

Q ss_pred             HHHHHHHHHHHHHCCC--CCCCEEEE--ECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH---------
Q ss_conf             9999999999861001--28886898--5117765799998663013463111100221100366355799---------
Q gi|254780767|r   71 PQFIFRINQTVELIVS--SKPDVLLI--VDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC---------  137 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~--~~Pd~vi~--iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~---------  137 (383)
                      |.+=...++++.++++  +.||++=+  =|+.=---+|+..|     +||.||=- =+.-  |++|.+-++         
T Consensus        95 PyLD~~~D~~l~ylr~~g~lPdlIH~HYADAGYVG~~ls~~L-----~vPlvfTG-HSLG--R~Kr~RLLa~G~~skaPk  166 (445)
T TIGR02472        95 PYLDELADQLLSYLRQQGRLPDLIHAHYADAGYVGARLSRLL-----GVPLVFTG-HSLG--REKRRRLLAAGLKSKAPK  166 (445)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCHHHHCCHHHHHHHHHHHC-----CCCEEEEC-CCCC--HHHHHHHHHCCCCCCCCC
T ss_conf             007899999999997358888731010101558999998625-----89848837-5357--789999984340026788


Q ss_pred             --HHHHHHCCC--------------------CCCCHH--H--HHCC---------CCCCEEECCCCCCCCCCCCCCHHHH
Q ss_conf             --999864015--------------------677422--3--2002---------5531476388211221001355888
Q gi|254780767|r  138 --AYINQVISI--------------------LPFEKE--V--MQRL---------GGPPTTFVGHPLSSSPSILEVYSQR  182 (383)
Q Consensus       138 --~~~d~~~~i--------------------fpFE~~--~--f~k~---------~~~~~~fVGHPl~d~~~~~~~~~~~  182 (383)
                        +-++..++|                    =-.|.+  |  |+++         +|+++.=. ||+-.......-....
T Consensus       167 P~~~IE~~f~is~RI~AEE~tL~~AslvitST~QEi~~QY~~Y~~y~P~r~~VIPPGvD~~rF-yp~~~~~~~~~i~~~L  245 (445)
T TIGR02472       167 PPQEIEKQFNISRRIEAEEETLAHASLVITSTHQEIEEQYALYDSYDPERMEVIPPGVDLSRF-YPPQSSEEDSEIDKLL  245 (445)
T ss_pred             CHHHHHHHHCCCCCHHHHHHHHHHCCEEEEECCCEEHHHHCCCCCCCCCCCEECCCCCCCCCC-CCCCCCCCCHHHHHHH
T ss_conf             778999861226414788999851474586145103212101478670211351788887543-4788888875888752


Q ss_pred             HHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHH---HHHHCCCCCEEEECCCCCHH-------H---HHHHHHHHCC
Q ss_conf             976187655650599853874301230511189998---76402735126201663368-------8---9999996048
Q gi|254780767|r  183 NKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVA---SLVKRNPFFRFSLVTVSSQE-------N---LVRCIVSKWD  249 (383)
Q Consensus       183 ~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~---~l~~~~~~~~~~i~~~~~~~-------~---~~~~~~~~~~  249 (383)
                      ...+. ++++|.|+-+  ||.-+ ++|++.++++-=   .|+ ..-|+..++-+=.+..       +   .+-..+..|+
T Consensus       246 ~rFL~-~p~KP~ilai--sRpd~-RKNi~~Lv~aYG~~p~L~-~~aNLVlvlG~RdD~r~me~~qR~Vl~~vl~~iD~YD  320 (445)
T TIGR02472       246 ARFLK-DPEKPPILAI--SRPDR-RKNIPALVEAYGRSPKLQ-EMANLVLVLGSRDDIRKMESSQREVLTEVLLLIDRYD  320 (445)
T ss_pred             HHHCC-CCCCCEEEEE--CCCCC-CCCHHHHHHHHCCCHHHH-HHCCEEEEECCCCCHHHCHHHHHHHHHHHHHHHCCCC
T ss_conf             23114-7887838872--27887-667455562007886676-5208088752778853121578999999987630002


Q ss_pred             CCCEEEE----ECCCCHHHHHHHH--------HHHCC-CHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHH
Q ss_conf             8850552----0552035788763--------55233-115668887627530254057741000010246761023024
Q gi|254780767|r  250 ISPEIII----DKEQKKQVFMTCN--------AAMAA-SGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNL  316 (383)
Q Consensus       250 ~~~~i~~----~~~~~~~~l~~sd--------~ai~~-SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNi  316 (383)
                      +--+|-.    -.++-.+++..|-        =|++= -|=.=||+|.+|+|+|--                .--|--.|
T Consensus       321 LYGkvAyPK~H~~~dvP~lYRLAA~~rGiFVNPALTEPFGLTLlEAAAcGLPivAT----------------~DGGP~dI  384 (445)
T TIGR02472       321 LYGKVAYPKHHRPDDVPELYRLAARRRGIFVNPALTEPFGLTLLEAAACGLPIVAT----------------EDGGPRDI  384 (445)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHCCCEEECCCCCCCCHHHHHHHHHCCCCEEEC----------------CCCCCHHH
T ss_conf             45640268888811232678999865986762721253016899999769972107----------------86486688


Q ss_pred             HCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             4078426124205489899999999984498999999
Q gi|254780767|r  317 IVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAM  353 (383)
Q Consensus       317 i~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~  353 (383)
                      |++++-  =||=+-.+.+.|..++.+.++|.+.=+..
T Consensus       385 ~~~C~N--GLLvd~ld~e~i~~AL~~alsd~~QW~~W  419 (445)
T TIGR02472       385 IANCRN--GLLVDVLDLEAIASALEQALSDSSQWQTW  419 (445)
T ss_pred             HHHCCC--CCEECCCCHHHHHHHHHHHCCCHHHHHHH
T ss_conf             842888--75005789899999999733890667899


No 115
>PRK13122 consensus
Probab=85.46  E-value=1.8  Score=23.03  Aligned_cols=124  Identities=19%  Similarity=0.296  Sum_probs=72.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHC-------CCEE--EEC-H------
Q ss_conf             9874599997682147899999999997389983999971---------7899947-------8806--504-4------
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKE-------GLVS--LFD-F------   55 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~-------G~~~--~~~-~------   55 (383)
                      |.++=|=.++|.+.-    -..++.|.+. +  +.+.=+|         ||--|++       |.+.  +++ +      
T Consensus         1 ~~K~fipyi~g~pd~----~~~~~~l~~~-G--aDiiElGiPfSDP~ADGpvIQ~A~~rAL~~G~~~~~~~~~l~~~r~~   73 (242)
T PRK13122          1 MTKLFIPYIMGNKDL----IENATLLSEN-G--ADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITIDYIFNQLEKHGDQ   73 (242)
T ss_pred             CCEEEEEEECCCCCH----HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC
T ss_conf             972377762689999----9999999975-9--99999789888866658999999999997699899999999973136


Q ss_pred             --HHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC
Q ss_conf             --453110136746645999999999986100128886898511776-57999986630134631111002211003663
Q gi|254780767|r   56 --SELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGR  132 (383)
Q Consensus        56 --~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R  132 (383)
                        ..+-+||.+..+.++.     .++..+.+.+..-|.+|.+|-|-= +-.+.+.++++  |+..|++|+|+-   .+.|
T Consensus        74 ~~~pivlM~Y~N~i~~~G-----~~~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~--gi~~I~lvaPtt---~~~R  143 (242)
T PRK13122         74 IKCNYVLMTYYNIICHYG-----EQAFFEKCRDTGVYGLIIPDLPYELSQRLKQQFSHY--GVKIISLVAMTT---DDKR  143 (242)
T ss_pred             CCCCEEEEEECHHHHHHC-----HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHH
T ss_conf             798779998516988727-----999999998769986777899878899999999867--986898718999---8999


Q ss_pred             HHHHHHHHH
Q ss_conf             557999998
Q gi|254780767|r  133 ARKMCAYIN  141 (383)
Q Consensus       133 ~k~~~~~~d  141 (383)
                      ++.+.+..+
T Consensus       144 i~~i~~~s~  152 (242)
T PRK13122        144 IKDIVSHAE  152 (242)
T ss_pred             HHHHHHHCC
T ss_conf             999998299


No 116
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=85.37  E-value=3  Score=21.61  Aligned_cols=90  Identities=19%  Similarity=0.298  Sum_probs=53.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+|..+-   -.+|..|.+.+... + ++...++.....       ..|+++                   ...+.+.
T Consensus         1 MkILvtGa~---GqLG~~l~~~l~~~-~-~~~~~~~~~~~~-------~~Dit~-------------------~~~v~~~   49 (299)
T PRK09987          1 MNILLFGKT---GQVGWELQRALAPL-G-NLIALDVHSTDY-------CGDFSN-------------------PEGVAET   49 (299)
T ss_pred             CEEEEECCC---CHHHHHHHHHHHHC-C-CEEEEECCCCCC-------CCCCCC-------------------HHHHHHH
T ss_conf             979998999---97899999986650-9-889985263001-------367899-------------------9999999


Q ss_pred             CCCCCCCEEEE------ECHHHH--------H----HHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             00128886898------511776--------5----7999986630134631111002211
Q gi|254780767|r   84 IVSSKPDVLLI------VDNPDF--------T----HRVAKRVRKKMPNLPIINYVCPSVW  126 (383)
Q Consensus        84 i~~~~Pd~vi~------iD~pgF--------n----l~lak~lkk~~~~ipvi~yv~PqvW  126 (383)
                      +.+.+||+||=      ||.-.=        |    -.||+.+++.  |+++||+-+=+|.
T Consensus        50 ~~~~~Pd~IIN~aA~T~VD~~E~~~~~a~~vN~~~~~~La~~~~~~--~~~lIhiSTD~VF  108 (299)
T PRK09987         50 VRKIRPDVIVNAAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEV--GAWVVHYSTDYVF  108 (299)
T ss_pred             HHHCCCCEEEECHHHCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHC--CCEEEEECCCEEE
T ss_conf             9965999999883101636652489999998889999999999973--9859996321160


No 117
>cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome. It has been shown that in Escherichia coli RPS2 is essential for the binding of ribosomal protein S1 to the 30s ribosomal subunit. In humans, most likely in all vertebrates, and perhaps in all metazoans, the protein also functions as the 67 kDa laminin receptor (LAMR1 or 67LR), which is formed from a 37 kDa precursor, and is overexpressed in many tumors. 67LR is a cell surface receptor which interacts with a variety of ligands, laminin-1 and others. It is assumed that the ligand interactions are mediated via the conserved C-terminus, which becomes extracellular as the protein undergoes conformational changes which are not well understood. Specifically, a conserved palindromic motif, LMWWML, may participate in the interactions. 67LR plays essential roles in the adhesion of cells to the basement membrane an
Probab=85.29  E-value=3  Score=21.58  Aligned_cols=20  Identities=35%  Similarity=0.557  Sum_probs=13.1

Q ss_pred             HHHHHHHHHCCCEEEECCCC
Q ss_conf             56688876275302540577
Q gi|254780767|r  277 TVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       277 TaTLE~al~g~P~IV~Yk~~  296 (383)
                      .|-.||..+|+|.|-+-.++
T Consensus       141 ~ai~Ea~~l~IPvI~i~Dtn  160 (193)
T cd01425         141 QAIREASKLGIPVIAIVDTN  160 (193)
T ss_pred             HHHHHHHHHCCCEEEEECCC
T ss_conf             89999986187557885089


No 118
>PRK04607 consensus
Probab=85.26  E-value=3  Score=21.58  Aligned_cols=90  Identities=24%  Similarity=0.322  Sum_probs=46.3

Q ss_pred             CCCCE-EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH-----HHHCCCEEEE-CHHH-----------CCE--
Q ss_conf             98745-99997682147899999999997389983999971789-----9947880650-4445-----------311--
Q gi|254780767|r    1 MNSLK-IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPS-----LQKEGLVSLF-DFSE-----------LSV--   60 (383)
Q Consensus         1 m~~mk-i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~-----m~~~G~~~~~-~~~~-----------l~v--   60 (383)
                      |++|| |.|+.||++|  .|..++-++.+... ..++.=+|...     ++..|++.-+ ++..           +.+  
T Consensus         2 M~~~k~IaIT~GDPaG--IGpEIilk~~~~~~-~~~~viigd~~~l~~~~~~lg~~~~~~~~~~~~~~~~~~~~~l~v~~   78 (330)
T PRK04607          2 MNSIKRIVVTAGEPAG--IGPDLVLALSKEDW-PHQLVVCADKQLLAERAAQLGIQVQLLDYNADLAPQAQQAGTLLVEH   78 (330)
T ss_pred             CCCCCCEEEECCCCCH--HHHHHHHHHHHHCC-CCCEEEEECHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCEEEEEC
T ss_conf             9889948995588762--17999999851358-88879998999999999984999457555866556624488458843


Q ss_pred             --------EEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             --------0136746645999999999986100128886898
Q gi|254780767|r   61 --------IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI   94 (383)
Q Consensus        61 --------~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~   94 (383)
                              .|-.. -.+-...++.++..++.+++.+.|++|+
T Consensus        79 ~~~~~~~~~G~~s-~~~g~~~~~sl~~Av~~~~~g~~dalVT  119 (330)
T PRK04607         79 IELAEPVVAGQLN-EANGHYVLKTLERAALGCMNGEFDAIVT  119 (330)
T ss_pred             CCCCCCCCCCCCC-HHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             5667877889739-8999999999999999997298788997


No 119
>pfam00290 Trp_syntA Tryptophan synthase alpha chain.
Probab=85.06  E-value=1.8  Score=23.05  Aligned_cols=122  Identities=19%  Similarity=0.289  Sum_probs=72.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEEE-------------C------HHH
Q ss_conf             99997682147899999999997389983999971---------7899947880650-------------4------445
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSLF-------------D------FSE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~~-------------~------~~~   57 (383)
                      -|+.||-+|=|.- .+++++|.+. +  +.+.=+|         ||--|++....+-             .      -..
T Consensus        13 ~yi~aG~P~~~~~-~~~i~~l~~~-G--aDiiEiGiPFSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~~p   88 (258)
T pfam00290        13 PFVTAGDPDLETT-LEILEALEEA-G--ADAIELGIPFSDPLADGPTIQRANLRALAGGMTLDQTLELVEEIRNKGTSVP   88 (258)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             8870738998999-9999999976-9--9999978998887665899999999999869969999999998551289988


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHH
Q ss_conf             3110136746645999999999986100128886898511776-579999866301346311110022110036635579
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKM  136 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~  136 (383)
                      +-+||.+..+.++.     .++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|++|+|+-=   +.|++.+
T Consensus        89 ivlM~Y~N~i~~~G-----~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--~l~~I~lvsPtt~---~~Ri~~i  158 (258)
T pfam00290        89 IVLMTYYNPVLNYG-----IERFYAQAAEAGVDGLIIPDLPPEEADPLREAAEKH--GIDLIFLVAPTTS---DERLKTI  158 (258)
T ss_pred             EEEEEECHHHHHCC-----HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCCC---HHHHHHH
T ss_conf             89985208898729-----999999999759977870799988999999999845--8435888458881---9999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780767|r  137 CAYIN  141 (383)
Q Consensus       137 ~~~~d  141 (383)
                      .+..+
T Consensus       159 ~~~s~  163 (258)
T pfam00290       159 SEAAS  163 (258)
T ss_pred             HHHCC
T ss_conf             96089


No 120
>PRK13132 consensus
Probab=84.29  E-value=1.9  Score=22.93  Aligned_cols=123  Identities=17%  Similarity=0.270  Sum_probs=70.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEE---------ECH-------HHCCEEE
Q ss_conf             9999768214789999999999738998399997-------1789994788065---------044-------4531101
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSL---------FDF-------SELSVIG   62 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~---------~~~-------~~l~v~G   62 (383)
                      -|+.||-++=|.- .+++++|.+. +-|+-=.|+       -||--|.+....+         +++       ..+-+||
T Consensus        15 ~yitaG~P~~e~s-~~~~~~l~~~-GaDiiEiGiPfSDP~aDGPvIq~A~~~AL~~G~~~~~~~~~~~~ir~~~pivlM~   92 (246)
T PRK13132         15 GYIVAGYPNLETT-KEFLQRLDES-PLDILELGIPYSDPLADGKLIADASFIALQQGVNTDTVFELLARVKTKKALVFLV   92 (246)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             7882858998999-9999999974-9998997898888765589999999999877998999999999753699979996


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHH-HHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHH
Q ss_conf             367466459999999999861001288868985117-7657999986630134631111002211003663557999998
Q gi|254780767|r   63 IMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNP-DFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYIN  141 (383)
Q Consensus        63 ~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~p-gFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d  141 (383)
                      ....+.++     -.++..+.+++..-|.+|..|-| +-+-.+.+.+++.  ++..|++|+|+-    +.|++.+.+..+
T Consensus        93 Y~N~i~~~-----G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~--~i~~I~lvaPTs----~~R~~~i~~~s~  161 (246)
T PRK13132         93 YYNLIFAY-----GLEKFVKKAKELGISGLIVPDLPFEESEELIKECEKY--NIALIPLISVTS----PKRAKKILKHAK  161 (246)
T ss_pred             ECHHHHHC-----CHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC----HHHHHHHHHCCC
T ss_conf             01088772-----9999999998769985775799978989999999985--997014425797----899999995489


No 121
>pfam00072 Response_reg Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.
Probab=84.10  E-value=1.1  Score=24.45  Aligned_cols=42  Identities=26%  Similarity=0.683  Sum_probs=29.5

Q ss_pred             HHHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             9986100128886898-5117765-7999986630134631111
Q gi|254780767|r   79 QTVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      +..+.+.+++||++++ +.-||.| +.+++.+|+..+.+|+|-.
T Consensus        33 ~al~~~~~~~~dlvi~Di~mP~~dG~el~~~ir~~~~~~piI~~   76 (111)
T pfam00072        33 EALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPPTTPVIVL   76 (111)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             99999984799899995368995015799999735999809999


No 122
>PRK13140 consensus
Probab=83.98  E-value=2.9  Score=21.74  Aligned_cols=124  Identities=20%  Similarity=0.238  Sum_probs=70.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEEEC---H---------------HHCCE
Q ss_conf             9999768214789999999999738998399997-------178999478806504---4---------------45311
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSLFD---F---------------SELSV   60 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~~~---~---------------~~l~v   60 (383)
                      .|+.||-+|=|.- ..++++|-+. +-|+-=.|+       -||--|++....+-+   +               ..+-+
T Consensus        18 ~y~taG~P~~~~s-~~~~~~l~~~-GaDiiElGiPfSDP~ADGpvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~pivl   95 (257)
T PRK13140         18 IYFTAGYPTLEDT-VSIIKDLEKH-GVDMIEIGIPFSDPLADGPVIQKSATQALKNGMTLKLLFEQLKDIRKEVQIPLIL   95 (257)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEE
T ss_conf             8881828987999-9999999975-9999997898898776589999999999986998999999999974368988899


Q ss_pred             EEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH--HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHH
Q ss_conf             0136746645999999999986100128886898511776--57999986630134631111002211003663557999
Q gi|254780767|r   61 IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF--THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCA  138 (383)
Q Consensus        61 ~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF--nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~  138 (383)
                      ||....+.++     -.++..+.+++..-|.+|..|-|-=  .-.+.+.+++.  |+..|++|+|+-=   +.|++.+.+
T Consensus        96 M~Y~N~i~~~-----G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~~--~i~~I~lvaPtt~---~~Ri~~i~~  165 (257)
T PRK13140         96 MGYLNPIMQY-----GFEKFCKKCAETGIDGVIIPDLPFDDYQEHYKEIFEKY--GLKNIMLITPQTS---EERIREIDS  165 (257)
T ss_pred             EECHHHHHHH-----CHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHC--CCCEEEEECCCCC---HHHHHHHHH
T ss_conf             9055999851-----79999999998499869835998567589999999986--9977998689998---999999997


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780767|r  139 YIN  141 (383)
Q Consensus       139 ~~d  141 (383)
                      ..+
T Consensus       166 ~a~  168 (257)
T PRK13140        166 HTD  168 (257)
T ss_pred             HCC
T ss_conf             399


No 123
>PRK13120 consensus
Probab=83.72  E-value=3.3  Score=21.33  Aligned_cols=122  Identities=19%  Similarity=0.297  Sum_probs=74.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHC-------CCE--EEECH----------HH
Q ss_conf             99997682147899999999997389983999971---------7899947-------880--65044----------45
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKE-------GLV--SLFDF----------SE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~-------G~~--~~~~~----------~~   57 (383)
                      -|+.||-+|=|.- -.++++|-+. +-|  +.=+|         ||--|++       |.+  .++++          ..
T Consensus        25 ~yitaG~P~~~~t-~~~l~~l~~~-GaD--iiElGiPFSDPvADGPvIQ~A~~rAL~~G~~l~~vl~~v~~~r~~~~~~P  100 (285)
T PRK13120         25 PYIAAGDPSPQAT-VPLMHALVRA-GAD--LVELGVPFSDPMADGPVVQRAAERAIAQGVGLRRVLELVADFRRDDSVTP  100 (285)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCC--EEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             7857858998999-9999999976-999--99978987874566899999999999769984469999999873489888


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHH-HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHH
Q ss_conf             31101367466459999999999861001288868985117765-79999866301346311110022110036635579
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFT-HRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKM  136 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn-l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~  136 (383)
                      +-+||.+..+.+|     -..+..+.+++..-|.+|..|-|--. -.+.+.+++.  |+..|+.|+|+-   ...|++.+
T Consensus       101 ivlM~Y~Npi~~y-----G~e~F~~~~~~aGvdGlIIpDLP~EE~~~~~~~~~~~--gi~~I~LiaPtT---~~eRi~~I  170 (285)
T PRK13120        101 VVLMGYANPIERM-----GQRAFAQAAQAAGVDGVLVVDYPPEEVDEFAAMLAEA--GVAPIFLLAPTS---TEARIEAI  170 (285)
T ss_pred             EEEEEHHHHHHHH-----HHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHH
T ss_conf             8986105499998-----7999999999839877964799979999999999966--996589957999---89999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780767|r  137 CAYIN  141 (383)
Q Consensus       137 ~~~~d  141 (383)
                      .+...
T Consensus       171 ~~~s~  175 (285)
T PRK13120        171 GRVAR  175 (285)
T ss_pred             HHHCC
T ss_conf             95089


No 124
>PRK13113 consensus
Probab=83.55  E-value=3.4  Score=21.19  Aligned_cols=121  Identities=19%  Similarity=0.331  Sum_probs=71.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC----------HHH
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04----------445
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD----------FSE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~----------~~~   57 (383)
                      -|+.+|.++=+.- -.++++|.+. +  +.+.=+|         ||--|++....+         ++          -..
T Consensus        21 ~yitaG~P~~e~s-~~~~~~l~~~-G--aDiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~~P   96 (263)
T PRK13113         21 AYVMAGDPDYDTS-LEVMRGLPAA-G--VDIIELGMPFTDPMADGPTIQLAGQRALEGGMTLDRTLDMVRAFRKEDDTTP   96 (263)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             8873828997999-9999999976-9--9999978988887765899999999999779838899999997512389988


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHH
Q ss_conf             3110136746645999999999986100128886898511776-579999866301346311110022110036635579
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKM  136 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~  136 (383)
                      +-+||.+..+.++     -.++..+.+++..-|.+|.+|-|-= .-.+.+.+++.  |+..|++|+|+-   .+.|++++
T Consensus        97 ivlM~Y~N~i~~~-----G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--~l~~I~lvaPtt---~~~Ri~~i  166 (263)
T PRK13113         97 IVMMGYYNPIYSR-----GVDRFLAEAKEAGIDGLIVVDLPPEEDSELCLPAQAA--GLNFIRLATPTT---DDRRLPKV  166 (263)
T ss_pred             EEEEECHHHHHHH-----HHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHH
T ss_conf             8998313689885-----6999999987779436971799978889999999977--986799947999---99999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780767|r  137 CAYI  140 (383)
Q Consensus       137 ~~~~  140 (383)
                      .+..
T Consensus       167 ~~~a  170 (263)
T PRK13113        167 LQNT  170 (263)
T ss_pred             HHCC
T ss_conf             8338


No 125
>PRK13124 consensus
Probab=83.48  E-value=3.3  Score=21.36  Aligned_cols=121  Identities=21%  Similarity=0.313  Sum_probs=68.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC----H-----HHC
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04----4-----453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD----F-----SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~----~-----~~l   58 (383)
                      -|+.+|-++=|.- .+++++|-+. +  +.+.=+|         ||--|++.-+.+         ++    +     ..+
T Consensus        13 ~yitaG~P~~e~s-~~~~~~l~~~-G--aDiiElGiPfSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~pi   88 (257)
T PRK13124         13 PFITAGDPDPETT-IDLVLALEEA-G--ADILELGIPYSDPLADGPVIQRASKRALNGGMNIVKAMELVGKMRKKVTIPI   88 (257)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8863708998999-9999999976-9--9999978988887765799999999999769968999999998524478888


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHH-HHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             1101367466459999999999861001288868985117-765799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNP-DFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~p-gFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      =+||.+..+-++     -.++..+.+++..-|.+|..|-| +-.-.+.+.+++.  |+..|++|+|+-    ..|++.+.
T Consensus        89 vlM~Y~N~i~~~-----G~e~F~~~~~~~Gv~GvIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPTs----~~Ri~~i~  157 (257)
T PRK13124         89 VYFTYYNPVLQY-----GLEKFFALARENGIDGLLIPDLPLEESGELQEICDKY--GIYLIPLVAPTS----KERIKKIA  157 (257)
T ss_pred             EEEEHHHHHHHH-----HHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC----HHHHHHHH
T ss_conf             997500789875-----7999999999759984777899979999999999866--873578847996----79999998


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780767|r  138 AYIN  141 (383)
Q Consensus       138 ~~~d  141 (383)
                      +..+
T Consensus       158 ~~s~  161 (257)
T PRK13124        158 EQAE  161 (257)
T ss_pred             HCCC
T ss_conf             5489


No 126
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both strongly stimulated by the formation of the complex. The alpha subunit catalyzes the cleavage of indole 3-glycerol phosphate (IGP) to indole and d-glyceraldehyde 3-phosphate (G3P). Indole is then channeled to the active site of the beta subunit, a PLP-dependent enzyme that catalyzes a replacement reaction to convert L-serine into L-tryptophan.
Probab=83.24  E-value=2.1  Score=22.62  Aligned_cols=121  Identities=18%  Similarity=0.298  Sum_probs=67.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE-------------ECH-----HHC
Q ss_conf             99997682147899999999997389983999971---------789994788065-------------044-----453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL-------------FDF-----SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~-------------~~~-----~~l   58 (383)
                      -|+.+|-+|=|.- -.++++|.+.   ++.+.=+|         ||--|.+....+             ..+     ..+
T Consensus         4 ~y~taG~P~~~~~-~~~~~~l~~~---G~d~iEiGiPfsDP~aDGpvIq~A~~~aL~~g~~~~~~~~~~~~~r~~~~~pi   79 (242)
T cd04724           4 PYITAGDPDLETT-LEILKALVEA---GADIIELGIPFSDPVADGPVIQAASERALANGVTLKDVLELVKEIRKKNTIPI   79 (242)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC---CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             7873778997999-9999999976---99999978998887765899999999999769949999999999873479888


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      -+||.+..+.++     -.++..+.+++..-|.+|..|-|-- .-.+...+++.  |+..|.+|+|+-   .+.|++.+.
T Consensus        80 vlM~Y~N~i~~~-----G~e~F~~~~~~~Gv~GviipDLP~ee~~~~~~~~~~~--~i~~I~lvsPtt---~~~ri~~i~  149 (242)
T cd04724          80 VLMGYYNPILQY-----GLERFLRDAKEAGVDGLIIPDLPPEEAEEFREAAKEY--GLDLIFLVAPTT---PDERIKKIA  149 (242)
T ss_pred             EEEEECHHHHHH-----CHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCEEEEEECCCC---CHHHHHHHH
T ss_conf             999844576652-----8999999999759975870699957846899999865--983889968988---789999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780767|r  138 AYI  140 (383)
Q Consensus       138 ~~~  140 (383)
                      +..
T Consensus       150 ~~s  152 (242)
T cd04724         150 ELA  152 (242)
T ss_pred             HHC
T ss_conf             747


No 127
>PRK13118 consensus
Probab=82.87  E-value=2.9  Score=21.74  Aligned_cols=58  Identities=17%  Similarity=0.246  Sum_probs=33.4

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHH-HHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             99998610012888689851177-6579999866301346311110022110036635579999
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPD-FTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pg-Fnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      .++..+.+++..-|.+|..|-|- -+-.+.+.+++.  |+..|++|+|+-   .+.|++.+.+.
T Consensus       111 ~e~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~~~  169 (269)
T PRK13118        111 YERFVAQAKEAGVDGLILVDLPPEEADELRAPAQAH--GLDFIRLTSPTT---SDERLPRVLEH  169 (269)
T ss_pred             HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCHHEEECCCC---CHHHHHHHHHC
T ss_conf             999999999859974645899978999999999975--984640369898---78999999843


No 128
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional
Probab=82.23  E-value=2.8  Score=21.84  Aligned_cols=124  Identities=19%  Similarity=0.248  Sum_probs=70.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEE---------EC----H-----HHCCE
Q ss_conf             9999768214789999999999738998399997-------1789994788065---------04----4-----45311
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSL---------FD----F-----SELSV   60 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~---------~~----~-----~~l~v   60 (383)
                      -|+.||-++=|.- .+++++|-+. +-|+-=.|+       -||--|.+....+         ++    +     ..+-+
T Consensus        19 ~y~taG~P~~e~s-~~~~~~l~~~-GaDiiElGiPfSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~v~~~r~~~~~Pivl   96 (263)
T CHL00200         19 PFITAGDPDIVIT-KKALKILDKK-GADIIELGIPYSDPLADGPIIQEASNRALKQGINLNKILSILSEVNGEIKAPIVI   96 (263)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             8870738987899-9999999976-9999997898888666589999999999977987778999999986067998899


Q ss_pred             EEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHH-HHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             013674664599999999998610012888689851177-6579999866301346311110022110036635579999
Q gi|254780767|r   61 IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPD-FTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus        61 ~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pg-Fnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      ||.+..+.++.     .++..+.+++..-|.+|.+|-|- -.-.+...+++.  |+..|++|+|+-   .+.|++++.+.
T Consensus        97 MtY~N~i~~yG-----~e~F~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~~~  166 (263)
T CHL00200         97 FTYYNPVLHYG-----INKFIKKISQAGVKGLIIPDLPYEESDYLISVCNLY--NIELILLIAPTS---SKSRIQKIARA  166 (263)
T ss_pred             EEEHHHHHHCC-----HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHHH
T ss_conf             86206888738-----899999999849986874799978889999999855--862166647899---69999999972


Q ss_pred             HH
Q ss_conf             98
Q gi|254780767|r  140 IN  141 (383)
Q Consensus       140 ~d  141 (383)
                      .+
T Consensus       167 a~  168 (263)
T CHL00200        167 AP  168 (263)
T ss_pred             CC
T ss_conf             89


No 129
>PRK13121 consensus
Probab=82.20  E-value=3.4  Score=21.26  Aligned_cols=124  Identities=19%  Similarity=0.305  Sum_probs=66.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHC-------CCEE--EEC----H------HHCC
Q ss_conf             9999768214789999999999738998399997-------17899947-------8806--504----4------4531
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKE-------GLVS--LFD----F------SELS   59 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~-------G~~~--~~~----~------~~l~   59 (383)
                      -|+.+|-+|=|.- -.++++|.+. +-|+-=.|+       -||--|++       |.+.  +++    +      ..+-
T Consensus        21 ~y~taG~P~~~~s-~~~~~~l~~~-GaDiiElGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~~Piv   98 (265)
T PRK13121         21 PFITAGDPDPAKT-VELMHALVEG-GADVIELGVPFSDPMADGPVIQRASERALAHGVSLRQVLAMVKEFRETNQTTPVV   98 (265)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEE
T ss_conf             8870718998999-9999999976-9999997898899776589999999999977998467799999831037999989


Q ss_pred             EEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHH
Q ss_conf             10136746645999999999986100128886898511776-57999986630134631111002211003663557999
Q gi|254780767|r   60 VIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCA  138 (383)
Q Consensus        60 v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~  138 (383)
                      +||.++.+.++.     .++..+.+++..-|.+|.+|.|-= .-.+.+.+++.  |+..|..|+|+-   .+.|++++.+
T Consensus        99 lM~Y~N~i~~yG-----~e~F~~~~~~aGvdGlIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~~  168 (265)
T PRK13121         99 LMGYANPIERMG-----YDAFAAAARAAGVDGVLVVDYPPEECEEFAAKMRAA--GIDPIFLLAPTS---TDERIAAVAR  168 (265)
T ss_pred             EEEHHHHHHHHH-----HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHH
T ss_conf             862145999971-----999999998729873434899989999999999865--996689958999---8999999996


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780767|r  139 YIN  141 (383)
Q Consensus       139 ~~d  141 (383)
                      ..+
T Consensus       169 ~~~  171 (265)
T PRK13121        169 VAS  171 (265)
T ss_pred             HCC
T ss_conf             289


No 130
>pfam00318 Ribosomal_S2 Ribosomal protein S2.
Probab=82.02  E-value=3.1  Score=21.49  Aligned_cols=19  Identities=37%  Similarity=0.588  Sum_probs=12.7

Q ss_pred             HHHHHHHHCCCEEEECCCC
Q ss_conf             6688876275302540577
Q gi|254780767|r  278 VILELALCGIPVVSIYKSE  296 (383)
Q Consensus       278 aTLE~al~g~P~IV~Yk~~  296 (383)
                      |..||..+|+|.|-+-.++
T Consensus       152 ai~Ea~~l~IP~I~ivDTn  170 (205)
T pfam00318       152 AIKEASKLGIPVIAIVDTN  170 (205)
T ss_pred             HHHHHHHCCCCEEEECCCC
T ss_conf             9999987599756540599


No 131
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional
Probab=82.01  E-value=2.6  Score=22.03  Aligned_cols=122  Identities=18%  Similarity=0.292  Sum_probs=64.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEEE-------------CH-----HHC
Q ss_conf             99997682147899999999997389983999971---------7899947880650-------------44-----453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSLF-------------DF-----SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~~-------------~~-----~~l   58 (383)
                      -|+.+|-+|=|.- .+++++|.+. +-|  +.=+|         ||--|++....+-             .+     ..+
T Consensus        13 ~y~taG~P~~e~~-~~~~~~l~~~-Gad--~iEiGiPfSDP~aDGpvIq~a~~~AL~~G~~~~~~f~~~~~~r~~~~~pi   88 (256)
T PRK13111         13 PYITAGDPDLETS-LEILKALVEA-GAD--IIELGIPFSDPVADGPVIQRASLRALAAGVTLADVLELLREIRAKPTIPI   88 (256)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-CCC--EEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8870708998999-9999999965-999--99978887887665799999999999779969999999999860689988


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      -+||.+..+-++.     .++..+.+++..-|.+|..|-|-= .-.+.+.++++  |+..|+.|+|+-   .+.|++.+.
T Consensus        89 vlM~Y~N~i~~~G-----~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--gi~~I~lvaPtt---~~~Ri~~i~  158 (256)
T PRK13111         89 VLMTYYNPIFQYG-----VEAFAADAAEAGVDGLIIPDLPPEEAEEFRAAAKKH--GIDLIFLVAPTT---TDERLKKIA  158 (256)
T ss_pred             EEEEECCHHHHHC-----HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCEEEEEECCCC---CHHHHHHHH
T ss_conf             9985030898709-----999999999759977981699978889999999975--980899969999---889999999


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780767|r  138 AYIN  141 (383)
Q Consensus       138 ~~~d  141 (383)
                      +..+
T Consensus       159 ~~s~  162 (256)
T PRK13111        159 SHAS  162 (256)
T ss_pred             HHCC
T ss_conf             6269


No 132
>PRK03367 consensus
Probab=81.74  E-value=4.2  Score=20.65  Aligned_cols=105  Identities=18%  Similarity=0.333  Sum_probs=57.3

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHH-----HHCCCEEEE-CH-----------HHCCEEEH
Q ss_conf             98745999976821478999999999973899839999717899-----947880650-44-----------45311013
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSL-----QKEGLVSLF-DF-----------SELSVIGI   63 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m-----~~~G~~~~~-~~-----------~~l~v~G~   63 (383)
                      |++-||.|+.|+++|  .|-.++-.+.++ ....++.-+|.+..     +..|+..-+ .+           ..+.+.-+
T Consensus         2 m~~~~IaIT~GDPaG--IGPEIi~kl~~~-~~~~~~iv~gd~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~i~~~   78 (329)
T PRK03367          2 VKNQRVVITPGEPAG--IGPDLVVQLAQR-EWPVELVVCADPALLTDRAAMLGLPLTLRPYSPDQPAQPQTAGTLTLLPV   78 (329)
T ss_pred             CCCCCEEEECCCCCH--HHHHHHHHHHHC-CCCCCEEEEECHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCEEEEECC
T ss_conf             989978998788753--189999999700-68988899978999999999759994588738876566465883478616


Q ss_pred             HH---H------HHHHHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHHH
Q ss_conf             67---4------6645999999999986100128886898------------51177657999986
Q gi|254780767|r   64 MQ---V------VRHLPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKRV  108 (383)
Q Consensus        64 ~e---v------l~~~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~l  108 (383)
                      ..   +      -.+-...++.++...+.+++.+.|++|+            ..|||-.--||++.
T Consensus        79 ~~~~~~~~G~~s~~~g~~~~~~l~~Av~~~~~g~~~alVTaPInK~~i~~aG~~f~GHTE~La~~~  144 (329)
T PRK03367         79 ALRAPVTPGQLAVENGHYVVETLARACDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERS  144 (329)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             767788889728899999999999999999829878999774158999868999898399999986


No 133
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers
Probab=81.59  E-value=1.6  Score=23.44  Aligned_cols=41  Identities=32%  Similarity=0.696  Sum_probs=27.9

Q ss_pred             HHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             986100128886898-5117765-7999986630134631111
Q gi|254780767|r   80 TVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      ..+.+.+++||++|+ +.-||.| +.+++.+|+..+.+|+|-.
T Consensus        33 al~~~~~~~~dlvi~D~~mP~~~G~el~~~ir~~~~~~pvI~l   75 (113)
T cd00156          33 ALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFL   75 (113)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEE
T ss_conf             9999875799999977999898726999999985899959999


No 134
>PRK11557 putative DNA-binding transcriptional regulator; Provisional
Probab=81.31  E-value=3.6  Score=21.09  Aligned_cols=27  Identities=4%  Similarity=0.089  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             466459999999999861001288868
Q gi|254780767|r   66 VVRHLPQFIFRINQTVELIVSSKPDVL   92 (383)
Q Consensus        66 vl~~~~~~~~~~~~~~~~i~~~~Pd~v   92 (383)
                      +-.+|+.+-+.-+++.+.|.+++.++.
T Consensus         7 I~~~~~~Lt~~Ek~IA~yIl~n~~~v~   33 (282)
T PRK11557          7 IRQRYPGLAQSDRKLADYLLLQPDTAR   33 (282)
T ss_pred             HHHHHHHCCHHHHHHHHHHHCCHHHHH
T ss_conf             999885449999999999980989997


No 135
>PRK06180 short chain dehydrogenase; Provisional
Probab=81.30  E-value=4.3  Score=20.55  Aligned_cols=35  Identities=29%  Similarity=0.326  Sum_probs=27.5

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9874599997682147899999999997389983999971
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      |++||..+++|-.||  +|..+.+.+-++   +.++.+.+
T Consensus         1 M~~~KvvlITGassG--IG~aiA~~l~~~---G~~Vi~~~   35 (277)
T PRK06180          1 MASMKTWLITGVSSG--FGRALAQAALAA---GHRVVGTV   35 (277)
T ss_pred             CCCCCEEEECCCCCH--HHHHHHHHHHHC---CCEEEEEE
T ss_conf             999988999178739--999999999987---99999998


No 136
>PRK13127 consensus
Probab=81.19  E-value=3.5  Score=21.12  Aligned_cols=120  Identities=18%  Similarity=0.295  Sum_probs=65.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEEEC---H---------------HHC
Q ss_conf             99997682147899999999997389983999971---------78999478806504---4---------------453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSLFD---F---------------SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~~~---~---------------~~l   58 (383)
                      -|+.||-++=|.- ..++++|-+. +  +.+.=+|         ||--|++....+-+   +               ..+
T Consensus        15 ~yitaG~P~~e~t-~~~l~~l~~~-G--aDiiElGiPfSDP~ADGPvIq~a~~rAL~~G~~~~~~~~~~~~~r~~~~~pi   90 (262)
T PRK13127         15 PYLVAGDPDPEAT-LEFVKALVKG-G--ADVIELGIPFSDPVADGPTIQAADVRALSAGMKIDKYFELVKELRVDSSVPL   90 (262)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8862708998999-9999999976-9--9999978988887765799999999999769979999999999745699887


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      =+||.+..+.++     -.++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|.+|+|+-   .+.|++++.
T Consensus        91 vlM~Y~N~i~~~-----G~e~F~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~--gi~~I~lvaPtt---~~~Ri~~i~  160 (262)
T PRK13127         91 VLMTYYNPVYRY-----GVEKFVKKAAEAGVSGLIIPDLPVEEATDLREACKKH--GLDLVFLVAPTT---PEERLKRID  160 (262)
T ss_pred             EEEECCHHHHHC-----CHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCEEEEEECCCC---CHHHHHHHH
T ss_conf             999661388760-----8999999998759976996699978999999999855--832799858999---899999998


Q ss_pred             HH
Q ss_conf             99
Q gi|254780767|r  138 AY  139 (383)
Q Consensus       138 ~~  139 (383)
                      +.
T Consensus       161 ~~  162 (262)
T PRK13127        161 EA  162 (262)
T ss_pred             HC
T ss_conf             43


No 137
>PRK13123 consensus
Probab=81.18  E-value=2.7  Score=21.91  Aligned_cols=124  Identities=23%  Similarity=0.278  Sum_probs=69.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEEEC---H-------------HHCCEEE
Q ss_conf             9999768214789999999999738998399997-------178999478806504---4-------------4531101
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSLFD---F-------------SELSVIG   62 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~~~---~-------------~~l~v~G   62 (383)
                      -|+.||.+|=|.- ..++++|-+. +-|+-=.|+       -||--|.+....+-+   +             ..+=+||
T Consensus        19 ~yitaG~P~~~~~-~~~i~~l~~~-GaDiiElGiPFSDPvADGPvIq~A~~rAL~~G~~~~~~~~~~~~~~~~~PivlMt   96 (256)
T PRK13123         19 PYIMAGDGGLDGL-KETIRFLEEA-GVSAIEIGIPFSDPVADGPVIQLAGLRALASGVSLKAILQALIEKETQIPLVIMT   96 (256)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             8861868997899-9999999976-9999997899888666579999989999867996999998876305799889740


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHH
Q ss_conf             36746645999999999986100128886898511776-57999986630134631111002211003663557999998
Q gi|254780767|r   63 IMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYIN  141 (383)
Q Consensus        63 ~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d  141 (383)
                      .+.++.+|.     .++..+.+++..-|.+|..|-|-- .-.+.+.+++.  |+..|+.|+|+-   .+.|++.+.+..+
T Consensus        97 Y~N~i~~yG-----~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--gi~~I~liaPtt---~~~Ri~~i~~~a~  166 (256)
T PRK13123         97 YINPVFQYG-----IERFVEDLAETGVKGLIIPDLPYEHQDFIAPLLRDT--DIALIPLVSLTS---PIERQKEIIKEAE  166 (256)
T ss_pred             HHHHHHHCC-----HHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEECCCCC---CHHHHHHHHHCCC
T ss_conf             425898718-----999999999749978973799967899999999976--997786408999---3889999986078


No 138
>PRK13138 consensus
Probab=81.15  E-value=2.5  Score=22.14  Aligned_cols=121  Identities=19%  Similarity=0.220  Sum_probs=58.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC----H------HH
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04----4------45
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD----F------SE   57 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~----~------~~   57 (383)
                      -|+.||.++=|.- ..++++|-+. +  +.+.=+|         ||--|++....+         ++    +      ..
T Consensus        17 ~yitaG~P~~e~t-~~~~~~l~~~-G--adiiEiGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~p   92 (264)
T PRK13138         17 PYISLGDPDYDSC-IIWADALIRG-G--AGILELGIPFSDPVADGPVIQKAFKRALAHPFSMDKILEITAEIHKLHPEIP   92 (264)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCC
T ss_conf             8867879998999-9999999977-9--9989979988886665899999999999779908897446776033589888


Q ss_pred             CCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHH---HHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHH
Q ss_conf             311013674664599999999998610012888689851177---65799998663013463111100221100366355
Q gi|254780767|r   58 LSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPD---FTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRAR  134 (383)
Q Consensus        58 l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pg---Fnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k  134 (383)
                      +=.||....+.++.     .++..+.+++..-|.+|..|-|-   -.-.+...+++.  |+..|++|+|+-   .+.|++
T Consensus        93 ivlM~Y~N~i~~~G-----~e~F~~~~~~~GvdGlIipDLP~e~~E~~~~~~~~~~~--~i~~I~liaPtt---~~~Ri~  162 (264)
T PRK13138         93 LVYLTYFNPLFSMG-----LEAFTERAKNSGIQGLIIPDLPFDTPEAEEFFSQLERK--KIDFIHLVTPAT---TEDRIQ  162 (264)
T ss_pred             EEEEEEHHHHHHHC-----HHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHC--CCCEEEECCCCC---CHHHHH
T ss_conf             89752123898848-----99999999876977585368986503359999999986--998675217999---899999


Q ss_pred             HHHHHH
Q ss_conf             799999
Q gi|254780767|r  135 KMCAYI  140 (383)
Q Consensus       135 ~~~~~~  140 (383)
                      .+.+..
T Consensus       163 ~i~~~s  168 (264)
T PRK13138        163 SMKSFA  168 (264)
T ss_pred             HHHHHC
T ss_conf             999738


No 139
>PRK02304 adenine phosphoribosyltransferase; Provisional
Probab=80.85  E-value=3.5  Score=21.18  Aligned_cols=54  Identities=11%  Similarity=0.100  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             674664599999999998610012888689851177657999986630134631111
Q gi|254780767|r   64 MQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        64 ~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      +..+.+--.+....+.+.+.+...++|.+++||+-||-+--+=..+   .++|.+-.
T Consensus        26 tpll~dp~~~~~~~~~l~~~~~~~~vD~IvgiEarGfi~a~alA~~---l~~p~v~i   79 (174)
T PRK02304         26 TPLLADPEALREVIDALVERYKDADIDKIVGIEARGFIFGAALAYK---LGIGFVPV   79 (174)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCEECCHHHHHH---HCCCEEEE
T ss_conf             2476599999999999999843489989999865552101588998---29987999


No 140
>PRK13135 consensus
Probab=80.77  E-value=4.4  Score=20.50  Aligned_cols=122  Identities=19%  Similarity=0.270  Sum_probs=61.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEEEC---H---------------HHC
Q ss_conf             99997682147899999999997389983999971---------78999478806504---4---------------453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSLFD---F---------------SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~~~---~---------------~~l   58 (383)
                      -|+.||-+|=|.- ..++++|.+. +  +.+.=+|         ||--|.+....+-+   +               ..+
T Consensus        21 ~yitaG~P~~~~s-~~~l~~l~~~-G--aDiiElGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~Pi   96 (267)
T PRK13135         21 TFITAGDPDLATT-EALIPLLAES-G--ADIIELGVPFSDPMADGPTIQLSSERALAAGTTLPRILAMVRSVRRRCQVPI   96 (267)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8871718998999-9999999975-9--9999978998986665899999999999769849999999998633589988


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      =+||.+..+.+|     -.++..+.+++..-|.+|.+|-|-= .-.+...+++.  |+..|++|+|+-   .+.|++++.
T Consensus        97 vlM~Y~N~i~~y-----G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~--~l~~I~lvsPtt---~~~Ri~~i~  166 (267)
T PRK13135         97 VLMGYYNPIFAY-----GLERFAADAAAAGVDGVLLVDLPPEEAEEFKACADRH--GLDVIFLLTPTS---DESRIRTVA  166 (267)
T ss_pred             EEEECCHHHHHH-----HHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHH
T ss_conf             998423099884-----6899999999749974763789978889999999872--961899808989---579999999


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780767|r  138 AYIN  141 (383)
Q Consensus       138 ~~~d  141 (383)
                      +..+
T Consensus       167 ~~s~  170 (267)
T PRK13135        167 RLGR  170 (267)
T ss_pred             HCCC
T ss_conf             6189


No 141
>PRK13119 consensus
Probab=80.76  E-value=4.5  Score=20.43  Aligned_cols=122  Identities=18%  Similarity=0.302  Sum_probs=59.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE------C-CHHHHHCCCEEE---------EC----H------HHCC
Q ss_conf             9999768214789999999999738998399997------1-789994788065---------04----4------4531
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV------G-GPSLQKEGLVSL---------FD----F------SELS   59 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi------G-G~~m~~~G~~~~---------~~----~------~~l~   59 (383)
                      -|+.||-++=|.- ..++++|-+. +-|+-=.|+      . ||--|++....+         ++    +      ..+-
T Consensus        19 ~yltaG~P~~e~s-~~~l~~l~~~-GadiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~piv   96 (261)
T PRK13119         19 PYITVGDPDIRTT-LALMHGMVAN-GADILELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVV   96 (261)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEE
T ss_conf             8864838998999-9999999966-9999997898888666589999999999977997889999999865148998989


Q ss_pred             EEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHH
Q ss_conf             10136746645999999999986100128886898511776-57999986630134631111002211003663557999
Q gi|254780767|r   60 VIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCA  138 (383)
Q Consensus        60 v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~  138 (383)
                      +||...++.++     -.++..+.+++..-|.+|..|-|-- .-.+.+.+++.  |+..|..|+|+-   .+.|++++.+
T Consensus        97 lMtY~N~i~~y-----G~e~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~~  166 (261)
T PRK13119         97 LMGYLNPVHKM-----GYREFAQEAAKAGVDGVLTVDSPVETIDPLYRELKDN--GVDCIFLIAPTT---TEDRIKTIAE  166 (261)
T ss_pred             EEECHHHHHHH-----HHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHH
T ss_conf             98403789886-----2999999999759857983689978879999999975--997644307999---8999999997


Q ss_pred             H
Q ss_conf             9
Q gi|254780767|r  139 Y  139 (383)
Q Consensus       139 ~  139 (383)
                      .
T Consensus       167 ~  167 (261)
T PRK13119        167 L  167 (261)
T ss_pred             H
T ss_conf             2


No 142
>PRK09390 fixJ response regulator FixJ; Provisional
Probab=80.75  E-value=1.9  Score=22.95  Aligned_cols=35  Identities=17%  Similarity=0.321  Sum_probs=14.3

Q ss_pred             CCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEE
Q ss_conf             0128886898-5117765-799998663013463111
Q gi|254780767|r   85 VSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        85 ~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~  119 (383)
                      ...+||+|++ +.=||.| +.+.+.+|++.+.+|++-
T Consensus        44 ~~~~pdlvllDi~mP~~~G~e~l~~l~~~~p~~~viv   80 (202)
T PRK09390         44 PGLRFGCVVTDVRMPGIDGIELLRRLKARGSPLPVIV   80 (202)
T ss_pred             HCCCCCEEEECCCCCCCCCHHHHHHHHHCCCCCCEEE
T ss_conf             6579799987799999896079999872289986799


No 143
>PRK06555 pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated
Probab=80.21  E-value=4.7  Score=20.31  Aligned_cols=118  Identities=17%  Similarity=0.185  Sum_probs=62.4

Q ss_pred             CCCCEEEEEE-CCCCHHHHHH--HHHHHHHHHCCCCEEEEEEC-CHH-HHHCCCEEEEC-----HHHCCEEEHH------
Q ss_conf             9874599997-6821478999--99999997389983999971-789-99478806504-----4453110136------
Q gi|254780767|r    1 MNSLKIAVIA-GEISGDLLAG--DLIKSLKEMVSYPINLVGVG-GPS-LQKEGLVSLFD-----FSELSVIGIM------   64 (383)
Q Consensus         1 m~~mki~i~a-GE~SGD~~~a--~li~~Lk~~~~~~~~~~giG-G~~-m~~~G~~~~~~-----~~~l~v~G~~------   64 (383)
                      |+++||-|++ |...-=+.++  .+++++.+. .++.+++|+= |-+ +-......+.+     ...+.-.|=.      
T Consensus         1 ms~kriaIlTsGGd~PGlNavIr~vV~~~~~~-~~~~eV~G~~~Gy~GLl~~~~~~l~~~~~~~~~~l~~~GGTiLGSsR   79 (403)
T PRK06555          1 MAKKKVAMLTAGGLAPCLSSAVGGLIERYTDV-APEIEIIAYKSGYQGLLLGDSIEITPAMREKAHLLHRHGGSPIGNSR   79 (403)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH-CCCEEEEEECCCHHHHCCCCCEECCHHHHHHHHHHHCCCCCEECCCC
T ss_conf             99888999898776288999999999999861-79849999872148756999550786677777566228977671798


Q ss_pred             -------HHHHHH--HHHHHHHHHHHHHCCCCCCCEEEEE---CHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             -------746645--9999999999861001288868985---117765799998663013463111
Q gi|254780767|r   65 -------QVVRHL--PQFIFRINQTVELIVSSKPDVLLIV---DNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        65 -------evl~~~--~~~~~~~~~~~~~i~~~~Pd~vi~i---D~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                             +.+++.  +.-....+.+.+.+++...|.++.|   |+-.=-.+|++++++++.++++|.
T Consensus        80 ~kl~~~~d~~kr~~~~eg~d~~~~~~e~L~~~gId~L~~IGGDgS~~~A~~La~~~~~~~~~i~VVG  146 (403)
T PRK06555         80 VKLTNAADCVKRGLVKEGEDPLRVAAERLASDGVDILHTIGGDDTNTTAADLAAYLAANGYDLTVVG  146 (403)
T ss_pred             CCCCCCCCCHHCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             8877753200114431353599999999998299999998880599999999999997399952896


No 144
>TIGR01182 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4.1.3.16 from EC) (KHG-aldolase) catalyzes the interconversion of 4-hydroxy-2-oxoglutarate into pyruvate and glyoxylate. Phospho-2-dehydro-3-deoxygluconate aldolase (4.1.2.14 from EC) (KDPG-aldolase) catalyzes the interconversion of 6-phospho-2-dehydro-3-deoxy-D-gluconate into pyruvate and glyceraldehyde 3-phosphate. These two enzymes are structurally and functionally related . They are both homotrimeric proteins of approximately 220 amino-acid residues. They are class I aldolases whose catalytic mechanism involves the formation of a Schiff-base intermediate between the substrate and the epsilon-amino group of a lysine residue. In both enzymes, an arginine is required for catalytic activity.; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=79.95  E-value=1.4  Score=23.72  Aligned_cols=26  Identities=31%  Similarity=0.341  Sum_probs=12.5

Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHCCC
Q ss_conf             38743012305111899987640273
Q gi|254780767|r  200 GSRAQEIYKILPFFESAVASLVKRNP  225 (383)
Q Consensus       200 GSR~~EI~~~lP~~l~~~~~l~~~~~  225 (383)
                      |=|--||..--|.=+++++.|++++|
T Consensus        33 G~~~~EvTlRT~~A~~aI~~l~~~~P   58 (205)
T TIGR01182        33 GLRVLEVTLRTPVALEAIRALRKEVP   58 (205)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             98089885147216899999997282


No 145
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentially c
Probab=79.86  E-value=4.8  Score=20.24  Aligned_cols=60  Identities=20%  Similarity=0.338  Sum_probs=39.3

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEE-ECHHHHHHHHHHHHHHH--CCCCCCEEEECCC-CCCCCCCC
Q ss_conf             9999999986100128886898-51177657999986630--1346311110022-11003663
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLI-VDNPDFTHRVAKRVRKK--MPNLPIINYVCPS-VWAWREGR  132 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~-iD~pgFnl~lak~lkk~--~~~ipvi~yv~Pq-vWAWr~~R  132 (383)
                      ....+++..+...+.+.+++|+ +|+||=-+.=+..+.+.  ...+|++-||.|. -|||-.+-
T Consensus        14 ~~~~l~r~l~~A~~~~a~avvl~idTpGG~v~~~~~I~~~i~~s~vpvi~~V~p~G~~A~SAGa   77 (187)
T cd07020          14 TADYLERAIDQAEEGGADALIIELDTPGGLLDSTREIVQAILASPVPVVVYVYPSGARAASAGT   77 (187)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
T ss_conf             9999999999998689989999985896078999999999981899989998789760771899


No 146
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
Probab=79.86  E-value=3.2  Score=21.43  Aligned_cols=101  Identities=19%  Similarity=0.197  Sum_probs=58.8

Q ss_pred             CCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCC-EEEEHHHCCCCCCCHHHCCCCCH
Q ss_conf             2035788763552331-----15668887627530254057741000010246761-02302440784261242054898
Q gi|254780767|r  260 QKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWT-CALPNLIVDYPLVPEYFNSMIRS  333 (383)
Q Consensus       260 ~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~-i~LpNii~~~~ivPEliQ~~~~~  333 (383)
                      +-++.+..||+.+-.|     |=--||++.+|+|+|+. .++.+--|+...+..+. -|.  .+.+|.-    ...+-+.
T Consensus       467 ~Y~efv~Gc~LgVFPSyYEPWGYTPlE~~a~gvPsITT-dLsGFG~~~~~~~~~~~~~GV--~VvdR~~----~~~~Esv  539 (590)
T cd03793         467 DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITT-NLSGFGCFMEEHIEDPESYGI--YIVDRRF----KSPDESV  539 (590)
T ss_pred             CHHHHHCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEEC-CCHHHHHHHHHHHCCCCCCCE--EEEECCC----CCHHHHH
T ss_conf             69999645765557653488788869887627980221-660377999986416423747--9997898----9979999


Q ss_pred             HHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             999999999844-9899999999999999983899
Q gi|254780767|r  334 EALVRWIERLSQ-DTLQRRAMLHGFENLWDRMNTK  367 (383)
Q Consensus       334 ~~i~~~~~~ll~-d~~~r~~~~~~~~~~~~~Lg~~  367 (383)
                      +.|++.+.++-. +...|.++++...++.+.+...
T Consensus       540 ~~l~~~~~~f~~~s~~qr~~~R~rae~ls~~~dW~  574 (590)
T cd03793         540 QQLTQYMYEFCQLSRRQRIIQRNRTERLSDLLDWR  574 (590)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCHH
T ss_conf             99999999997499999999999999999866899


No 147
>PRK09739 hypothetical protein; Provisional
Probab=79.83  E-value=4.8  Score=20.23  Aligned_cols=37  Identities=16%  Similarity=0.229  Sum_probs=24.7

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHH----HHCCCCEEEEE
Q ss_conf             987459999768214789999999999----73899839999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLK----EMVSYPINLVG   38 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk----~~~~~~~~~~g   38 (383)
                      |+++||+|+-|-+.-+-..+.|.++..    +. +.++++.-
T Consensus         1 M~~kkiLIV~aHP~~~S~~~ala~~~~~~l~~~-GheV~v~D   41 (201)
T PRK09739          1 MQSERIYLVWAHPRHDSLTAKVADAIHQRAQER-GIQVTELD   41 (201)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEEE
T ss_conf             997779999738998656899999999999987-99599997


No 148
>TIGR02015 BchY chlorophyllide reductase subunit Y; InterPro: IPR010245   This entry represents the Y subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , . This enzyme is responsible for the reduction of the chlorin B-ring and is closely related to the protochlorophyllide reductase complex which reduces the D-ring. Both of these complexes in turn are homologous to nitrogenase.; GO: 0016731 oxidoreductase activity acting on iron-sulfur proteins as donors NAD or NADP as acceptor, 0015979 photosynthesis, 0030494 bacteriochlorophyll biosynthetic process, 0016021 integral to membrane.
Probab=79.78  E-value=0.98  Score=24.79  Aligned_cols=225  Identities=16%  Similarity=0.129  Sum_probs=105.2

Q ss_pred             CCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHH--HHCCCCCCCHH---HHHCC
Q ss_conf             001288868985-1177657999986630134631111002211003663557999998--64015677422---32002
Q gi|254780767|r   84 IVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYIN--QVISILPFEKE---VMQRL  157 (383)
Q Consensus        84 i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d--~~~~ifpFE~~---~f~k~  157 (383)
                      -++.+|.++++= =||-=-+-+...|++.  |+-..--++-.     +|  +.+-...|  .+..|.||=..   -|+. 
T Consensus       163 ~R~~~~t~~lLGEiFPvDa~~Ig~~L~~~--G~~~~~~~P~~-----d~--~~~~~A~~~~~~A~lHPFY~~~~~~F~a-  232 (426)
T TIGR02015       163 SRDDKPTLVLLGEIFPVDAMVIGGLLQPL--GVESGPTVPGR-----DW--RELYAALDSSVVAVLHPFYEATAREFEA-  232 (426)
T ss_pred             CCCCCCCEEEECCCCCCCHHHHHHHHHHC--CCEEEECCCCH-----HH--HHHHHHCCCCEEEEECCHHHHHHHHHHH-
T ss_conf             55567617896032463288999898741--84023105732-----08--9999750443466525347999999985-


Q ss_pred             CCCCEEECCCCCCCCCCC---------------------CCCHHHHHHHC-CCCCCCCEEEEEECCCCCCHHHHCCCHHH
Q ss_conf             553147638821122100---------------------13558889761-87655650599853874301230511189
Q gi|254780767|r  158 GGPPTTFVGHPLSSSPSI---------------------LEVYSQRNKQR-NTPSQWKKILLLPGSRAQEIYKILPFFES  215 (383)
Q Consensus       158 ~~~~~~fVGHPl~d~~~~---------------------~~~~~~~~~~~-~~~~~~~~I~llPGSR~~EI~~~lP~~l~  215 (383)
                      .|.++. =|+|+-.+-..                     ...++..+... +....-+-=.++-|=-.+|+        -
T Consensus       233 AG~~iv-Gs~PvG~~~T~~Wl~~IG~Ald~~p~~~~~~~~~~r~~~~g~~AGfa~~~~g~~~v~GYEG~EL--------~  303 (426)
T TIGR02015       233 AGKKIV-GSAPVGANGTGEWLERIGEALDLDPDTVKTVAEELRKKIKGAIAGFAEPIKGRVTVSGYEGSEL--------L  303 (426)
T ss_pred             CCCCEE-CCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHH--------H
T ss_conf             696122-5888771158999998655407888899999988668899998501566224689851156268--------8


Q ss_pred             HHHHHHHCCCCCEEEECCCC--CHHHHHHHHHHHCCCCCEEEEECCCCHHHHH--HHHHHHCCCHHHHH--HHHHHCCCE
Q ss_conf             99876402735126201663--3688999999604888505520552035788--76355233115668--887627530
Q gi|254780767|r  216 AVASLVKRNPFFRFSLVTVS--SQENLVRCIVSKWDISPEIIIDKEQKKQVFM--TCNAAMAASGTVIL--ELALCGIPV  289 (383)
Q Consensus       216 ~~~~l~~~~~~~~~~i~~~~--~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~--~sd~ai~~SGTaTL--E~al~g~P~  289 (383)
                      .++.|.+.--++.++--..+  ......+..+...+...+---.-++--.++.  .=|++|   ||.+|  .+=-.|+|.
T Consensus       304 ~~RLL~E~G~dv~Y~~ta~~rT~~~~~D~~~L~~~G~~VkyR~~LE~D~~Av~~f~PDL~I---GTT~l~~~AK~~GiPa  380 (426)
T TIGR02015       304 VVRLLLESGADVPYVGTAIPRTAWGAEDKEWLEALGVEVKYRASLEDDMEAVEEFEPDLAI---GTTPLVQFAKEKGIPA  380 (426)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCEEEECCCHHHHHHHHHCCCCCEEE---ECCCHHHHHHHCCCCE
T ss_conf             8898887077533100135677542667999984795588602236789999616997576---1673567877548961


Q ss_pred             EEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             2540577410000102467610230244078426124205489899999999984498999999999
Q gi|254780767|r  290 VSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHG  356 (383)
Q Consensus       290 IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~  356 (383)
                      +  |-                   .|+|+-|+++     ...-+.-++.-+.-++++.+.--+|.+-
T Consensus       381 l--Yf-------------------TN~ISARPl~-----~~aGA~Sl~~~i~~~~~~r~~~g~M~~f  421 (426)
T TIGR02015       381 L--YF-------------------TNLISARPLM-----GPAGAGSLLQVINGALENRERYGRMKEF  421 (426)
T ss_pred             E--EH-------------------HHCHHHCCCC-----CCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2--11-------------------1011203221-----0001789999999987405676656742


No 149
>pfam00551 Formyl_trans_N Formyl transferase. This family includes the following members. Glycinamide ribonucleotide transformylase catalyses the third step in de novo purine biosynthesis, the transfer of a formyl group to 5'-phosphoribosylglycinamide. Formyltetrahydrofolate deformylase produces formate from formyl- tetrahydrofolate. Methionyl-tRNA formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. Inclusion of the following members is supported by PSI-blast. HOXX_BRAJA (P31907) contains a related domain of unknown function. PRTH_PORGI (P46071) contains a related domain of unknown function. Y09P_MYCTU (Q50721) contains a related domain of unknown function.
Probab=79.01  E-value=2.9  Score=21.73  Aligned_cols=95  Identities=15%  Similarity=0.181  Sum_probs=48.6

Q ss_pred             CEEEEEE-CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4599997-682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    4 LKIAVIA-GEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         4 mki~i~a-GE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      |||.|.+ |.-|   -...+++++++. +.++++.+|-.++-.+.|.+.   ....++--+.=.-+.+..-...-.++.+
T Consensus         1 mkiavl~SG~Gs---nl~~Il~a~~~~-~l~~~I~~Visn~~~~~~~~~---a~~~~ip~~~~~~~~~~~r~~~~~~~~~   73 (181)
T pfam00551         1 MKIAVLISGTGS---NLQALLDALRKG-GHEVEIVAVVTNKDKAAGLER---AEQAGIPVEVFEHKNFTPRSQFDSELAD   73 (181)
T ss_pred             CEEEEEECCCCH---HHHHHHHHHHHC-CCCCEEEEEEECCCCHHHHHH---HHHCCCCEEEECCCCCCCHHHHHHHHHH
T ss_conf             989999907966---599999999819-999889999958957288889---9985999898067789983461899999


Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHH
Q ss_conf             10012888689851177657999986
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRV  108 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~l  108 (383)
                      .+++.+||++|+.-   |+.-+-+..
T Consensus        74 ~l~~~~~Dliv~~g---~~~il~~~~   96 (181)
T pfam00551        74 SLAALAPDLIVLAG---YMRILPPEF   96 (181)
T ss_pred             HHHHHCCCEEEEEC---HHHHCCHHH
T ss_conf             99974999999801---633569789


No 150
>PRK07454 short chain dehydrogenase; Provisional
Probab=78.89  E-value=5.2  Score=20.04  Aligned_cols=35  Identities=23%  Similarity=0.322  Sum_probs=25.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9874599997682147899999999997389983999971
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      |++||+-+++|-.||  .|..+.+.|-+.   +.++..++
T Consensus         3 ~~~mKvalITGas~G--IG~a~A~~la~~---G~~V~l~~   37 (241)
T PRK07454          3 LNSMPTALITGASRG--IGKATALAFAKA---GWDLALVA   37 (241)
T ss_pred             CCCCCEEEECCCCCH--HHHHHHHHHHHC---CCEEEEEE
T ss_conf             899988999175878--999999999987---99899998


No 151
>cd01143 YvrC Periplasmic binding protein YvrC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria and archaea.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=78.42  E-value=1.9  Score=22.91  Aligned_cols=60  Identities=20%  Similarity=0.340  Sum_probs=36.3

Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             98610012888689851177657999986630134631111002211003663557999998640156774
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFE  150 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE  150 (383)
                      -.+.+.+-+||+||..+  +..-.....+++.  |||++++-.|+-|       ..+.+.+..+--+|--|
T Consensus        52 n~E~i~~l~PDLVi~~~--~~~~~~~~~L~~~--gi~v~~~~~~~~~-------~~~~~~i~~lg~i~g~~  111 (195)
T cd01143          52 NVEKIVALKPDLVIVSS--SSLAELLEKLKDA--GIPVVVLPAASSL-------DEIYDQIELIGKITGAE  111 (195)
T ss_pred             CHHHHHCCCCCEEEEEC--CCCHHHHHHHHHC--CCEEEEECCCCCH-------HHHHHHHHHHHHHHCCH
T ss_conf             99999616999999827--8747799998641--8859997589999-------99999999999996974


No 152
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional
Probab=77.71  E-value=5.6  Score=19.82  Aligned_cols=119  Identities=13%  Similarity=0.277  Sum_probs=59.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEEE---CH------------HHCCEE
Q ss_conf             99997682147899999999997389983999971---------7899947880650---44------------453110
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSLF---DF------------SELSVI   61 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~~---~~------------~~l~v~   61 (383)
                      -|+.||-++=+.-. .++++|.+.    +.+.=+|         ||--|++..+.+.   ++            ..+-.|
T Consensus         9 ~yitaG~P~~e~s~-~~l~~l~~~----aDiiElGiPfSDPvADGpvIq~A~~~Al~~g~~~~~i~~~~r~~~~~pivlM   83 (247)
T PRK13125          9 VYLTAGWPNAETFL-EAIDGLVGL----VDFLELGIPPKNPKYDGPVIRKAHREVSYWGLDYWSLLEEVRKKVGVPTYIM   83 (247)
T ss_pred             EEEECCCCCHHHHH-HHHHHHHHC----CCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCEEEH
T ss_conf             88718379989999-999998647----9999979988987666099999999998769989999998505689988972


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHH----HHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             1367466459999999999861001288868985117----765799998663013463111100221100366355799
Q gi|254780767|r   62 GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNP----DFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        62 G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~p----gFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      |...+      +..-.++..+.+++..-|.+|..|-|    +=.-.+.+.++++  |+..|.+|+|+-   .+.|++.+.
T Consensus        84 ~Y~N~------~~~g~e~F~~~~~~~GvdGvIipDLP~e~~ee~~~~~~~~~~~--gl~~I~lvsPtt---~~~ri~~i~  152 (247)
T PRK13125         84 TYLED------YVGSLDDLLNTAKEVGARGVLFPDLLIDFPDELEKYVELIRRY--GLAPVFFTSPKF---PDRLIRRLS  152 (247)
T ss_pred             HHHHH------HHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHH
T ss_conf             98899------9976999999999859975883388875467899999999976--984699957998---199999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780767|r  138 AYI  140 (383)
Q Consensus       138 ~~~  140 (383)
                      +..
T Consensus       153 ~~s  155 (247)
T PRK13125        153 KLS  155 (247)
T ss_pred             HHC
T ss_conf             868


No 153
>cd05013 SIS_RpiR RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate isomerases that catalyze the reversible reactions of ribose 5-phosphate into ribulose 5-phosphate.
Probab=77.68  E-value=5.6  Score=19.81  Aligned_cols=108  Identities=17%  Similarity=0.165  Sum_probs=61.0

Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHH-HHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHH
Q ss_conf             99999997389983999971789994788065044453110136-74664599999999998610012888689851177
Q gi|254780767|r   21 DLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIM-QVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPD   99 (383)
Q Consensus        21 ~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~-evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pg   99 (383)
                      +.++.|++. + .+-++|.|....-+.-+     ...+..+|.. +.+.....      .......-.+-|++|.+.++|
T Consensus         5 ~~~~~i~~a-~-~I~i~G~G~S~~~A~~~-----~~~l~~~g~~~~~~~~~~~------~~~~~~~~~~~d~~i~iS~sg   71 (139)
T cd05013           5 KAVDLLAKA-R-RIYIFGVGSSGLVAEYL-----AYKLLRLGKPVVLLSDPHL------QLMSAANLTPGDVVIAISFSG   71 (139)
T ss_pred             HHHHHHHCC-C-EEEEEECCHHHHHHHHH-----HHHHCCCCCEEEECCCHHH------HHHHHHCCCCCCEEEEECCCC
T ss_conf             999999759-9-28999808159999999-----9997258982798796277------888874599999999976863


Q ss_pred             H---HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH
Q ss_conf             6---579999866301346311110022110036635579999986401567742
Q gi|254780767|r  100 F---THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEK  151 (383)
Q Consensus       100 F---nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~  151 (383)
                      .   -+++++.+|++  |+|++-.-+        ..-..+.++.|..+.+.--|.
T Consensus        72 ~~~~~~~~~~~ak~~--g~~ii~IT~--------~~~s~l~~~ad~~l~~~~~~~  116 (139)
T cd05013          72 ETKETVEAAEIAKER--GAKVIAITD--------SANSPLAKLADIVLLVSSEEG  116 (139)
T ss_pred             CCHHHHHHHHHHHHC--CCEEEEEEC--------CCCCHHHHHCCEEEECCCCCC
T ss_conf             637899999999986--997999979--------999977996999998288655


No 154
>PRK09468 ompR osmolarity response regulator; Provisional
Probab=77.50  E-value=2.5  Score=22.12  Aligned_cols=42  Identities=17%  Similarity=0.282  Sum_probs=31.5

Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             86100128886898-5117765-799998663013463111100
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+.+..++||++|+ +.-||.| +.+.+.+|+....+|+|..-+
T Consensus        42 ~~~~~~~~~DlvilDi~lp~~dG~~l~~~iR~~~~~~pII~LTa   85 (239)
T PRK09468         42 DRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQNNPTPIIMLTA   85 (239)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCEEEEEC
T ss_conf             99997589989998789988887346777875057877899946


No 155
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional
Probab=77.46  E-value=2.5  Score=22.15  Aligned_cols=46  Identities=4%  Similarity=-0.030  Sum_probs=20.5

Q ss_pred             CCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             48989999999998449899999999999999983899998999999999861
Q gi|254780767|r  330 MIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       330 ~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      -++-+.|++.+.  +..    +....-...+.++||-.. -.+.+.-++..=|
T Consensus       158 G~snkeIA~~L~--iS~----~TV~~h~~~i~~KL~v~~-r~el~~~A~~~~l  203 (204)
T PRK09958        158 GKDNNDIAEKMF--ISN----KTVSTYKSRLMEKLECKS-LMDLYTFAQRNKI  203 (204)
T ss_pred             CCCHHHHHHHHC--CCH----HHHHHHHHHHHHHHCCCC-HHHHHHHHHHCCC
T ss_conf             999999998978--899----999999999999848999-9999999998289


No 156
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones]
Probab=77.03  E-value=5.8  Score=19.70  Aligned_cols=63  Identities=16%  Similarity=0.302  Sum_probs=42.1

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEE-ECHHHH----HHHHHHHHHHHCCCCCCEEEECCC-CCCCCCCCHHHH
Q ss_conf             99999999986100128886898-511776----579999866301346311110022-110036635579
Q gi|254780767|r   72 QFIFRINQTVELIVSSKPDVLLI-VDNPDF----THRVAKRVRKKMPNLPIINYVCPS-VWAWREGRARKM  136 (383)
Q Consensus        72 ~~~~~~~~~~~~i~~~~Pd~vi~-iD~pgF----nl~lak~lkk~~~~ipvi~yv~Pq-vWAWr~~R~k~~  136 (383)
                      .......+..+...+++-|++|+ +|.||=    ..++.+....  ..+|++.||.|+ -|||-.+---.+
T Consensus        40 ~s~~~l~r~l~~A~~~~a~~vvl~ldTPGGl~~sm~~iv~~i~~--s~vPV~~yv~p~ga~AaSAGtyI~m  108 (436)
T COG1030          40 ASADYLQRALQSAEEENAAAVVLELDTPGGLLDSMRQIVRAILN--SPVPVIGYVVPDGARAASAGTYILM  108 (436)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHC--CCCCEEEEECCCCCCHHCHHHHHHH
T ss_conf             79999999999998579847999960897267999999999875--9997799994898511040327988


No 157
>PRK13137 consensus
Probab=76.94  E-value=5.9  Score=19.68  Aligned_cols=123  Identities=16%  Similarity=0.200  Sum_probs=64.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEEE---CHH---------------HCCE
Q ss_conf             9999768214789999999999738998399997-------17899947880650---444---------------5311
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSLF---DFS---------------ELSV   60 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~~---~~~---------------~l~v   60 (383)
                      -|+.||-++=|.-- .++++|.+  +-|+-=.|+       -||--|++....+-   .++               .+=.
T Consensus        29 ~yitaG~P~~~~s~-~~~~~l~~--gaDiiElGiPFSDP~ADGPvIQ~A~~~AL~~G~~l~~~l~~~~~~r~~~~~Pivl  105 (266)
T PRK13137         29 PFLTAGYPSAAGFL-QVAEELLA--YADLLEVGIPYSDPLGDGPTIQRASEQALAGGTSTRRTLELVRELRALTDTPLVI  105 (266)
T ss_pred             EEECCCCCCHHHHH-HHHHHHHC--CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCEEE
T ss_conf             78668188878999-99999973--8998997899888566579999999999977986778999999755568987899


Q ss_pred             EEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             0136746645999999999986100128886898511776-579999866301346311110022110036635579999
Q gi|254780767|r   61 IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus        61 ~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      ||....+.+     .-.++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|+.|+|+-   .+.|++.+.+.
T Consensus       106 M~Y~N~i~~-----yG~e~F~~~a~~aGvdGlIipDLP~eE~~~~~~~~~~~--gi~~I~lvaPtT---~~eRi~~i~~~  175 (266)
T PRK13137        106 MTYLNPIYA-----VGPEEFMRLFQEAGVDGLILPDLPPDQDPEIADLAAEI--GLAVTFLIAPTS---TPERVKLVARA  175 (266)
T ss_pred             EECHHHHHH-----HCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHHH
T ss_conf             934589987-----58999999999769609994799978889999999875--997899937999---99999999960


Q ss_pred             HH
Q ss_conf             98
Q gi|254780767|r  140 IN  141 (383)
Q Consensus       140 ~d  141 (383)
                      .+
T Consensus       176 a~  177 (266)
T PRK13137        176 CT  177 (266)
T ss_pred             CC
T ss_conf             88


No 158
>PRK13129 consensus
Probab=76.48  E-value=6  Score=19.60  Aligned_cols=120  Identities=15%  Similarity=0.267  Sum_probs=54.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC----H-----HHC
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04----4-----453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD----F-----SEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~----~-----~~l   58 (383)
                      -|+.||-+|=|.- ..++++|.+. +  +.+.=+|         ||--|.+....+         ++    +     ..+
T Consensus        23 ~yitaG~P~~e~s-~~~~~~l~~~-G--aDiiEiGiPfSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~Pi   98 (267)
T PRK13129         23 PFLMAGDPDLETT-AEALLILQEN-G--ADLIELGIPYSDPLADGPVIQAAATRALQSGTTLEKVLEMLESLKGKLTIPI   98 (267)
T ss_pred             EEEECCCCCHHHH-HHHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8870718998999-9999999977-9--9999979988887765899999999999769878999999998543478888


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      =+||.+..+.++     -.++..+.+++.--|.+|..|-|-= .-.+...+++.  |+..|.+|+|+-   .+.|++++.
T Consensus        99 vlM~Y~N~i~~~-----G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~  168 (267)
T PRK13129         99 ILFTYYNPLLNR-----GMERFCEQAAAAGVAGLVVPDLPLEEAEKLSPIAAER--GIDLILLVAPTT---PAERMKRIA  168 (267)
T ss_pred             EEEEEHHHHHHH-----HHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCEEEEEECCCC---CHHHHHHHH
T ss_conf             998610789885-----5999999998669875767899989999999999853--981689948999---689999998


Q ss_pred             HH
Q ss_conf             99
Q gi|254780767|r  138 AY  139 (383)
Q Consensus       138 ~~  139 (383)
                      +.
T Consensus       169 ~~  170 (267)
T PRK13129        169 QQ  170 (267)
T ss_pred             HC
T ss_conf             16


No 159
>PRK09836 DNA-binding transcriptional activator CusR; Provisional
Probab=76.42  E-value=2.4  Score=22.22  Aligned_cols=77  Identities=17%  Similarity=0.269  Sum_probs=50.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+++--|+.   ++..|...|++.   ++++.....-                                   .+..+.
T Consensus         1 MkILiVEDd~~---l~~~l~~~L~~~---G~~v~~a~~g-----------------------------------~~a~~~   39 (226)
T PRK09836          1 MKLLIVEDEKK---TGEYLTKGLTEA---GFVVDLADNG-----------------------------------LNGYHL   39 (226)
T ss_pred             CEEEEEECCHH---HHHHHHHHHHHC---CCEEEEECCH-----------------------------------HHHHHH
T ss_conf             98999939999---999999999878---9999998999-----------------------------------999999


Q ss_pred             CCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEE
Q ss_conf             00128886898-5117765-79999866301346311110
Q gi|254780767|r   84 IVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        84 i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv  121 (383)
                      +...+||+||+ +.-||.| +.+++++|+...++|+|..-
T Consensus        40 ~~~~~~DlvilDi~lP~~~G~~l~~~iR~~~~~~PII~Lt   79 (226)
T PRK09836         40 AMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLT   79 (226)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEEEE
T ss_conf             8518999999889999998720435677616796099994


No 160
>PRK10693 response regulator of RpoS; Provisional
Probab=76.07  E-value=3  Score=21.60  Aligned_cols=42  Identities=17%  Similarity=0.440  Sum_probs=31.1

Q ss_pred             HHHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             9986100128886898-5117765-7999986630134631111
Q gi|254780767|r   79 QTVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      +..+.+.+.+||+||+ +.-|+.| +.+.+++|+..+.+|||-.
T Consensus        42 eAl~~l~~~~pDLIi~Dl~MP~mdGlell~~lr~~~~~~PVIvl   85 (337)
T PRK10693         42 DALELLGGFTPDLMICDIAMPRMNGLKFVEHLRNRGDQTPVLVI   85 (337)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999865899999996899999989999999985899649999


No 161
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]
Probab=75.97  E-value=3  Score=21.58  Aligned_cols=72  Identities=28%  Similarity=0.533  Sum_probs=48.1

Q ss_pred             EEECCHHHHHCCCEEEECHHHCC--EEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHC
Q ss_conf             99717899947880650444531--10136746645999999999986100128886898-5117765-79999866301
Q gi|254780767|r   37 VGVGGPSLQKEGLVSLFDFSELS--VIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKM  112 (383)
Q Consensus        37 ~giGG~~m~~~G~~~~~~~~~l~--v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~  112 (383)
                      .=+-.+.|-..|++.+.|-..++  ++|=          -+.-++..+.+.+.+||+||+ |-=|++| +.+.+.+|+..
T Consensus         5 lIVDDE~lIr~GLk~lI~w~~~g~eiVgt----------A~NG~eAleli~e~~pDiviTDI~MP~mdGLdLI~~ike~~   74 (475)
T COG4753           5 LIVDDEPLIREGLKSLIDWEALGIEVVGT----------AANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQS   74 (475)
T ss_pred             EEECCHHHHHHHHHHHCCHHHCCCEEEEE----------CCCHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99667299999999848856369757875----------14579999998734997899815788875799999999749


Q ss_pred             CCCCCE
Q ss_conf             346311
Q gi|254780767|r  113 PNLPII  118 (383)
Q Consensus       113 ~~ipvi  118 (383)
                      +.+.+|
T Consensus        75 p~~~~I   80 (475)
T COG4753          75 PDTEFI   80 (475)
T ss_pred             CCCEEE
T ss_conf             985399


No 162
>PRK02947 hypothetical protein; Provisional
Probab=75.82  E-value=6.3  Score=19.49  Aligned_cols=193  Identities=20%  Similarity=0.209  Sum_probs=95.2

Q ss_pred             HHHHHH-HHHHHCCCCEEEEEECCHHHHH-------CCCEEEECHHHCCEEEHHHHHH--HHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999-9997389983999971789994-------7880650444531101367466--45999999999986100128
Q gi|254780767|r   19 AGDLIK-SLKEMVSYPINLVGVGGPSLQK-------EGLVSLFDFSELSVIGIMQVVR--HLPQFIFRINQTVELIVSSK   88 (383)
Q Consensus        19 ~a~li~-~Lk~~~~~~~~~~giGG~~m~~-------~G~~~~~~~~~l~v~G~~evl~--~~~~~~~~~~~~~~~i~~~~   88 (383)
                      ||.++. ++++  +.-+..+|-|-.+|-+       -|+-...++-+-++|..-.+.+  .+-+.-...+.+.+...-.+
T Consensus        30 Aa~~ia~si~~--gg~i~~fGtGHS~~~a~E~f~RAGGla~~~pI~~~~l~~~~g~~~s~~~ER~~g~a~~il~~~~i~~  107 (247)
T PRK02947         30 AADLVADSIAN--GGRIYVFGTGHSHMAAEEVFYRAGGLAPFNPILEPSLMLHEGAVASSYLERIEGYAKLILDRYPIRP  107 (247)
T ss_pred             HHHHHHHHHHC--CCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHCCCCC
T ss_conf             99999999975--9979998885164899987411476433130034110254786665312225509999998679999


Q ss_pred             CCEEEEECHHHHH---HHHHHHHHHHCCCCCCEEEECCCCCCC---CCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCE
Q ss_conf             8868985117765---799998663013463111100221100---3663557999998640156774223200255314
Q gi|254780767|r   89 PDVLLIVDNPDFT---HRVAKRVRKKMPNLPIINYVCPSVWAW---REGRARKMCAYINQVISILPFEKEVMQRLGGPPT  162 (383)
Q Consensus        89 Pd~vi~iD~pgFn---l~lak~lkk~~~~ipvi~yv~PqvWAW---r~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~  162 (383)
                      -|++|.+-..|-|   .-+|..+|++  |.+||=..+-+-=.-   |..--|++..++|.++=-                
T Consensus       108 ~Dvlii~SnSG~N~~pVE~A~~ak~~--G~~VIaiTS~~~s~~~~srH~SGkkL~d~aDiviDN----------------  169 (247)
T PRK02947        108 GDVLIIVSNSGRNAVPIEMALEAKER--GAKVIAVTSLAYSKSVASRHSSGKRLYEVADVVIDN----------------  169 (247)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHC--CCEEEEEECHHHHCCCCCCCCCCCEEHHHCCEEEEC----------------
T ss_conf             98899996787776899999999986--996999966788167899897667115636678657----------------


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCC-EEEECCCCCHHHHH
Q ss_conf             76388211221001355888976187655650599853874301230511189998764027351-26201663368899
Q gi|254780767|r  163 TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFF-RFSLVTVSSQENLV  241 (383)
Q Consensus       163 ~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~-~~~i~~~~~~~~~~  241 (383)
                         +-|.-|-.-..+.         .     -.-+=|.|--.-.--.--++.+++++|.++.-.. .|.-+..+..++.-
T Consensus       170 ---~~p~GDA~l~i~g---------~-----~~kvgp~STi~g~~i~n~i~~e~~~~L~~~G~~pPv~~S~N~~ggde~N  232 (247)
T PRK02947        170 ---GAPKGDAVLEIEG---------L-----EAKVGPTSTVVGVAILNAIFAEAAEELVERGIDPPVFLSANIDGGDEHN  232 (247)
T ss_pred             ---CCCCCCEEEEECC---------C-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHH
T ss_conf             ---9998765898789---------7-----7775757789999999999999999999779999867627888838999


Q ss_pred             HHHHHHC
Q ss_conf             9999604
Q gi|254780767|r  242 RCIVSKW  248 (383)
Q Consensus       242 ~~~~~~~  248 (383)
                      ....++|
T Consensus       233 ~~l~~~Y  239 (247)
T PRK02947        233 RALVEKY  239 (247)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 163
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional
Probab=75.50  E-value=3.5  Score=21.17  Aligned_cols=78  Identities=21%  Similarity=0.317  Sum_probs=46.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+++--|+   .++..|...|...   ++++.+.+..                                   .+..+.
T Consensus         1 mkILlVEDd~---~~~~~l~~~L~~~---g~~V~~a~~~-----------------------------------~ea~~~   39 (222)
T PRK10643          1 MKILIVEDDT---LLLQGLILAAQTE---GYACDGVSTA-----------------------------------REAEQS   39 (222)
T ss_pred             CEEEEEECCH---HHHHHHHHHHHHC---CCEEEEECCH-----------------------------------HHHHHH
T ss_conf             9799992889---9999999999978---9999998999-----------------------------------999999


Q ss_pred             CCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             00128886898-5117765-799998663013463111100
Q gi|254780767|r   84 IVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        84 i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      +....||+||+ +.-|+.| +.+.+.+|+....+|+|..-+
T Consensus        40 ~~~~~~DlvilDi~lp~~~G~~l~~~ir~~~~~~pII~lt~   80 (222)
T PRK10643         40 LESGHYSLVVLDLGLPDEDGLHFLARIRQKKYTLPVLILTA   80 (222)
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHHHHHCCCCCCEEEEEC
T ss_conf             97489989999688899862268999983489988999821


No 164
>KOG1465 consensus
Probab=75.04  E-value=6.6  Score=19.35  Aligned_cols=97  Identities=18%  Similarity=0.168  Sum_probs=48.4

Q ss_pred             EEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHH-HHHHHHHHHCCCCCEEEEECCCCHHHHHHHHH---
Q ss_conf             59985387430123051118999876402735126201663368-89999996048885055205520357887635---
Q gi|254780767|r  195 ILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQE-NLVRCIVSKWDISPEIIIDKEQKKQVFMTCNA---  270 (383)
Q Consensus       195 I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~-~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~---  270 (383)
                      |.|-+||-+.     .--|+..+.+-.  +....++.-++|..+ +.....+.+.+....+ +....-...|+...-   
T Consensus       165 viLT~g~SrT-----V~~FL~~A~kk~--Rkf~viVaE~~p~~qgH~~Ak~la~~giettV-I~daaVfA~MsrVnKVIi  236 (353)
T KOG1465         165 VILTLGSSRT-----VENFLKHAAKKG--RKFRVIVAEGAPNNQGHELAKPLAQAGIETTV-IPDAAVFAMMSRVNKVII  236 (353)
T ss_pred             EEEECCCCHH-----HHHHHHHHHHCC--CCEEEEEEECCCCCCCHHHHHHHHHCCCEEEE-ECCHHHHHHHHHCCEEEE
T ss_conf             5984276188-----999999999616--71589996237764434764778975871588-330999997643463899


Q ss_pred             ----------HHCCCHHHHH-HHH-HHCCCEEEE---CCCCCCE
Q ss_conf             ----------5233115668-887-627530254---0577410
Q gi|254780767|r  271 ----------AMAASGTVIL-ELA-LCGIPVVSI---YKSEWIV  299 (383)
Q Consensus       271 ----------ai~~SGTaTL-E~a-l~g~P~IV~---Yk~~~lt  299 (383)
                                .++.||+-|+ ++| -..+|.+|+   ||++|+.
T Consensus       237 gt~avl~NGgl~~~~G~~~vAlaAk~h~vPv~VlAp~yKLsPly  280 (353)
T KOG1465         237 GTHAVLANGGLRAPSGVHTVALAAKHHSVPVIVLAPMYKLSPLY  280 (353)
T ss_pred             EEEEEECCCCEECCCHHHHHHHHHHHCCCCEEEECCHHHCCCCC
T ss_conf             75468538976325408899999873487679952243258888


No 165
>PRK09935 transcriptional regulator FimZ; Provisional
Probab=75.02  E-value=3  Score=21.63  Aligned_cols=22  Identities=5%  Similarity=0.110  Sum_probs=9.5

Q ss_pred             HHHHHHHHCCCCCEEEECCCCC
Q ss_conf             9998764027351262016633
Q gi|254780767|r  215 SAVASLVKRNPFFRFSLVTVSS  236 (383)
Q Consensus       215 ~~~~~l~~~~~~~~~~i~~~~~  236 (383)
                      +.++.+.+.+|+.++++.+...
T Consensus        66 ~~i~~i~~~~p~~~ilvls~~~   87 (210)
T PRK09935         66 TLLKRIKQIQETVKVLFLSSKS   87 (210)
T ss_pred             CHHHHHHHHCCCCCEEEEECCC
T ss_conf             0567898738997089971767


No 166
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional
Probab=74.78  E-value=4.6  Score=20.35  Aligned_cols=26  Identities=19%  Similarity=0.192  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             99999999997389983999971789
Q gi|254780767|r   18 LAGDLIKSLKEMVSYPINLVGVGGPS   43 (383)
Q Consensus        18 ~~a~li~~Lk~~~~~~~~~~giGG~~   43 (383)
                      .|.++++.+++...-++++.|+-.+.
T Consensus       155 ~~~~l~~~i~~~p~~G~~vvG~~dd~  180 (464)
T PRK10124        155 AGQMLLESFRNQPWLGFEVVGVYHDP  180 (464)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             99999999972966796699996688


No 167
>pfam07355 GRDB Glycine/sarcosine/betaine reductase selenoprotein B (GRDB). This family represents a conserved region approximately 350 residues long within the selenoprotein B component of the bacterial glycine, sarcosine and betaine reductase complexes.
Probab=73.72  E-value=4.4  Score=20.49  Aligned_cols=70  Identities=21%  Similarity=0.433  Sum_probs=45.5

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHHHH--------HHHHHHHHHCCCCCCEE--E-ECCCCCCCC--------CCCHH
Q ss_conf             99999998610012888689851177657--------99998663013463111--1-002211003--------66355
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDFTH--------RVAKRVRKKMPNLPIIN--Y-VCPSVWAWR--------EGRAR  134 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl--------~lak~lkk~~~~ipvi~--y-v~PqvWAWr--------~~R~k  134 (383)
                      -....++.+.+++.+||++|.  -|.||-        .++|.++.+ +|||++-  | =-|-+-.+|        .+.+.
T Consensus        66 dea~~~il~mv~~~~pDlfiA--GPAFnAGRYGvACG~i~kaV~e~-l~IP~vTgMy~ENPGvdm~kk~~yIv~t~nsAa  142 (349)
T pfam07355        66 EEAVAEILEMLKEEKPDLFIA--GPAFNAGRYGVACGTIAKAVKEE-LGIPAVTGMYVENPGVDMFKKDVYIISTGNSAA  142 (349)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE--CCCCCCCCHHHHHHHHHHHHHHH-HCCCEEEECCCCCCCHHHHHCCEEEEECCCHHH
T ss_conf             999999999998429998987--66325642588899999999998-699638641566850767644428996584176


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             799999864015
Q gi|254780767|r  135 KMCAYINQVISI  146 (383)
Q Consensus       135 ~~~~~~d~~~~i  146 (383)
                      .|++.+-.|..+
T Consensus       143 ~Mr~a~~~ma~l  154 (349)
T pfam07355       143 GMRKALPAMAKL  154 (349)
T ss_pred             HHHHHHHHHHHH
T ss_conf             788889999999


No 168
>PRK10499 N,N'-diacetylchitobiose-specific PTS system transporter subunit IIB; Provisional
Probab=73.68  E-value=7.1  Score=19.14  Aligned_cols=83  Identities=17%  Similarity=0.361  Sum_probs=55.5

Q ss_pred             CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             9874599997-682147899999999997389983999971789994788065044453110136746645999999999
Q gi|254780767|r    1 MNSLKIAVIA-GEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         1 m~~mki~i~a-GE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      |+++||+++| +..|--++..++-++-+++ +.++++..++-.+....+     +--|.=..|        |.+....++
T Consensus         1 M~~kkIlL~C~aGMSTSlLv~kM~~~A~~~-~i~~~I~A~~~~~~~~~~-----~~~DviLLG--------PQVry~~~~   66 (106)
T PRK10499          1 MEKKHIYLFCSAGMSTSLLVSKMRAQAEKY-EVPVIIEAFPETLAGEKG-----QNADVVLLG--------PQIAYMLPE   66 (106)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC-CCCEEEEEEEHHHHHHHC-----CCCCEEEEC--------HHHHHHHHH
T ss_conf             998779998899987899999999999976-998899995378987644-----599999998--------478887999


Q ss_pred             HHHHCCCCCCCEEEEECHHHH
Q ss_conf             986100128886898511776
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      +.+.+. .+|  |..||.-+|
T Consensus        67 ik~~~~-~~P--V~vId~~~Y   84 (106)
T PRK10499         67 IQRLLP-NKP--VEVIDSLLY   84 (106)
T ss_pred             HHHHCC-CCC--EEEECHHHH
T ss_conf             998828-998--899888983


No 169
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentially cle
Probab=73.56  E-value=7.1  Score=19.12  Aligned_cols=56  Identities=20%  Similarity=0.457  Sum_probs=36.3

Q ss_pred             HHHHHHHHHHCCCCCCCEEEE-ECHHHHHHH----HHHHHHHHCCCCCCEEEECCC-CCCCCCC
Q ss_conf             999999986100128886898-511776579----999866301346311110022-1100366
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLI-VDNPDFTHR----VAKRVRKKMPNLPIINYVCPS-VWAWREG  131 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~-iD~pgFnl~----lak~lkk~~~~ipvi~yv~Pq-vWAWr~~  131 (383)
                      ...+++..+...+.+.+++|+ +|.||=-+.    +.+.+..  ..+|++-||.|+ -+||-.|
T Consensus        15 ~~~l~r~l~~A~~~~a~~vii~ldTPGG~~~a~~~I~~~i~~--s~vPv~~yV~P~g~~A~SAG   76 (172)
T cd07015          15 YDQFDRYITIAEQDNAEAIIIELDTPGGRADAAGNIVQRIQQ--SKIPVIIYVYPPGASAASAG   76 (172)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHC--CCCCEEEEEECCCCCHHHHH
T ss_conf             999999999999779989999986896289999999999982--99998999947996267699


No 170
>PRK13117 consensus
Probab=72.79  E-value=6.6  Score=19.32  Aligned_cols=58  Identities=17%  Similarity=0.234  Sum_probs=28.7

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             999986100128886898511776-579999866301346311110022110036635579999
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      .++..+.+++..-|.+|..|-|-- .-.+.+.+++.  |+..|+.++|+-   -+.|++++.+.
T Consensus       111 ~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~--gl~~I~lv~Ptt---~~~Ri~~i~~~  169 (268)
T PRK13117        111 IDNFYARCAEAGVDSVLIADVPVEESAPFRQAAKKH--GIAPIFICPPNA---DDDTLRQIASL  169 (268)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHHH
T ss_conf             999999999769877985799978858999999867--983799847999---99999999974


No 171
>PRK13139 consensus
Probab=72.44  E-value=7.6  Score=18.95  Aligned_cols=57  Identities=18%  Similarity=0.257  Sum_probs=30.4

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             99986100128886898511776-579999866301346311110022110036635579999
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      ++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|.+|+|+-   .+.|++.+.+.
T Consensus       110 e~F~~~~~~~Gv~GvIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPtt---~~~Ri~~i~~~  167 (254)
T PRK13139        110 ERFIDEVADIGVKGLIVPDLPPEQAQDYIAQCRAK--GMAPIGIYAPTS---TDERMGKIAAA  167 (254)
T ss_pred             HHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHHC
T ss_conf             99999999759985864799978899999999846--975799945899---98999999851


No 172
>pfam06925 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.
Probab=72.29  E-value=7.6  Score=18.93  Aligned_cols=83  Identities=8%  Similarity=0.054  Sum_probs=45.7

Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCC--CCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHH
Q ss_conf             99999861001288868985117765799998663013--4631111002211003663557999998640156774223
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMP--NLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEV  153 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~--~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~  153 (383)
                      ..+++.+.|++++||+||+. +|=.+--....+|+++.  .+|++-.|                  .|..    +.-..|
T Consensus        77 ~~~~l~~~i~~~~PD~IV~T-hp~~~~~~l~~lk~~~~~~~~p~~tVi------------------TD~~----~~H~~W  133 (169)
T pfam06925        77 FARELAALLKEFQPDIIIST-HPLPAAVPLSVLKSKGLLKRVLVVTVV------------------TDFR----TCHPFW  133 (169)
T ss_pred             HHHHHHHHHHHHCCCEEEEC-CHHHHHHHHHHHHHCCCCCCCCEEEEE------------------CCCC----CCCCCC
T ss_conf             99999999998493999999-762667899999983878899789998------------------9886----665781


Q ss_pred             HHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCC
Q ss_conf             200255314763882112210013558889761876556
Q gi|254780767|r  154 MQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQW  192 (383)
Q Consensus       154 f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~  192 (383)
                      +.  .+++..||+|+-+.         +...+.|+++++
T Consensus       134 ~~--~~~D~y~Va~ee~~---------~~l~~~Gi~~~k  161 (169)
T pfam06925       134 LH--PEIDRYYVPSKEVK---------KEALEKGIDPSN  161 (169)
T ss_pred             CC--CCCCEEEECCHHHH---------HHHHHCCCCHHH
T ss_conf             68--99998997999999---------999985999889


No 173
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=72.29  E-value=4.8  Score=20.24  Aligned_cols=36  Identities=33%  Similarity=0.648  Sum_probs=17.0

Q ss_pred             CCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEE
Q ss_conf             00128886898-5117765-799998663013463111
Q gi|254780767|r   84 IVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        84 i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~  119 (383)
                      +..++||+|++ +.-||-| +.+.+.+|+..+.+|+|.
T Consensus        43 l~~~~~dlvl~Di~mP~~~Gl~ll~~lr~~~~~~pvIv   80 (469)
T PRK10923         43 LASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVII   80 (469)
T ss_pred             HHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCEEE
T ss_conf             86699999987899999899999999984298997899


No 174
>PRK13115 consensus
Probab=72.06  E-value=7.6  Score=18.94  Aligned_cols=124  Identities=18%  Similarity=0.099  Sum_probs=64.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEEEC---HH--------------HCCEE
Q ss_conf             9999768214789999999999738998399997-------178999478806504---44--------------53110
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSLFD---FS--------------ELSVI   61 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~~~---~~--------------~l~v~   61 (383)
                      -|+.||.+|=|.- ..++++|-+. +-|+-=.|+       -||--|++....+-+   ++              .+-+|
T Consensus        28 ~yitaG~P~~e~t-~~~i~~l~~~-GaDiiElGiPFSDP~ADGPvIQ~A~~rAL~~G~~~~~~f~~v~~~~~~~~PivlM  105 (269)
T PRK13115         28 GYLPAGFPDVDTS-IAAMTALVES-GCDIVEVGLPYSDPVMDGPVIQAATEAALRGGVRVRDVFRAVEAISAAGGRALVM  105 (269)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCEEEH
T ss_conf             7852738998999-9999999966-9999997999888566689999999999977995999999999841579988854


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             136746645999999999986100128886898511776-5799998663013463111100221100366355799999
Q gi|254780767|r   62 GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYI  140 (383)
Q Consensus        62 G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~  140 (383)
                      |.+.++-+     .-.++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|+.|+|+-   .+.|++.+.+..
T Consensus       106 ~Y~N~i~~-----yG~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--gi~~I~LvaPtt---~~eRi~~i~~~a  175 (269)
T PRK13115        106 TYWNPVLR-----YGVDRFARDLAAAGGAGLITPDLIPDEAGEWLAASERH--GLDRIFLVAPSS---TPERLAETVEAS  175 (269)
T ss_pred             HHHHHHHH-----HCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CEEEEEEECCCC---CHHHHHHHHHCC
T ss_conf             75489987-----36999999999739980764789978999999999865--812899858999---889999998448


Q ss_pred             H
Q ss_conf             8
Q gi|254780767|r  141 N  141 (383)
Q Consensus       141 d  141 (383)
                      .
T Consensus       176 ~  176 (269)
T PRK13115        176 R  176 (269)
T ss_pred             C
T ss_conf             8


No 175
>PRK09483 response regulator; Provisional
Probab=71.79  E-value=4.2  Score=20.66  Aligned_cols=20  Identities=20%  Similarity=0.423  Sum_probs=8.3

Q ss_pred             HHHHHHHHCCCCCEEEECCC
Q ss_conf             99987640273512620166
Q gi|254780767|r  215 SAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       215 ~~~~~l~~~~~~~~~~i~~~  234 (383)
                      +++..+.+..|..++++.+.
T Consensus        64 ~~~~~i~~~~p~~~vivls~   83 (216)
T PRK09483         64 EATRKILRSTPDVKIIMLTV   83 (216)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             37788874089985786305


No 176
>cd01139 TroA_f Periplasmic binding protein TroA_f.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=71.67  E-value=7.9  Score=18.84  Aligned_cols=90  Identities=14%  Similarity=0.257  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCHHHHHCC--CEE----EECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             9999999999738998399997178999478--806----5044453110136746645999999999986100128886
Q gi|254780767|r   18 LAGDLIKSLKEMVSYPINLVGVGGPSLQKEG--LVS----LFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDV   91 (383)
Q Consensus        18 ~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G--~~~----~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~   91 (383)
                      .+..++..|... +.--.+.|++++..+...  ...    .=.+.++..+|-.-          ...--.+.|.+-+||+
T Consensus        26 ~~~~~l~~l~~~-~~~~~ivg~~~~~~~~~~~~~~~~~~~~P~l~~lp~vg~~~----------~~~~n~E~il~l~PDv   94 (342)
T cd01139          26 RQLYALALLEGE-NPFARIVGWGGDLKKGDPDTYAKYKEKFPEIADIPLIGSTY----------NGDFSVEKVLTLKPDL   94 (342)
T ss_pred             HHHHHHHHHCCC-CCCCEEEEECCHHHHCCHHHHHHHHHHCHHHHCCCCCCCCC----------CCCCCHHHHHHCCCCE
T ss_conf             199999974534-55236998363553216566899987595865188547888----------9985999996219988


Q ss_pred             EEEE---CHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             8985---1177657999986630134631111
Q gi|254780767|r   92 LLIV---DNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        92 vi~i---D~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      ||+-   ...+.+-.+.+++.+.  |||++..
T Consensus        95 Vi~~~~~~~~~~~~~~~~~l~~~--GIpVv~~  124 (342)
T cd01139          95 VILNIWAKTTAEESGILEKLEQA--GIPVVFV  124 (342)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHC--CCCEEEE
T ss_conf             99944345654456799999971--9988999


No 177
>PRK10403 transcriptional regulator NarP; Provisional
Probab=71.57  E-value=3.2  Score=21.41  Aligned_cols=31  Identities=10%  Similarity=0.300  Sum_probs=15.2

Q ss_pred             CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             8989999999998449899999999999999983899
Q gi|254780767|r  331 IRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTK  367 (383)
Q Consensus       331 ~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~  367 (383)
                      .+-+.|+..+.  +..    +....-.+++.++||-.
T Consensus       169 ~snkeIA~~L~--iS~----~TV~~h~~~I~~KLgv~  199 (215)
T PRK10403        169 LSNKQIASVLN--ISE----QTVKVHIRNLLRKLNVR  199 (215)
T ss_pred             CCHHHHHHHHC--CCH----HHHHHHHHHHHHHHCCC
T ss_conf             99999999979--829----99999999999986899


No 178
>cd01147 HemV-2 Metal binding protein HemV-2.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=71.24  E-value=4.6  Score=20.35  Aligned_cols=42  Identities=26%  Similarity=0.312  Sum_probs=25.5

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             86100128886898511776579999866301346311110022
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPS  124 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pq  124 (383)
                      .+.|.+-+||+||.-++.+..-......++  .|||+++.-.|+
T Consensus        67 ~E~i~al~PDlVi~~~~~~~~~~~~~~~~~--~gip~v~~~~~~  108 (262)
T cd01147          67 YEKIAALKPDVVIDVGSDDPTSIADDLQKK--TGIPVVVLDGGD  108 (262)
T ss_pred             HHHHHCCCCCEEEEECCCCCHHHHHHHHHH--HCCCEEECCCCC
T ss_conf             999960699889984677706789999998--799789748999


No 179
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional
Probab=70.69  E-value=2.8  Score=21.83  Aligned_cols=39  Identities=18%  Similarity=0.346  Sum_probs=28.7

Q ss_pred             HHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             6100128886898-5117765-7999986630134631111
Q gi|254780767|r   82 ELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        82 ~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      +.+.+++||++|+ +.-||-| +.+++.+|+....+|++..
T Consensus        38 ~~~~~~~~DlvilDi~lP~~dG~~l~~~iR~~~~~~PII~l   78 (219)
T PRK10336         38 EALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLIL   78 (219)
T ss_pred             HHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHCCCCCEEEE
T ss_conf             99862896999997999999856310104652788878998


No 180
>pfam02601 Exonuc_VII_L Exonuclease VII, large subunit. This family consist of exonuclease VII, large subunit EC:3.1.11.6 This enzyme catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones.
Probab=70.35  E-value=8.4  Score=18.65  Aligned_cols=92  Identities=20%  Similarity=0.287  Sum_probs=54.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      |.+|.|++...|.=++  .+++.++++ .|.+++.=. .-.||-++..             -|++..+       +.+-+
T Consensus        14 p~~IgvITS~~gAa~~--Di~~~~~~r-~p~~~i~l~-p~~VQG~~a~-------------~~I~~ai-------~~~~~   69 (295)
T pfam02601        14 PKRIAVITSATGAAYQ--DFLRTARRR-GPLVEIEIY-PTLVQGDGAA-------------ESIVSAL-------ERANE   69 (295)
T ss_pred             CCEEEEEECCCCHHHH--HHHHHHHHH-CCCCEEEEE-CCCCCCCHHH-------------HHHHHHH-------HHHHH
T ss_conf             9989998489408999--999999981-999679994-7357650489-------------9999999-------99984


Q ss_pred             HCCCCCCCEEEEE-------CHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             1001288868985-------117765-7999986630134631111
Q gi|254780767|r   83 LIVSSKPDVLLIV-------DNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        83 ~i~~~~Pd~vi~i-------D~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      .-...+||++|.+       |-..|| ..+|+.+-+.  .+|||-=
T Consensus        70 ~~~~~~~Dviii~RGGGS~eDL~~FN~e~laraI~~~--~iPvisa  113 (295)
T pfam02601        70 RETALDYDVIVIIRGGGSKEDLWVFNDEELARAIANS--PIPVITG  113 (295)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHCCHHHHHHHHHHC--CCCEEEC
T ss_conf             6898998389995786888987455889999999838--9987806


No 181
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated
Probab=69.79  E-value=8.6  Score=18.57  Aligned_cols=90  Identities=17%  Similarity=0.245  Sum_probs=46.9

Q ss_pred             CCCEEEEEECCCCHHHHHHHH-HHHHHH--HCCCCEEEEEECCHHHHH-----CCCEEE--ECHHHCCEE----------
Q ss_conf             874599997682147899999-999997--389983999971789994-----788065--044453110----------
Q gi|254780767|r    2 NSLKIAVIAGEISGDLLAGDL-IKSLKE--MVSYPINLVGVGGPSLQK-----EGLVSL--FDFSELSVI----------   61 (383)
Q Consensus         2 ~~mki~i~aGE~SGD~~~a~l-i~~Lk~--~~~~~~~~~giGG~~m~~-----~G~~~~--~~~~~l~v~----------   61 (383)
                      +++||.|+.|+++|  .|-.+ +++|++  ...+++.|.=+|.+..-+     .|++.-  ..-.++.+.          
T Consensus         4 ~~lrIaIT~GDPaG--IGPEIilKal~~~~~~~~~~~~vviGd~~~l~~~~~~l~~~~~~~~~~~~~~v~~~~~~~~~~~   81 (329)
T PRK01909          4 QPLQIAITTGEPAG--VGPELTVQALADAATRWPDARFTVLGDAALLAARAAAVGVDWARLAAGGHVSVAHRALAAPAEA   81 (329)
T ss_pred             CCCEEEEECCCCCC--CHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHCCCCHHHHCCCCCCCEECCCCCCCCCC
T ss_conf             99769997588850--1799999999865754689888999799999999998399835504689751521677787878


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             136746645999999999986100128886898
Q gi|254780767|r   62 GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI   94 (383)
Q Consensus        62 G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~   94 (383)
                      |-... .+=...+..++...+.+++.+.|++|+
T Consensus        82 G~~~~-~~g~~~~~~l~~Av~~~~~g~~dalVT  113 (329)
T PRK01909         82 GKLDA-ANGRYVLDLLDAAIDGALAGRYDAIVT  113 (329)
T ss_pred             CCCCH-HHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             98088-999999999999999997598889997


No 182
>pfam05693 Glycogen_syn Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
Probab=69.69  E-value=7.8  Score=18.87  Aligned_cols=98  Identities=21%  Similarity=0.220  Sum_probs=58.1

Q ss_pred             CCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEE---EEECCCCC-CEEEEHHHCCCCCCCHHHCCC
Q ss_conf             2035788763552331-----15668887627530254057741000---01024676-102302440784261242054
Q gi|254780767|r  260 QKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNF---FIFYIKTW-TCALPNLIVDYPLVPEYFNSM  330 (383)
Q Consensus       260 ~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~---i~~lik~~-~i~LpNii~~~~ivPEliQ~~  330 (383)
                      +.++.+..||+.+-.|     |=--||++.+|+|+|.-    -|+.|   +...+.-+ ..|.-  +.+|.-    -..+
T Consensus       462 ~Y~efv~Gc~LgVFPSYYEPWGYTPlE~~a~gVPsITT----dLSGFG~~~~~~~~~~~~~GI~--VvdR~~----~n~~  531 (633)
T pfam05693       462 DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTT----NLSGFGCFMEEHIEDPKDYGIY--IVDRRF----KSPD  531 (633)
T ss_pred             CHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEC----CCHHHHHHHHHHHCCCCCCCEE--EEECCC----CCHH
T ss_conf             79998524664446543589888859986517880113----7515789999873064347579--997888----9879


Q ss_pred             CCHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             898999999999844-9899999999999999983899
Q gi|254780767|r  331 IRSEALVRWIERLSQ-DTLQRRAMLHGFENLWDRMNTK  367 (383)
Q Consensus       331 ~~~~~i~~~~~~ll~-d~~~r~~~~~~~~~~~~~Lg~~  367 (383)
                      -..+.|++.+.++-. +...|.+|++..+++.+.+...
T Consensus       532 Esv~ql~~~m~~f~~~s~rqri~~RnrterLS~~~dW~  569 (633)
T pfam05693       532 ESVQQLAQFMYEFCQQSRRQRIIQRNRTERLSDLLDWK  569 (633)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCHH
T ss_conf             99999999999997499999999999999998864899


No 183
>PRK10161 transcriptional regulator PhoB; Provisional
Probab=69.61  E-value=5.9  Score=19.66  Aligned_cols=80  Identities=16%  Similarity=0.276  Sum_probs=51.0

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973899839999717899947880650444531101367466459999999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |+. ||+++--|+.   .+..+...|...   ++++.....                                   ..+.
T Consensus         1 M~~-kILiVEDd~~---l~~~l~~~L~~~---g~~v~~a~~-----------------------------------g~~a   38 (229)
T PRK10161          1 MAR-RILVVEDEAP---IREMVCFVLEQN---GFQPVEAED-----------------------------------YDSA   38 (229)
T ss_pred             CCC-CEEEEECCHH---HHHHHHHHHHHC---CCEEEEECC-----------------------------------HHHH
T ss_conf             997-1999959999---999999999977---999999899-----------------------------------9999


Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHC--CCCCCEEEEC
Q ss_conf             86100128886898-5117765-79999866301--3463111100
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKM--PNLPIINYVC  122 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~--~~ipvi~yv~  122 (383)
                      .+.+.++.||++|+ +.-||.| +.+.+.+|+..  .++|+|..-+
T Consensus        39 ~~~l~~~~~DliilDi~lP~~dG~~~~~~ir~~~~~~~~PII~lta   84 (229)
T PRK10161         39 VNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTA   84 (229)
T ss_pred             HHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCCCCCEEEEEC
T ss_conf             9998528998999978998876335878877502468975899955


No 184
>PRK00742 chemotaxis-specific methylesterase; Provisional
Probab=69.52  E-value=5  Score=20.11  Aligned_cols=76  Identities=21%  Similarity=0.370  Sum_probs=41.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      +||+|+  |.|..+  ..+++.+-+. .+++++.|..++..+                                  ..+.
T Consensus         3 irVLIV--DDs~~~--R~~l~~~L~~-~~~~eVv~~A~nG~e----------------------------------Al~~   43 (345)
T PRK00742          3 IRVLVV--DDSAFM--RRLLSEILNS-DPDIEVVGTARDGLE----------------------------------AVEK   43 (345)
T ss_pred             CEEEEE--ECCHHH--HHHHHHHHHH-CCCEEEEEEECCHHH----------------------------------HHHH
T ss_conf             269999--298899--9999999972-899089999899999----------------------------------9999


Q ss_pred             CCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEE
Q ss_conf             00128886898-5117765-799998663013463111
Q gi|254780767|r   84 IVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        84 i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~  119 (383)
                      +.+.+||+|++ |.-|+.| +-+.+.+++.. .+|++-
T Consensus        44 ~~~~~pDvVllDi~MP~mdGie~l~~I~~~~-p~pVim   80 (345)
T PRK00742         44 IKKLNPDVITLDVEMPVMDGIEALRKIMALR-PTPVVM   80 (345)
T ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHHHHC-CCCEEE
T ss_conf             8860999999837889998799999999758-987799


No 185
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination.  HJR's occur in archaea, bacteria, and in the mitochondria of certain fungi, however this CD includes only the bacterial and mitochondrial HJR's.  These are referred to as the RuvC family of Holliday junction resolvases, RuvC being the E.coli HJR.  RuvC and its orthologs are homodimers and are structurely similar to RNase H and Hsp70.
Probab=69.38  E-value=8.8  Score=18.51  Aligned_cols=80  Identities=18%  Similarity=0.168  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEEC-HHHHHHHHHHHHH---------HHCCCCCCEEEECCCCCCC--CCCCHH
Q ss_conf             664599999999998610012888689851-1776579999866---------3013463111100221100--366355
Q gi|254780767|r   67 VRHLPQFIFRINQTVELIVSSKPDVLLIVD-NPDFTHRVAKRVR---------KKMPNLPIINYVCPSVWAW--REGRAR  134 (383)
Q Consensus        67 l~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD-~pgFnl~lak~lk---------k~~~~ipvi~yv~PqvWAW--r~~R~k  134 (383)
                      ...--++.....++.+.+.+++||.+..=| |.+.|.+-+-.+-         ....|+|+.-|-+-||+--  +.||+.
T Consensus        38 ~~~~~RL~~I~~~l~~li~~~~P~~vaiE~~f~~~n~~tal~lg~arGvi~~~~~~~~i~v~ey~P~~VK~~vtG~G~A~  117 (154)
T cd00529          38 APLPSRLKTIYDGLNEVIDQFQPDVVAIERVFFAKNPDSALKLGQARGALILALANRNLPVFEYTPNQVKKAVTGYGKAD  117 (154)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECHHHHHHHHHCCCCCC
T ss_conf             99899999999999999983499789865465601888899999999999999998179861688899889986797375


Q ss_pred             --HHHHHHHHHCCC
Q ss_conf             --799999864015
Q gi|254780767|r  135 --KMCAYINQVISI  146 (383)
Q Consensus       135 --~~~~~~d~~~~i  146 (383)
                        .+.+.+..++.+
T Consensus       118 K~qV~~mV~~~l~l  131 (154)
T cd00529         118 KDQVQHMVKRLLNL  131 (154)
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             99999999998199


No 186
>pfam04392 ABC_sub_bind ABC transporter substrate binding protein. This family contains many hypothetical proteins and some ABC transporter substrate binding proteins.
Probab=69.31  E-value=8.8  Score=18.50  Aligned_cols=166  Identities=16%  Similarity=0.190  Sum_probs=76.5

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHH---
Q ss_conf             99998610012888689851177657999986630134631111002211003663557999998640156774223---
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEV---  153 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~---  153 (383)
                      ...+.+.+...+||+++.+-.|     -|..+++...++|+++-.-                 .|      |-+..+   
T Consensus        48 ~~~ia~~l~~~~~Dli~a~~Tp-----aa~a~~~~~~~iPIVf~~v-----------------~d------Pv~aglv~s   99 (292)
T pfam04392        48 AAQIARQLVTDKNDLIIGIATP-----VAQILKSAIKTIPIVFAAV-----------------TD------PVGAKLVPS   99 (292)
T ss_pred             HHHHHHHHHHCCCCEEEECCCH-----HHHHHHHHCCCCCEEEEEE-----------------CC------HHHHCCCCC
T ss_conf             9999999973799899987509-----9999998359999899972-----------------68------566066445


Q ss_pred             HHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             20025531476388211221001355888976187655650599853874301230511189998764027351262016
Q gi|254780767|r  154 MQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       154 f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      +.+ .|-+++=|-+.    .. ....-+.  -..+.++.+.|+++=-+..+--.    ...+.++...++. +++++...
T Consensus       100 ~~~-pg~NvTGvs~~----~~-~~~~l~l--l~~l~P~~k~igviyn~~e~~s~----~~~~~~~~~a~~~-gi~l~~~~  166 (292)
T pfam04392       100 KEQ-PGENVTGVSDL----VD-VEQTIEL--IKKLLPNVKSIGVYYSPSEANSV----SLVEEIKKYAKKS-GIKVVEAS  166 (292)
T ss_pred             CCC-CCCEEEEEECC----CC-HHHHHHH--HHHHCCCCCEEEEEECCCCCCHH----HHHHHHHHHHHHC-CCEEEEEE
T ss_conf             668-99826785277----47-9999999--99868898589999579986579----9999999999976-99899996


Q ss_pred             CCCHHHHHHHHHHHCCCCCEEE-EECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEC
Q ss_conf             6336889999996048885055-20552035788763552331156688876275302540
Q gi|254780767|r  234 VSSQENLVRCIVSKWDISPEII-IDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIY  293 (383)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~i~-~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Y  293 (383)
                      ..+..+. ...........+.. +..+...  .+.       -.+.+-.+.-.++|.+..+
T Consensus       167 v~~~~ei-~~a~~~l~~~~Dal~i~~d~~v--~s~-------~~~i~~~a~~~kiPv~~~~  217 (292)
T pfam04392       167 VPSSNDV-PSAMSSMAGKVDAIFIPTDNLI--ASA-------FTAVLQEANKAKIPVITSD  217 (292)
T ss_pred             CCCHHHH-HHHHHHHHCCCCEEEEECCCCH--HHH-------HHHHHHHHHHCCCCEEECC
T ss_conf             6886679-9999974328988999378107--889-------9999999997499989577


No 187
>PRK10651 transcriptional regulator NarL; Provisional
Probab=69.19  E-value=2.1  Score=22.67  Aligned_cols=34  Identities=9%  Similarity=0.242  Sum_probs=17.9

Q ss_pred             CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             5489899999999984498999999999999999838999
Q gi|254780767|r  329 SMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKK  368 (383)
Q Consensus       329 ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~  368 (383)
                      .-.+-+.|+.++.  +..    +....-.+++.++||-..
T Consensus       169 ~G~snkeIA~~L~--iS~----~TV~~h~~~i~~KLgv~n  202 (216)
T PRK10651        169 QGLSNKMIARRLD--ITE----STVKVHVKHMLKKMKLKS  202 (216)
T ss_pred             CCCCHHHHHHHHC--CCH----HHHHHHHHHHHHHHCCCC
T ss_conf             5999999999969--789----999999999999848999


No 188
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114   This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism. It is phosphorylated by NtrB and interacts with sigma-54. One of the best studied examples is its activation of the gene glnA, which encodes the enzyme glutamine synthetase.. NtrC is composed of three domains , . The 124 residue N-terminal domain is homologous to receiver domains of other response regulator proteins in two-component signal transduction systems , . The 240 residue central domain of NtrC is homologous to a domain found in all activators of the sigma-54 RNA polymerase holoenzyme , . The C-terminal domain has been indicated to contain the determinants necessary for both DNA-binding and dimerization of full-length NtrC.; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0009399 nitrogen fixation, 0050906 detection of stimulus during sensory perception.
Probab=68.83  E-value=7.7  Score=18.88  Aligned_cols=146  Identities=14%  Similarity=0.231  Sum_probs=79.6

Q ss_pred             HHHHHHHHHCCCC-CCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH
Q ss_conf             9999998610012-8886898-5117765-79999866301346311110022110036635579999986401567742
Q gi|254780767|r   75 FRINQTVELIVSS-KPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEK  151 (383)
Q Consensus        75 ~~~~~~~~~i~~~-~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~  151 (383)
                      .....+.+.+... +||++|+ |=-||.| |-|-+++|+..|..|||=                |.-+.|..-++-+|+.
T Consensus        29 ~~A~~~l~~l~~~p~pD~~~tD~rMPg~~Gl~LL~~ik~~~P~LPVIv----------------M~A~~dl~~Av~a~~~   92 (471)
T TIGR01818        29 DNAASVLRALAREPQPDLLITDVRMPGEDGLDLLKQIKKRHPKLPVIV----------------MTAHSDLDSAVAAYQR   92 (471)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCEEE----------------ECCCHHHHHHHHHHHC
T ss_conf             318999999844799987986122688248999999985089997798----------------7130678999999735


Q ss_pred             HHHHCCCCCCEEECCCCC-CCCCCCCCCHHHHHHHCCCCCCCCEEEEEE--CCCCCCHHHHCCCHHHHHHHHHHC-CCCC
Q ss_conf             232002553147638821-122100135588897618765565059985--387430123051118999876402-7351
Q gi|254780767|r  152 EVMQRLGGPPTTFVGHPL-SSSPSILEVYSQRNKQRNTPSQWKKILLLP--GSRAQEIYKILPFFESAVASLVKR-NPFF  227 (383)
Q Consensus       152 ~~f~k~~~~~~~fVGHPl-~d~~~~~~~~~~~~~~~~~~~~~~~I~llP--GSR~~EI~~~lP~~l~~~~~l~~~-~~~~  227 (383)
                      -.|        .|.--|+ +|+....-.+.-.     -.....--..-.  -+...||-=-.|-|-++...+..- ..++
T Consensus        93 GAf--------EYLpKPFD~de~v~lv~RA~~-----~~~~~~~~~~~~~~~~~~~~liG~aPAMQevfR~igRL~~~~l  159 (471)
T TIGR01818        93 GAF--------EYLPKPFDLDEAVTLVERALA-----HAQEQVALELDAGEAEDSAELIGEAPAMQEVFRAIGRLSRSDL  159 (471)
T ss_pred             CCH--------HCCCCCCCHHHHHHHHHHHHC-----CCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             830--------217698766889999998610-----3001222000121012562123688516899999997516960


Q ss_pred             EEEECCCC-CHHHHHHHHHHHCC
Q ss_conf             26201663-36889999996048
Q gi|254780767|r  228 RFSLVTVS-SQENLVRCIVSKWD  249 (383)
Q Consensus       228 ~~~i~~~~-~~~~~~~~~~~~~~  249 (383)
                      .+.|-.-+ +-++++-.-+..++
T Consensus       160 ~VlI~GESGTGKELVA~ALH~~s  182 (471)
T TIGR01818       160 SVLINGESGTGKELVARALHRHS  182 (471)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC
T ss_conf             58885575775899999840137


No 189
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]
Probab=68.78  E-value=9  Score=18.43  Aligned_cols=61  Identities=15%  Similarity=0.123  Sum_probs=28.4

Q ss_pred             HHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-EEC-CCCCCEEEEHHHCCCCCCCHHHCCCCCHH
Q ss_conf             63552331156688876275302540577410000-102-46761023024407842612420548989
Q gi|254780767|r  268 CNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-IFY-IKTWTCALPNLIVDYPLVPEYFNSMIRSE  334 (383)
Q Consensus       268 sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~~l-ik~~~i~LpNii~~~~ivPEliQ~~~~~~  334 (383)
                      +.+++++|..--.|+-+.+.=.++.     .+.++ -.. +.--|+|.| .+.|+.-+.|.+.-..+.+
T Consensus       226 t~~~~A~a~a~~~~ail~d~~~vl~-----~s~~l~G~yg~~dv~~gvP-~~lg~~Gv~~iie~~l~~~  288 (313)
T COG0039         226 TYYGPAAALARMVEAILRDEKRVLP-----VSVYLDGEYGVEDVYFGVP-AVLGKNGVEEILELLLSDD  288 (313)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCEEE-----EEEEECCCCCCCCEEEEEE-EEECCCCCEEEECCCCCHH
T ss_conf             0566999999999999747785687-----8775357667687599856-8986897279845888989


No 190
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=68.60  E-value=9.1  Score=18.41  Aligned_cols=156  Identities=10%  Similarity=0.092  Sum_probs=65.6

Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-C------CCC--CCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             9986100128886898511776579999866301346311110-0------221--100366355799999864015677
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-C------PSV--WAWREGRARKMCAYINQVISILPF  149 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~------Pqv--WAWr~~R~k~~~~~~d~~~~ifpF  149 (383)
                      ...+.+.+.+..+++. .+.+.++.++..+.+.  ++|++-.. +      |..  |.++-.     ..+.+..-.+..+
T Consensus        58 ~a~kLi~~d~V~~i~g-~~s~~~~A~~~~~~~~--~vp~i~~~~~~~~~~~~~~~~~~F~~~-----~~~~~~~~~~~~~  129 (351)
T cd06334          58 CYERLKGEDGAVAFQG-WSTGITEALIPKIAAD--KIPLMSGSYGATLADDGAVFPYNFPVG-----PTYSDQARALVQY  129 (351)
T ss_pred             HHHHHHHCCCEEEECC-CCCHHHHHHHHHHHHH--CCCEEECCCCCCCCCCCCCCCEEEECC-----CCHHHHHHHHHHH
T ss_conf             9999985398266568-8867899999999981--992895246875233687784167626-----9878999999999


Q ss_pred             CH-HHHHCCCCCCEEECCC--CCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCC
Q ss_conf             42-2320025531476388--21122100135588897618765565059985387430123051118999876402735
Q gi|254780767|r  150 EK-EVMQRLGGPPTTFVGH--PLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPF  226 (383)
Q Consensus       150 E~-~~f~k~~~~~~~fVGH--Pl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~  226 (383)
                      =. ++..+..+-++-++.+  |.-..  ....-.+..++.|..    ++.--.=++.      -.-|-..+.++.+..|+
T Consensus       130 l~~~~~~~~~~kkva~v~~d~~~G~~--~~~~~~~~~~~~G~~----vv~~~~~~~~------~~Dft~~l~~i~~a~pD  197 (351)
T cd06334         130 IAEQEGGKLKGKKIALVYHDSPFGKE--PIEALKALAEKLGFE----VVLEPVPPPG------PNDQKAQWLQIRRSGPD  197 (351)
T ss_pred             HHHHHCCCCCCCEEEEEECCCHHHHH--HHHHHHHHHHHCCCE----EEEEEECCCC------CCCHHHHHHHHHHCCCC
T ss_conf             99841302488789999568627689--999999999976997----9888806999------83589999999976989


Q ss_pred             CEEEECCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             12620166336889999996048885055
Q gi|254780767|r  227 FRFSLVTVSSQENLVRCIVSKWDISPEII  255 (383)
Q Consensus       227 ~~~~i~~~~~~~~~~~~~~~~~~~~~~i~  255 (383)
                      ..|+....+..-..+++ ..+.+....+.
T Consensus       198 ~V~~~~~~~~~~~~~kq-a~~~G~~~~~i  225 (351)
T cd06334         198 YVILWGWGVMNPVAIKE-AKRVGLDDKFI  225 (351)
T ss_pred             EEEEECCCHHHHHHHHH-HHHCCCCCCEE
T ss_conf             99993773789999999-99759998579


No 191
>PRK12555 chemotaxis-specific methylesterase; Provisional
Probab=68.59  E-value=5.3  Score=19.94  Aligned_cols=78  Identities=17%  Similarity=0.372  Sum_probs=44.0

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      ||||+|+=-++.    --.+++.+-+. .+++++.|...+..                                  +..+
T Consensus         1 PirVLIVDDs~~----~R~~l~~~L~~-~~~~eVv~~A~~g~----------------------------------eAl~   41 (340)
T PRK12555          1 PMNVGIVDDSAL----AREALRRIIAR-RPDHRVLGVATDGL----------------------------------QARD   41 (340)
T ss_pred             CCEEEEEECCHH----HHHHHHHHHHH-CCCCEEEEEECCHH----------------------------------HHHH
T ss_conf             988999909889----99999999960-99948999989999----------------------------------9999


Q ss_pred             HCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             100128886898-5117765-7999986630134631111
Q gi|254780767|r   83 LIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        83 ~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      .+.+.+||+|++ |+-|+.| +-+.+++++.. .+|++-.
T Consensus        42 ~~~~~~pDvVllDi~MP~mdGie~l~~I~~~~-p~PVimv   80 (340)
T PRK12555         42 LCKAQPPDVVLLDLEMPRMDGLTFLRRIMRRR-PCPVLIV   80 (340)
T ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHC-CCCEEEE
T ss_conf             98861999999727889998799999999878-9986998


No 192
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional
Probab=68.39  E-value=3.2  Score=21.44  Aligned_cols=44  Identities=20%  Similarity=0.340  Sum_probs=30.0

Q ss_pred             HHHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             9986100128886898-5117765-799998663013463111100
Q gi|254780767|r   79 QTVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      +..+.+..+.||++|+ +.-||-| +.+++++|+....+|++..-+
T Consensus        35 ~al~~~~~~~~dlvilD~~lp~~~G~~l~~~ir~~~~~~piI~lta   80 (223)
T PRK10816         35 EADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLTA   80 (223)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHCCCCCCCEEEEEC
T ss_conf             9999997579989999799989886400120110489876899944


No 193
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a member of the SIS (Sugar ISomerase domain) superfamily. In the ribulose monophosphate pathway of formaldehyde fixation, hexulose-6-phosphate synthase catalyzes the condensation of ribulose-5-phosphate with formadelhyde to become hexulose-6-phosphate, which is then isomerized to fructose-6-phosphate by PHI.
Probab=67.94  E-value=6.4  Score=19.42  Aligned_cols=49  Identities=14%  Similarity=0.245  Sum_probs=24.7

Q ss_pred             CCCEEEEECHHHHH---HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             88868985117765---799998663013463111100221100366355799999864015
Q gi|254780767|r   88 KPDVLLIVDNPDFT---HRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISI  146 (383)
Q Consensus        88 ~Pd~vi~iD~pgFn---l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~i  146 (383)
                      +=|++|.+.++|-+   +.+++.+|++  |+++|-.-        ...-..+.++.|..+.+
T Consensus        75 ~~Dv~I~iS~SG~T~~~~~~~~~aK~~--ga~iI~IT--------~~~~S~la~~aD~~l~i  126 (179)
T cd05005          75 PGDLLIAISGSGETSSVVNAAEKAKKA--GAKVVLIT--------SNPDSPLAKLADVVVVI  126 (179)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC--CCEEEEEE--------CCCCCHHHHHCCEEEEC
T ss_conf             999999981999956899999999987--99199997--------98999789958999981


No 194
>PRK13116 consensus
Probab=67.78  E-value=9.4  Score=18.34  Aligned_cols=17  Identities=41%  Similarity=0.561  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHCCCCCCE
Q ss_conf             79999866301346311
Q gi|254780767|r  102 HRVAKRVRKKMPNLPII  118 (383)
Q Consensus       102 l~lak~lkk~~~~ipvi  118 (383)
                      |.+.+.+|+....+|++
T Consensus        82 ~~~v~~ir~~~~~~Piv   98 (278)
T PRK13116         82 LEQIKRVRAAYPEVPIG   98 (278)
T ss_pred             HHHHHHHCCCCCCCCEE
T ss_conf             99999840358987689


No 195
>PRK13133 consensus
Probab=67.45  E-value=9.1  Score=18.42  Aligned_cols=124  Identities=15%  Similarity=0.181  Sum_probs=64.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEE-------CCHHHHHCCCEEE---------ECH----H---------
Q ss_conf             9999768214789999999999738998399997-------1789994788065---------044----4---------
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGV-------GGPSLQKEGLVSL---------FDF----S---------   56 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~gi-------GG~~m~~~G~~~~---------~~~----~---------   56 (383)
                      -|+.||-++=|.- -.++++|.+. +-|+-=.|+       -||--|++....+         +++    .         
T Consensus        19 ~yitaG~P~~~~t-~~~i~~l~~~-GaDiiElGiPFSDP~ADGpvIQ~A~~rAL~~G~~~~~~~~~~~~~r~~~~~~~~~   96 (267)
T PRK13133         19 AYYMPEFPVAGAT-LPVLEALQES-GADIIELGIPYSDPIGDGPVIQNAAHTAIRNGVSVRSLLELVRKARNGEGCRKIT   96 (267)
T ss_pred             EEECCCCCCHHHH-HHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             7856869998999-9999999975-9998997899888666689999999999986998999999999997302434668


Q ss_pred             -HCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHH
Q ss_conf             -53110136746645999999999986100128886898511776-5799998663013463111100221100366355
Q gi|254780767|r   57 -ELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRAR  134 (383)
Q Consensus        57 -~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k  134 (383)
                       .+-+||...++.++     -.++..+.+++.--|.+|..|-|-= .-.+...+++.  |+..|+.|+|+-   .+.|++
T Consensus        97 ~PivlMtY~N~i~~y-----G~e~F~~~~~~aGvdGlIipDLP~eE~~~~~~~~~~~--gl~~I~lvaPtt---~~eRi~  166 (267)
T PRK13133         97 VPILLMGYCNPLIAY-----GGDCFLADAVKAGVDGLLIPDLPPEEAIDFLERAKNF--GLTVVFLISPVT---PPERIE  166 (267)
T ss_pred             CCEEEHHHHHHHHHH-----CHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHH
T ss_conf             778715645799984-----7799999999869878877899968889999999846--986024428999---999999


Q ss_pred             HHHHHHH
Q ss_conf             7999998
Q gi|254780767|r  135 KMCAYIN  141 (383)
Q Consensus       135 ~~~~~~d  141 (383)
                      .+.+..+
T Consensus       167 ~i~~~s~  173 (267)
T PRK13133        167 FIDSLST  173 (267)
T ss_pred             HHHHCCC
T ss_conf             9984278


No 196
>pfam10906 DUF2697 Protein of unknown function (DUF2697). This is a eukaryotic family of proteins with unknown function.
Probab=67.27  E-value=3.7  Score=20.96  Aligned_cols=45  Identities=22%  Similarity=0.362  Sum_probs=25.6

Q ss_pred             EECHHHHHHHHHHHHHHHCCCCCCEEEECCCCC----CCCCCCHHHHHHH
Q ss_conf             851177657999986630134631111002211----0036635579999
Q gi|254780767|r   94 IVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVW----AWREGRARKMCAY  139 (383)
Q Consensus        94 ~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvW----AWr~~R~k~~~~~  139 (383)
                      ++||||||--+ +++..+-+|||.--+..|+.=    -.++-|..|++.+
T Consensus         8 L~~Sp~Fh~fV-Rrvy~kvNgI~~~p~~~~~~~~~~~~y~PT~~qKf~Af   56 (68)
T pfam10906         8 LLDSPGFHRFV-RRVYAKVNGIKYTPEQHEETSMSEFLYKPTRLQKFNAF   56 (68)
T ss_pred             HHCCHHHHHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             97377788999-99999970889877677544444430156505442255


No 197
>PRK13435 response regulator; Provisional
Probab=67.25  E-value=6.7  Score=19.30  Aligned_cols=77  Identities=27%  Similarity=0.339  Sum_probs=48.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971789994788065044453110136746645999999999986
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      +|||+|+=-|..-   +..+-+.|.+   .+++..|..+..                                  .+..+
T Consensus         1 ~mRILIVEDe~~i---~~~l~~~L~~---~G~~vv~~A~~~----------------------------------~eAl~   40 (141)
T PRK13435          1 QLRVLIVEDEALI---ALELEKLLEE---AGHQVVGIASTS----------------------------------EQALA   40 (141)
T ss_pred             CCEEEEECCCHHH---HHHHHHHHHH---CCCEEEEEECCH----------------------------------HHHHH
T ss_conf             9789998998999---9999999998---799799975999----------------------------------99999


Q ss_pred             HCCCCCCCEEEE-ECHH-HHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             100128886898-5117-765-7999986630134631111
Q gi|254780767|r   83 LIVSSKPDVLLI-VDNP-DFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        83 ~i~~~~Pd~vi~-iD~p-gFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      .++..+||++++ |-=| |.+ +.+++.++.. +++|+|+.
T Consensus        41 ~~~~~~PDlvllDi~LpdG~~G~e~~r~l~~~-~~ipvI~l   80 (141)
T PRK13435         41 LGRRAQPDVALVDIRLADGPTGVEVARRLSID-GGVEVIFM   80 (141)
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHHHHHHHC-CCCCEEEE
T ss_conf             97659998999788789999899999999875-99838999


No 198
>PRK10365 transcriptional regulatory protein ZraR; Provisional
Probab=66.84  E-value=6.5  Score=19.38  Aligned_cols=13  Identities=31%  Similarity=0.626  Sum_probs=9.7

Q ss_pred             CCCEEEEEECCCC
Q ss_conf             8745999976821
Q gi|254780767|r    2 NSLKIAVIAGEIS   14 (383)
Q Consensus         2 ~~mki~i~aGE~S   14 (383)
                      ++|+|+|+--|++
T Consensus         4 ~~~~ILIVDDd~~   16 (441)
T PRK10365          4 DNIDILVVDDDIS   16 (441)
T ss_pred             CCCEEEEECCCHH
T ss_conf             9985999839899


No 199
>PRK09423 gldA glycerol dehydrogenase; Provisional
Probab=66.75  E-value=9.9  Score=18.17  Aligned_cols=89  Identities=19%  Similarity=0.233  Sum_probs=54.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999768214789999999999738998399997178999478806504445311013674664599999999998610
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELI   84 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i   84 (383)
                      |++|++|+.|-+..+.++...|++. +-++.|..+.|+-                            . ....++..+..
T Consensus        31 r~liVtd~~~~~~~~~~v~~~L~~~-gi~~~~~~~~~~p----------------------------t-~~~v~~~~~~~   80 (366)
T PRK09423         31 RALLIADEFVLGIVGDTVEASLKDA-GLDVVFEVFNGEC----------------------------S-DNEIDRLVAIA   80 (366)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHHC-CCEEEEEECCCCC----------------------------C-HHHHHHHHHHH
T ss_conf             5899989528998999999999867-9869997338999----------------------------9-99999999999


Q ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCC
Q ss_conf             0128886898511776579999866301346311110022110
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWA  127 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWA  127 (383)
                      +++++|.||.|- .|=-+-.||.+... .++|+|-.  |+.=+
T Consensus        81 ~~~~~D~IiavG-GGS~iD~AKaia~~-~~~P~i~I--PTtAg  119 (366)
T PRK09423         81 EENGCDVIIGIG-GGKTLDTAKAVADY-LGVPVVIV--PTIAS  119 (366)
T ss_pred             HHCCCCEEEEEC-CHHHHHHHHHHHHH-CCCCEEEE--CCCCC
T ss_conf             864999899937-83887779999998-28997995--68666


No 200
>pfam04230 PS_pyruv_trans Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.
Probab=66.61  E-value=10  Score=18.15  Aligned_cols=35  Identities=14%  Similarity=0.206  Sum_probs=29.5

Q ss_pred             CCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEC
Q ss_conf             52035788763552331156688876275302540
Q gi|254780767|r  259 EQKKQVFMTCNAAMAASGTVILELALCGIPVVSIY  293 (383)
Q Consensus       259 ~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Y  293 (383)
                      .+..+.++.|++.|+..==++.-+.+.|+|+|.+.
T Consensus       221 ~~~~~~i~~~~~vi~~RlH~~I~a~~~gvP~i~i~  255 (258)
T pfam04230       221 EELLALISQADFVITTRLHGLIFALLLGVPFIVIA  255 (258)
T ss_pred             HHHHHHHHCCCEEEEECHHHHHHHHHCCCCEEEEE
T ss_conf             99999997098999837379999997599989971


No 201
>PRK11173 two-component response regulator; Provisional
Probab=66.27  E-value=6.3  Score=19.45  Aligned_cols=79  Identities=10%  Similarity=0.254  Sum_probs=46.6

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973899839999717899947880650444531101367466459999999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |.+-||+++--|++   .+..+...|...   ++++.+.+--                                   .+.
T Consensus         1 m~~~~ILiVEDD~~---~~~~l~~~L~~~---G~~V~~a~~~-----------------------------------~ea   39 (237)
T PRK11173          1 MQTPHILIVEDELV---TRNTLKSIFEAE---GYDVFEATDG-----------------------------------AEM   39 (237)
T ss_pred             CCCCEEEEEECCHH---HHHHHHHHHHHC---CCEEEEECCH-----------------------------------HHH
T ss_conf             99998999959899---999999999988---9999998999-----------------------------------999


Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEE
Q ss_conf             86100128886898-5117765-79999866301346311110
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv  121 (383)
                      .+.+.++.||++|+ +.-||.| +.+++.+|+.. .+|+|...
T Consensus        40 ~~~l~~~~~DlvilDi~lp~~~G~~l~~~iR~~~-~~piI~lt   81 (237)
T PRK11173         40 HQILSENDINLVIMDINLPGKNGLLLARELREQA-NVALMFLT   81 (237)
T ss_pred             HHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHCC-CCCEEEEE
T ss_conf             9998638998999938999887303555665168-84789994


No 202
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentiall
Probab=66.22  E-value=10  Score=18.10  Aligned_cols=48  Identities=15%  Similarity=0.252  Sum_probs=32.5

Q ss_pred             HHHHHHHHHCCCCCCCEEE-EECHHHHH----HHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             9999998610012888689-85117765----79999866301346311110022
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLL-IVDNPDFT----HRVAKRVRKKMPNLPIINYVCPS  124 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi-~iD~pgFn----l~lak~lkk~~~~ipvi~yv~Pq  124 (383)
                      ..+++..+...+...+.+| -||+||=.    +.+.+.++..  .+|++-||.|+
T Consensus        16 ~~l~r~l~~A~~~~a~~ivl~idTpGG~v~~~~~I~~~I~~~--~~pvv~~V~~~   68 (178)
T cd07021          16 AFVERALKEAKEEGADAVVLDIDTPGGRVDSALEIVDLILNS--PIPTIAYVNDR   68 (178)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCC
T ss_conf             999999999996899789999979998689999999999848--99999999992


No 203
>PRK05299 rpsB 30S ribosomal protein S2; Provisional
Probab=66.14  E-value=10  Score=18.09  Aligned_cols=20  Identities=35%  Similarity=0.511  Sum_probs=15.1

Q ss_pred             HHHHHHHHHCCCEEEECCCC
Q ss_conf             56688876275302540577
Q gi|254780767|r  277 TVILELALCGIPVVSIYKSE  296 (383)
Q Consensus       277 TaTLE~al~g~P~IV~Yk~~  296 (383)
                      +|..||.-+|+|.|-+-.|+
T Consensus       171 ~AV~EA~kl~IPvI~ivDTn  190 (255)
T PRK05299        171 IAVKEARKLGIPVVAIVDTN  190 (255)
T ss_pred             HHHHHHHHCCCCEEEEECCC
T ss_conf             99999997599888762489


No 204
>PRK03379 vitamin B12-transporter protein BtuF; Provisional
Probab=66.09  E-value=10  Score=18.09  Aligned_cols=71  Identities=14%  Similarity=0.154  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             46645999999999986100128886898511776579999866301346311110022110036635579999986401
Q gi|254780767|r   66 VVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        66 vl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~  145 (383)
                      ..+++|++-...+--.+.|..-+||+||.-+.. ..-+....|++.  |||+++. .       ......+.+.+..+-.
T Consensus        55 ~a~~lp~VG~~~~~~~E~IlaL~PDLVia~~~~-~~~~~~~~L~~~--GI~v~~~-~-------~~sl~di~~~i~~lG~  123 (265)
T PRK03379         55 QAQKIEQVSTWQGMNLERIVALKPDLVLAWRGG-NAERQVDQLASL--GIKVMWV-D-------ATSIEQIADALRQLAP  123 (265)
T ss_pred             HHHCCCCCCCCCCCCHHHHHHHCCCEEEEECCC-CCHHHHHHHHHC--CCEEEEC-C-------CCCHHHHHHHHHHHHH
T ss_conf             785487027888989999996399989995688-958999999816--9758835-9-------9999999999999998


Q ss_pred             CC
Q ss_conf             56
Q gi|254780767|r  146 IL  147 (383)
Q Consensus       146 if  147 (383)
                      ++
T Consensus       124 ~~  125 (265)
T PRK03379        124 WS  125 (265)
T ss_pred             HC
T ss_conf             65


No 205
>PRK13131 consensus
Probab=65.69  E-value=10  Score=18.04  Aligned_cols=56  Identities=18%  Similarity=0.187  Sum_probs=25.0

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHH
Q ss_conf             99986100128886898511776-57999986630134631111002211003663557999
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCA  138 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~  138 (383)
                      ++..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|+.|+|+-   .+.|++++.+
T Consensus       105 e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~--~l~~I~lvaPtt---~~~Ri~~i~~  161 (257)
T PRK13131        105 DGFYAQAKECGVDSVLIADMPLIEKELVIKSAQKH--QIKQIFIASPNA---SVKDLEQVAT  161 (257)
T ss_pred             HHHHHHHHHCCCCCEECCCCCHHHHHHHHHHHHHC--CCCEEEEECCCC---CHHHHHHHHH
T ss_conf             99999998659985655899967889999999977--984799728999---8899999983


No 206
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=65.38  E-value=9  Score=18.43  Aligned_cols=36  Identities=17%  Similarity=0.175  Sum_probs=30.2

Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             387430123051118999876402735126201663
Q gi|254780767|r  200 GSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS  235 (383)
Q Consensus       200 GSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~  235 (383)
                      .||..+++.|.+++.+.++.+.+..|+-.+++.+.|
T Consensus        85 ~~R~dll~~Na~I~~~i~~~i~~~~p~~ivivvtNP  120 (142)
T pfam00056        85 MTRLDLLNRNAGIFKDIVPAIAKSAPDAIVLVVSNP  120 (142)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             877899997469999999999976998199994594


No 207
>pfam07454 SpoIIP Stage II sporulation protein P (SpoIIP). This family contains the bacterial stage II sporulation protein P (SpoIIP) (approximately 350 residues long). It has been shown that a block in polar cytokinesis in Bacillus subtilis is mediated partly by transcription of spoIID, spoIIM and spoIIP. This inhibition of polar division is involved in the locking in of asymmetry after the formation of a polar septum during sporulation. Engulfment in Bacillus subtilis is mediated by two complementary systems: the first includes the proteins SpoIID, SpoIIM and SpoIIP (DMP) which carry out the engulfment, and the second includes the SpoIIQ-SpoIIIAGH (Q-AH) zipper, that recruits other proteins to the septum in a second-phase of the engulfment. The course of events follows as the incorporation firstly of SpoIIB into the septum during division to serve directly or indirectly as a landmark for localising SpoIIM and then SpoIIP and SpoIID to the septum. SpoIIP and SpoIID interact together to
Probab=65.24  E-value=11  Score=17.98  Aligned_cols=37  Identities=19%  Similarity=0.245  Sum_probs=23.2

Q ss_pred             EEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             5998538743012305111899987640273512620
Q gi|254780767|r  195 ILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSL  231 (383)
Q Consensus       195 I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i  231 (383)
                      |.+.=|++....+.++-.-.+....+.+.+|.+.--+
T Consensus       179 i~fVvG~~np~~~~N~~fA~~l~~~~~~~yPGl~rgi  215 (258)
T pfam07454       179 IMFVVGRKNPNYEKNLEFAKKLKAKADEKYPGLSRGI  215 (258)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             9999778998999999999999999997789864212


No 208
>cd01140 FatB Siderophore binding protein FatB.  These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=65.12  E-value=5.3  Score=19.99  Aligned_cols=37  Identities=24%  Similarity=0.363  Sum_probs=21.5

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             8610012888689851177657999986630134631111002
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP  123 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P  123 (383)
                      .+.|..-+||+||.-+...   .....+.+.   -|++++..+
T Consensus        65 ~E~I~~l~PDLIi~~~~~~---~~~~~l~~i---ap~v~~~~~  101 (270)
T cd01140          65 LEAIAALKPDLIIIGGRLA---EKYDELKKI---APTIDLGAD  101 (270)
T ss_pred             HHHHHHCCCCEEEECCCCH---HHHHHHHHH---CCEEEEECC
T ss_conf             9999713999999838417---889999854---775798458


No 209
>KOG2941 consensus
Probab=65.01  E-value=11  Score=17.95  Aligned_cols=132  Identities=11%  Similarity=0.188  Sum_probs=76.4

Q ss_pred             HHHCCCHHHHHHHHH-------HCCCCCEEEECCCCCHHHHHHHHHHHCCCC-CEEE---EECCCCHHHHHHHHHHHC--
Q ss_conf             230511189998764-------027351262016633688999999604888-5055---205520357887635523--
Q gi|254780767|r  207 YKILPFFESAVASLV-------KRNPFFRFSLVTVSSQENLVRCIVSKWDIS-PEII---IDKEQKKQVFMTCNAAMA--  273 (383)
Q Consensus       207 ~~~lP~~l~~~~~l~-------~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~-~~i~---~~~~~~~~~l~~sd~ai~--  273 (383)
                      ...+-+++++++...       ...|.+.++|-.-...++...+.+.+.+.. ..+.   ..-++...++..||+.++  
T Consensus       267 DEdf~ILL~AL~~y~~~~~~~~~~lP~llciITGKGPlkE~Y~~~I~~~~~~~v~~~tpWL~aEDYP~ll~saDlGVcLH  346 (444)
T KOG2941         267 DEDFGILLEALVIYEEQLYDKTHNLPSLLCIITGKGPLKEKYSQEIHEKNLQHVQVCTPWLEAEDYPKLLASADLGVCLH  346 (444)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHCCCCCEEEE
T ss_conf             63278999999864555401357997379999278831689999987715321036502232110066763143134763


Q ss_pred             --CCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCC------HHHHHHHHHHHHC
Q ss_conf             --31156688876275302540577410000102467610230244078426124205489------8999999999844
Q gi|254780767|r  274 --ASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIR------SEALVRWIERLSQ  345 (383)
Q Consensus       274 --~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~------~~~i~~~~~~ll~  345 (383)
                        +||        +..||=|+=-              --.+||-+-.+-...-||+++.-|      .+++++.+..+.+
T Consensus       347 tSSSG--------LDLPMKVVDM--------------FGcglPvcA~~fkcl~ELVkh~eNGlvF~Ds~eLa~ql~~lf~  404 (444)
T KOG2941         347 TSSSG--------LDLPMKVVDM--------------FGCGLPVCAVNFKCLDELVKHGENGLVFEDSEELAEQLQMLFK  404 (444)
T ss_pred             ECCCC--------CCCCHHHHHH--------------HCCCCCEEEECCHHHHHHHHCCCCCEEECCHHHHHHHHHHHHH
T ss_conf             04766--------6764667776--------------2578743664565389998567785375059999999999985


Q ss_pred             ----CHHHHHHHHHHHHHH
Q ss_conf             ----989999999999999
Q gi|254780767|r  346 ----DTLQRRAMLHGFENL  360 (383)
Q Consensus       346 ----d~~~r~~~~~~~~~~  360 (383)
                          |.+..++...+.++-
T Consensus       405 ~fp~~a~~l~~lkkn~~e~  423 (444)
T KOG2941         405 NFPDNADELNQLKKNLREE  423 (444)
T ss_pred             CCCCCHHHHHHHHHHHHHH
T ss_conf             4999878999999865787


No 210
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional
Probab=64.75  E-value=7.5  Score=18.98  Aligned_cols=18  Identities=6%  Similarity=0.126  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHCCCCEEEE
Q ss_conf             9999999997389983999
Q gi|254780767|r   19 AGDLIKSLKEMVSYPINLV   37 (383)
Q Consensus        19 ~a~li~~Lk~~~~~~~~~~   37 (383)
                      |-.+++.+++. ++++.+.
T Consensus        63 Glell~~ir~~-~p~~pvI   80 (457)
T PRK11361         63 GIKALKEMRSH-ETRTPVI   80 (457)
T ss_pred             HHHHHHHHHHC-CCCCCEE
T ss_conf             99999999820-9899389


No 211
>cd01980 Chlide_reductase_Y Chlide_reductase_Y : Y subunit of chlorophyllide (chlide) reductase (BchY).  Chlide reductase participates in photosynthetic pigment synthesis playing a role in the conversion of chlorophylls(Chl) into bacteriochlorophylls (BChl). Chlide reductase catalyzes the reduction of the B-ring of the tetrapyrolle. Chlide reductase is a three subunit enzyme (subunits are designated BchX, BchY and BchZ). The similarity between these three subunits and the subunits for nitrogenase suggests that BchX serves as an electron donor for the BchY-BchY catalytic subunits.
Probab=64.74  E-value=2.2  Score=22.47  Aligned_cols=155  Identities=8%  Similarity=0.138  Sum_probs=79.7

Q ss_pred             HHCCCCCCCEEEEECH-----HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHH-HHCCCCCCCHHHHH
Q ss_conf             6100128886898511-----77657999986630134631111002211003663557999998-64015677422320
Q gi|254780767|r   82 ELIVSSKPDVLLIVDN-----PDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYIN-QVISILPFEKEVMQ  155 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~-----pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d-~~~~ifpFE~~~f~  155 (383)
                      +..+..+|++++.|-.     -|.-+++..   ++..|+||+-|-.|-+=      ++...+..| .+..+++-.++.=.
T Consensus        85 ~ia~~~~~~~I~vigtC~~E~ig~~lell~---~~~~gv~Ii~~~~~G~~------t~a~~~~~da~~~~~~~r~~~~~~  155 (416)
T cd01980          85 KLADPPAYTFIPVISLCVAETAGVAEELLP---KQIDGVRVILVRGPAFP------IHSHPEAKDVGAMLLLARFEDFDG  155 (416)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHCCCHHHCH---HHCCCCEEEEEECCCCC------CEECCHHHHHHHHHHCCCCCCCCC
T ss_conf             860768888899965661765376743375---55189659996358850------031201589999986355521147


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHH---------CCCHHHHHHHHHHCCCC
Q ss_conf             025531476388211221001355888976187655650599853874301230---------51118999876402735
Q gi|254780767|r  156 RLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKI---------LPFFESAVASLVKRNPF  226 (383)
Q Consensus       156 k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~---------lP~~l~~~~~l~~~~~~  226 (383)
                      ....-...-+|. +.+-...  .-....++.|+..    ...||+-|..|+-..         -|.+-+++..+..+...
T Consensus       156 p~~~~~l~l~G~-l~p~d~~--~i~~~L~~mGi~~----~~~LP~r~~~eLp~~g~~~~va~~~PFl~~Ta~~l~~rGr~  228 (416)
T cd01980         156 PVAEPSLALLGE-MFPADPV--AIGSVLERMGLAA----VPVVPTREWRELYAAGDAAAVAALHPFYTATIRELEEAGRP  228 (416)
T ss_pred             CCCCCCEEEEEC-CCCCCHH--HHHHHHHHCCCCC----CCCCCCCCHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             878987589841-6987589--9999999749974----55689986434554477459997476306789999980983


Q ss_pred             CEEEECCC-CCHHHHHHHHHHHCCCCC
Q ss_conf             12620166-336889999996048885
Q gi|254780767|r  227 FRFSLVTV-SSQENLVRCIVSKWDISP  252 (383)
Q Consensus       227 ~~~~i~~~-~~~~~~~~~~~~~~~~~~  252 (383)
                      +.--.|.. .....+++.+-..++++.
T Consensus       229 i~~~~PiG~eGT~aWL~ai~~~fgv~~  255 (416)
T cd01980         229 IVSGAPVGADGTAAWLEAVGEALGLDM  255 (416)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCH
T ss_conf             057899581489999999999949898


No 212
>PRK10481 hypothetical protein; Provisional
Probab=64.61  E-value=8.1  Score=18.73  Aligned_cols=30  Identities=17%  Similarity=0.319  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      .++.....++.+.+.+...|++++.....|
T Consensus        72 ~~v~~~lq~~i~~le~~G~d~ilLlCTG~F  101 (224)
T PRK10481         72 QKVERDLQSVIEVLDNQGYDVILLLCTGNF  101 (224)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             997888999999998679989999724678


No 213
>pfam07302 AroM AroM protein. This family consists of several bacterial and archaeal AroM proteins. In Escherichia coli the aroM gene is cotranscribed with aroL. The function of this family is unknown.
Probab=64.20  E-value=8.2  Score=18.71  Aligned_cols=31  Identities=23%  Similarity=0.369  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH
Q ss_conf             9999999999861001288868985117765
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFT  101 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn  101 (383)
                      .++.....++.+.+.+...|++++...-.|.
T Consensus        70 ~~v~~~lq~~i~~Le~~G~d~ilLlCTG~F~  100 (221)
T pfam07302        70 QKIERRLQQVIEKLDKEGVDVILLLCTGEFP  100 (221)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             9988989999999986799899996147789


No 214
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=63.94  E-value=11  Score=17.82  Aligned_cols=90  Identities=17%  Similarity=0.281  Sum_probs=51.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||.++....-|-.|    ++.+++. .+++++.|+..+.-+..  +..  -+.+++-              .+....+.
T Consensus         1 iki~iiG~G~~g~~~----~~~~~~~-~~~~~i~ai~d~~~~~~--~~~--~~~~~~~--------------~~~~~~~~   57 (120)
T pfam01408         1 LRVGIVGAGKIGRRH----LRALNES-QDGAELVGVLDPDPARA--EAV--AESFGVP--------------AYSDLEEL   57 (120)
T ss_pred             CEEEEEECHHHHHHH----HHHHHHC-CCCCEEEEEECCCHHHH--HHH--HHHHCCC--------------EECCHHHH
T ss_conf             989999077999999----9999855-99978999982999999--999--9983996--------------78869999


Q ss_pred             CCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             00128886898511776579999866301346311
Q gi|254780767|r   84 IVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPII  118 (383)
Q Consensus        84 i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi  118 (383)
                      +...++|+|+..-.++.+..++.++=++  |++++
T Consensus        58 l~~~~iD~v~I~tp~~~H~~~~~~~l~~--g~~v~   90 (120)
T pfam01408        58 LADPDVDAVSVATPPGLHFELALAALEA--GKHVL   90 (120)
T ss_pred             HHCCCCCEEEECCCHHHHHHHHHHHHHH--CCEEE
T ss_conf             7377889899908746189999999981--99899


No 215
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain. This domain shows similarity with B12 (adenosylcobamide) binding domains found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase, but it lacks the signature motif Asp-X-His-X-X-Gly, which contains the histidine that acts as a cobalt ligand. The function of this domain remains unclear.
Probab=63.80  E-value=9.7  Score=18.23  Aligned_cols=35  Identities=26%  Similarity=0.270  Sum_probs=19.8

Q ss_pred             CCCCCCEEEEE-CHH--HHHHHHHHHHHHHCCCCCCEE
Q ss_conf             01288868985-117--765799998663013463111
Q gi|254780767|r   85 VSSKPDVLLIV-DNP--DFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        85 ~~~~Pd~vi~i-D~p--gFnl~lak~lkk~~~~ipvi~  119 (383)
                      ++.+||+|.+- =++  .+..++++.+|+..++++++-
T Consensus        36 ~~~~pdvvg~s~~~~~~~~~~~~~~~~k~~~p~~~iv~   73 (127)
T cd02068          36 ELLKPDVVGISLMTSAIYEALELAKIAKEVLPNVIVVV   73 (127)
T ss_pred             HCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             64996999999768899999999999999789978998


No 216
>TIGR00661 MJ1255 conserved hypothetical protein; InterPro: IPR005262    The function of this domain is unknown. A small region (~50 amino acids) within the domain appears to be related to a family of sugar transferases. .
Probab=63.32  E-value=11  Score=17.75  Aligned_cols=271  Identities=18%  Similarity=0.266  Sum_probs=139.7

Q ss_pred             EEEEECCCCHHHHHHH-HHHHHHHHCCCCEEEEEECCHH---HHHCCCEEEECHHHCCEEEH---HHHHHH-------HH
Q ss_conf             9999768214789999-9999997389983999971789---99478806504445311013---674664-------59
Q gi|254780767|r    6 IAVIAGEISGDLLAGD-LIKSLKEMVSYPINLVGVGGPS---LQKEGLVSLFDFSELSVIGI---MQVVRH-------LP   71 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~-li~~Lk~~~~~~~~~~giGG~~---m~~~G~~~~~~~~~l~v~G~---~evl~~-------~~   71 (383)
                      ++-+|||-.|+..-+. +..++++. +.++.+..-|-+.   +...|.........+...|-   ++.++.       .|
T Consensus         3 ~~~~~g~g~g~~~~~~~~~~~~~~~-~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p   81 (353)
T TIGR00661         3 LYGVCGEGFGHAARSGAIGDALKEQ-DYEVDYLASGRPAENYLSKEGFGDFETFPGLNLAGEDGKVNDVKTFLRKKELLP   81 (353)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC-CCEEEEEECCCCHHHHHHHHHCCHHHHHCCCEEECCCCCCHHHHHHHHHHCCCH
T ss_conf             3420257743035677778764201-110445532751244555430001222113112015664025777776402450


Q ss_pred             -HHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCC---------CCCCCH-HHH-HHH
Q ss_conf             -99999999986100128886898511776579999866301346311110022110---------036635-579-999
Q gi|254780767|r   72 -QFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWA---------WREGRA-RKM-CAY  139 (383)
Q Consensus        72 -~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWA---------Wr~~R~-k~~-~~~  139 (383)
                       .+++.++...+.+...+||+++. |+.-...-.++.++.-..++.-.|.+......         |....+ +.+ .+.
T Consensus        82 ~~~~~~~~~~~~~~~~~~~d~~~~-d~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (353)
T TIGR00661        82 RDLKENLRLEVKILRDFGPDLILS-DFEPYTAVAAKLLKIPLIGISNLHVINQNYFLYPLPLKGDKWPDEAVLRHFAPRP  160 (353)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE-CCHHHHHHHHHHHHCCCEEECCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             358999999888776417742540-3204678887764043000032012111012111011134556788888764323


Q ss_pred             HHHHCCCCCCCHHHHHCCCCCCEEECCC---CCCCC-CCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHH
Q ss_conf             9864015677422320025531476388---21122-1001355888976187655650599853874301230511189
Q gi|254780767|r  140 INQVISILPFEKEVMQRLGGPPTTFVGH---PLSSS-PSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFES  215 (383)
Q Consensus       140 ~d~~~~ifpFE~~~f~k~~~~~~~fVGH---Pl~d~-~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~  215 (383)
                      ...++.-|+|+..... + +++..+.-.   |+... +.          ...--..+.++..+||+...  .    -+++
T Consensus       161 ~~~~~~~~~~~~~~~~-~-~~~~~~~~~~~~p~~~~~~~----------~~~~~~~~~~~~~~~g~~~~--~----~~~~  222 (353)
T TIGR00661       161 ERLLLPWYPFPEPILP-Y-NLPIIKAPEFIGPLLRYDVD----------DLDPYGGDYILVYLGGFENN--N----KLLE  222 (353)
T ss_pred             HHHCCCCCCCCCCCCC-C-CCHHHHHHHHHHHHHHHHHH----------HCCCCCCCEEEEEECCCHHH--H----HHHH
T ss_conf             4530232123210242-1-11023101454456665443----------10012464478973562136--8----9999


Q ss_pred             HHHHHH-HCCCCCEEEECCCCCHHHHHHHH-HHHC-CCCCEE-EEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEE
Q ss_conf             998764-02735126201663368899999-9604-888505-52055203578876355233115668-8876275302
Q gi|254780767|r  216 AVASLV-KRNPFFRFSLVTVSSQENLVRCI-VSKW-DISPEI-IIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVV  290 (383)
Q Consensus       216 ~~~~l~-~~~~~~~~~i~~~~~~~~~~~~~-~~~~-~~~~~i-~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~I  290 (383)
                      ....+. +.+-+.++++-.........+.. +... ..+..+ .+..++....+..|...++..|-.+. |+..+|.|.+
T Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~~~~~  302 (353)
T TIGR00661       223 LLGKIDLKNNLNVKFVCYGPEVPGKLLRDLNLNELKDENVELRRLNEGDFKEDLENAAGVITNGGFSLPSEALALGKPLL  302 (353)
T ss_pred             HHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCEE
T ss_conf             88754320256137886054213467642131001356425886031257887755433111575023566765156413


Q ss_pred             EECCCC
Q ss_conf             540577
Q gi|254780767|r  291 SIYKSE  296 (383)
Q Consensus       291 V~Yk~~  296 (383)
                      +.--.+
T Consensus       303 ~~p~~~  308 (353)
T TIGR00661       303 VVPLLG  308 (353)
T ss_pred             EECCCC
T ss_conf             411444


No 217
>KOG1387 consensus
Probab=63.25  E-value=11  Score=17.74  Aligned_cols=255  Identities=14%  Similarity=0.195  Sum_probs=119.5

Q ss_pred             HHHHHHHCCCCCCCEEE-EECHHHHHHHHHHHHHHHCCCCCCEEEEC-CCC----------------CCCCCCCHHHHHH
Q ss_conf             99998610012888689-85117765799998663013463111100-221----------------1003663557999
Q gi|254780767|r   77 INQTVELIVSSKPDVLL-IVDNPDFTHRVAKRVRKKMPNLPIINYVC-PSV----------------WAWREGRARKMCA  138 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi-~iD~pgFnl~lak~lkk~~~~ipvi~yv~-Pqv----------------WAWr~~R~k~~~~  138 (383)
                      +--..+.+....||+.| ++-|| |.+++-++++    ++|++-||- |.+                -+|++     + -
T Consensus       139 mIl~~Eai~r~~Pdi~IDtMGY~-fs~p~~r~l~----~~~V~aYvHYP~iS~DML~~l~qrq~s~~l~~~K-----l-a  207 (465)
T KOG1387         139 MILAFEAIIRFPPDIFIDTMGYP-FSYPIFRRLR----RIPVVAYVHYPTISTDMLKKLFQRQKSGILVWGK-----L-A  207 (465)
T ss_pred             HHHHHHHHHHCCCHHEEECCCCC-CHHHHHHHHC----CCCEEEEEECCCCCHHHHHHHHHHHHCCHHHHHH-----H-H
T ss_conf             99999999818833168547874-0008999871----6953899845603288999998621012113577-----8-9


Q ss_pred             HHHHHCCCCCCCHHHHHCCCCCCEEEC-------CCCCCC--------CCCCCCCHHHHHHHCCCCCCCCEEEEEECCCC
Q ss_conf             998640156774223200255314763-------882112--------21001355888976187655650599853874
Q gi|254780767|r  139 YINQVISILPFEKEVMQRLGGPPTTFV-------GHPLSS--------SPSILEVYSQRNKQRNTPSQWKKILLLPGSRA  203 (383)
Q Consensus       139 ~~d~~~~ifpFE~~~f~k~~~~~~~fV-------GHPl~d--------~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~  203 (383)
                      |.....+       .|+. .|..+.+|       -|-+..        .+-+..+.++..+..+....+...+|--|-=+
T Consensus       208 Y~rlFa~-------lY~~-~G~~ad~vm~NssWT~nHI~qiW~~~~~~iVyPPC~~e~lks~~~te~~r~~~ll~l~Q~R  279 (465)
T KOG1387         208 YWRLFAL-------LYQS-AGSKADIVMTNSSWTNNHIKQIWQSNTCSIVYPPCSTEDLKSKFGTEGERENQLLSLAQFR  279 (465)
T ss_pred             HHHHHHH-------HHHH-CCCCCEEEEECCHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHCCCCCCCEEEEEEEECC
T ss_conf             9999999-------9986-1464229996266567789998602621487289887888877424577604789876037


Q ss_pred             CCHHHHCCCHHHHHHHHHHC----CCCCEEEECCC--CCHH-HH---HHHHHHHCCCCCEEEEECC----CCHHHHHHHH
Q ss_conf             30123051118999876402----73512620166--3368-89---9999960488850552055----2035788763
Q gi|254780767|r  204 QEIYKILPFFESAVASLVKR----NPFFRFSLVTV--SSQE-NL---VRCIVSKWDISPEIIIDKE----QKKQVFMTCN  269 (383)
Q Consensus       204 ~EI~~~lP~~l~~~~~l~~~----~~~~~~~i~~~--~~~~-~~---~~~~~~~~~~~~~i~~~~~----~~~~~l~~sd  269 (383)
                      .| ++|=-+-+++.......    -+..+.+++..  ++.+ +.   ++....+.+++.++....+    +.-+.+..|.
T Consensus       280 PE-KnH~~Lql~Al~~~~~pl~a~~~~iKL~ivGScRneeD~ervk~Lkd~a~~L~i~~~v~F~~N~Py~~lv~lL~~a~  358 (465)
T KOG1387         280 PE-KNHKILQLFALYLKNEPLEASVSPIKLIIVGSCRNEEDEERVKSLKDLAEELKIPKHVQFEKNVPYEKLVELLGKAT  358 (465)
T ss_pred             CC-CCCHHHHHHHHHHHCCCHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHCCCE
T ss_conf             65-55588999999975182010468825999705478113999998887898628754538995598799999861155


Q ss_pred             HHHCC-----CHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHH
Q ss_conf             55233-----1156688876275302540577410000102467610230244078426124205489899999999984
Q gi|254780767|r  270 AAMAA-----SGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLS  344 (383)
Q Consensus       270 ~ai~~-----SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll  344 (383)
                      +.+-+     -|-...|.++.|.=+|+---.+|+--     +-.++.|=++=         |+-  -|.++-++.+.++.
T Consensus       359 iGvh~MwNEHFGIsVVEyMAAGlIpi~h~SgGP~lD-----IV~~~~G~~tG---------Fla--~t~~EYaE~iLkIv  422 (465)
T KOG1387         359 IGVHTMWNEHFGISVVEYMAAGLIPIVHNSGGPLLD-----IVTPWDGETTG---------FLA--PTDEEYAEAILKIV  422 (465)
T ss_pred             EEHHHHHHHHCCHHHHHHHHCCCEEEEECCCCCCEE-----EEECCCCCCCE---------EEC--CCHHHHHHHHHHHH
T ss_conf             545244552035568998755726887078997323-----64045786010---------115--87289999999999


Q ss_pred             C-CHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             4-9899999999999999983899
Q gi|254780767|r  345 Q-DTLQRRAMLHGFENLWDRMNTK  367 (383)
Q Consensus       345 ~-d~~~r~~~~~~~~~~~~~Lg~~  367 (383)
                      . |++.|..++++.+.-..+.|+.
T Consensus       423 ~~~~~~r~~~r~~AR~s~~RFsE~  446 (465)
T KOG1387         423 KLNYDERNMMRRNARKSLARFGEL  446 (465)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             719888888899999999886688


No 218
>PRK09534 btuF corrinoid ABC transporter substrate-binding protein; Reviewed
Probab=62.64  E-value=7.7  Score=18.89  Aligned_cols=61  Identities=13%  Similarity=0.228  Sum_probs=37.3

Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH
Q ss_conf             986100128886898511776579999866301346311110022110036635579999986401567742
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEK  151 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~  151 (383)
                      =++.|..-+||+|+.-  -++.-...+.|++.  ||||+++-+|+       .+..+.+.+..+-.++.-|.
T Consensus       111 NvE~IiaL~PDLVla~--~~~~~~~v~~L~~~--GI~V~v~~~a~-------SiddV~~~I~~iG~~tg~~e  171 (364)
T PRK09534        111 NVEAVVGLDPDLVLAP--NTVRNDTVTRLRSA--GITVFQFRAAT-------SIDGVVEKTATIGRLTGNCA  171 (364)
T ss_pred             CHHHHHCCCCCEEEEC--CCCCHHHHHHHHHC--CCEEEEECCCC-------CHHHHHHHHHHHHHHHCCHH
T ss_conf             9999961699889965--87756789999976--99699918988-------99999999999999839856


No 219
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains; InterPro: IPR005690    Two integral outer envelope GTPases, Toc34 and Toc86, are proposed to regulate the recognition and translocation of nuclear-encoded preproteins during the early stages of protein import into chloroplasts. The long precursor of the 86K protein is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation . The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009707 chloroplast outer membrane.
Probab=62.18  E-value=3.8  Score=20.89  Aligned_cols=66  Identities=24%  Similarity=0.425  Sum_probs=44.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE----EECCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             9999999999861001288868985117765799998663013463111----100221100366355799999864015
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN----YVCPSVWAWREGRARKMCAYINQVISI  146 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~----yv~PqvWAWr~~R~k~~~~~~d~~~~i  146 (383)
                      .+=.|.++..++.+++..||+|+-||      ||--.-|-. .+.|++-    -..|+||-   +    ..=...|-++.
T Consensus       190 s~N~K~L~sVK~~~KK~PPDIVLY~D------RLD~Q~RD~-~dlPlLRti~~~lGpsIW~---N----~IV~LTHAAS~  255 (772)
T TIGR00993       190 SKNEKILSSVKKLIKKNPPDIVLYVD------RLDLQTRDL-NDLPLLRTITDVLGPSIWK---N----AIVTLTHAASA  255 (772)
T ss_pred             HHCHHHHHHHHHHHCCCCCCEEEEEC------CCCCCCCCC-CCCCHHHHHHHHHCCHHHH---H----HHHHHHHCCCC
T ss_conf             30206888888863179696698600------223334656-6774475777561610132---0----43211100368


Q ss_pred             CCCC
Q ss_conf             6774
Q gi|254780767|r  147 LPFE  150 (383)
Q Consensus       147 fpFE  150 (383)
                      =|=|
T Consensus       256 PPDg  259 (772)
T TIGR00993       256 PPDG  259 (772)
T ss_pred             CCCC
T ss_conf             7678


No 220
>PRK10610 chemotaxis regulatory protein CheY; Provisional
Probab=61.95  E-value=8.8  Score=18.52  Aligned_cols=35  Identities=14%  Similarity=0.276  Sum_probs=16.7

Q ss_pred             CCCCCCEEEE-ECHHHHH-HHHHHHHHHHC--CCCCCEE
Q ss_conf             0128886898-5117765-79999866301--3463111
Q gi|254780767|r   85 VSSKPDVLLI-VDNPDFT-HRVAKRVRKKM--PNLPIIN  119 (383)
Q Consensus        85 ~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~--~~ipvi~  119 (383)
                      .+..||++++ +.-|+.| +.+.+.+|+..  .++|++-
T Consensus        47 ~~~~~Dlil~D~~MP~~dG~el~~~ir~~~~~~~~Pii~   85 (129)
T PRK10610         47 QAGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVLM   85 (129)
T ss_pred             HHCCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             858999999818999998999999998577778996899


No 221
>PRK03877 consensus
Probab=61.91  E-value=12  Score=17.58  Aligned_cols=120  Identities=22%  Similarity=0.235  Sum_probs=62.4

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHH-HHHHHH-CCCCEEEEEECCHHHHH-----CCCE----EEECHHHC-------CEE-
Q ss_conf             98745999976821478999999-999973-89983999971789994-----7880----65044453-------110-
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLI-KSLKEM-VSYPINLVGVGGPSLQK-----EGLV----SLFDFSEL-------SVI-   61 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li-~~Lk~~-~~~~~~~~giGG~~m~~-----~G~~----~~~~~~~l-------~v~-   61 (383)
                      |+| +|.|+.||++|  .|..++ ++|++. .....++.=+|....-+     .|.+    .+.+.++.       .++ 
T Consensus         1 mKP-~IaIT~GDPaG--IGpEIilKal~~~~~~~~~~~vvigd~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~~i~~~~   77 (328)
T PRK03877          1 MKP-IIGITMGDAAG--VGPEIIVKALADKSVYEQCRPLVIGDAKRLERAGRIVGSELKVRAIQDPDEARFEFGTIDCID   77 (328)
T ss_pred             CCC-EEEEECCCCCH--HHHHHHHHHHHCCHHHCCCCEEEEECHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCCCEEEE
T ss_conf             999-79991588537--699999999968113505999999789999999998299971467389778523589315874


Q ss_pred             ----------EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             ----------136746645999999999986100128886898------------5117765799998663013463111
Q gi|254780767|r   62 ----------GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        62 ----------G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                                |-...- +=...+..++...+.+++.+.|++|+            .+|||-.--||+.....   -+..-
T Consensus        78 ~~~~~~~~~~G~~~~~-~g~~~~~sl~~A~~~~~~g~~~alVT~PInK~~i~~ag~~f~GHTE~La~~~~~~---~~~Mm  153 (328)
T PRK03877         78 LDLLPADLPFGKVSAV-AGDAAFRYIERAVELAKAGKIDAICTAPLNKEALHAGGHMFPGHTEILAHLTGTE---EVSMM  153 (328)
T ss_pred             CCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHHHCCC---CEEEE
T ss_conf             5546677788987988-9999999999999999749868799678067889857999898199999886478---72577


Q ss_pred             EECCCCCC
Q ss_conf             10022110
Q gi|254780767|r  120 YVCPSVWA  127 (383)
Q Consensus       120 yv~PqvWA  127 (383)
                      ++++..|.
T Consensus       154 l~~~~LrV  161 (328)
T PRK03877        154 LVSPKLKV  161 (328)
T ss_pred             EECCCCEE
T ss_conf             85598689


No 222
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=61.71  E-value=12  Score=17.56  Aligned_cols=44  Identities=9%  Similarity=0.027  Sum_probs=27.8

Q ss_pred             HHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             999999861001288868985117765799998663013463111
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      +......+.+.+.+.++||+-.+.+-.+..+..+-.+ .++|++.
T Consensus        54 ~a~~~a~~Lv~~~~V~aviG~~~S~~~~a~~~~v~~~-~~v~~is   97 (312)
T cd06346          54 AGVAAATKLVNVDGVPGIVGAACSGVTIAALTSVAVP-NGVVMIS   97 (312)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHH-CCCCEEC
T ss_conf             9999999876408806974676618889889999986-5981762


No 223
>PRK13358 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=61.69  E-value=10  Score=18.01  Aligned_cols=32  Identities=16%  Similarity=0.336  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHHH
Q ss_conf             99999999998610012888689851177657
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFTH  102 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl  102 (383)
                      .+++..+.++.+++++.+||++|.+..=.||-
T Consensus        25 ~~~~~g~~~~r~~l~~~~PDvvVi~~~DH~~~   56 (269)
T PRK13358         25 LRVVSGMNEIGRRLRALRPDLLVIIGSDHLFN   56 (269)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCHHHHH
T ss_conf             89999999999999981999999985437876


No 224
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional
Probab=61.35  E-value=12  Score=17.52  Aligned_cols=117  Identities=21%  Similarity=0.202  Sum_probs=59.8

Q ss_pred             CCCEEEEEECCCCHHHHHHHH-HHHHHHHCCCCEEEEEECCHHHHH-----CCCEEEECHHHCCEEEHHHHH------HH
Q ss_conf             874599997682147899999-999997389983999971789994-----788065044453110136746------64
Q gi|254780767|r    2 NSLKIAVIAGEISGDLLAGDL-IKSLKEMVSYPINLVGVGGPSLQK-----EGLVSLFDFSELSVIGIMQVV------RH   69 (383)
Q Consensus         2 ~~mki~i~aGE~SGD~~~a~l-i~~Lk~~~~~~~~~~giGG~~m~~-----~G~~~~~~~~~l~v~G~~evl------~~   69 (383)
                      ++ ||.|..||++|=  |-.+ ++++++. .......-+|..++-+     .+.+...++....+....++-      .+
T Consensus         1 Kp-~IaIT~GDPaGI--GPEIilKa~~~~-~~~~~pii~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~G~~~~~~   76 (304)
T PRK03946          1 KK-KIAISIGDINGI--GLEIALKSHEEV-SKICEPLYFIDEELLNQASQLLNLKIPNDFEIDEPGLLFEIKPGKVSAKS   76 (304)
T ss_pred             CC-CEEEECCCCCHH--HHHHHHHHHHHH-HHHCCEEEEECHHHHHHHHHHCCCCCCCCCEECCCCCCCCCCCCCCCHHH
T ss_conf             99-189948886343--999999982876-86299199988999999999849999644213256644568899828899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             5999999999986100128886898------------51177657999986630134631111002211
Q gi|254780767|r   70 LPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKRVRKKMPNLPIINYVCPSVW  126 (383)
Q Consensus        70 ~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvW  126 (383)
                      =...++.++...+.+++.+.|++|+            ..|||..--||+...+.    ++.-++++..|
T Consensus        77 g~~~~~~l~~Ai~~~~~g~~~aiVT~PInK~~i~~aG~~f~GHTE~La~~~~~~----~~Mml~~~~L~  141 (304)
T PRK03946         77 GAYSFESFKKAVELADSKEVDAICTLPIHKKAWQKAGIPYVGHTDALRDRFKKN----AIMMLGCEKLF  141 (304)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHHHHCC----CEEEECCCCEE
T ss_conf             999999999999999839987999675469999858999898169999986024----32311168638


No 225
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenas
Probab=61.27  E-value=12  Score=17.51  Aligned_cols=33  Identities=18%  Similarity=0.109  Sum_probs=15.3

Q ss_pred             CCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             874301230511189998764027351262016
Q gi|254780767|r  201 SRAQEIYKILPFFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       201 SR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      ||....+.|.++|.+.++.+.+..|+-.+++.+
T Consensus        83 tR~dLl~~N~~I~~~i~~~i~~~~p~~i~lvvs  115 (300)
T cd01339          83 SRDDLLGTNAKIVKEVAENIKKYAPNAIVIVVT  115 (300)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             889999988999999999999659984899827


No 226
>cd01141 TroA_d Periplasmic binding protein TroA_d.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=61.17  E-value=9.2  Score=18.39  Aligned_cols=37  Identities=24%  Similarity=0.520  Sum_probs=25.3

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             8610012888689851177657999986630134631111
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      .+.|.+-+||+||+-+.. -+-.+...+.+.  |||++++
T Consensus        62 ~E~ilaL~PDlVi~~~~~-~~~~~~~~L~~~--gI~v~~~   98 (186)
T cd01141          62 VELIVALKPDLVILYGGF-QAQTILDKLEQL--GIPVLYV   98 (186)
T ss_pred             HHHHHHHCCCEEEEECCC-CCHHHHHHHHHC--CCCEEEE
T ss_conf             999997099999995887-867899999964--9957996


No 227
>PRK09581 pleD response regulator PleD; Reviewed
Probab=61.13  E-value=10  Score=18.13  Aligned_cols=39  Identities=23%  Similarity=0.584  Sum_probs=21.3

Q ss_pred             HHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHH--CCCCCCEEE
Q ss_conf             6100128886898-5117765-7999986630--134631111
Q gi|254780767|r   82 ELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKK--MPNLPIINY  120 (383)
Q Consensus        82 ~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~--~~~ipvi~y  120 (383)
                      +.+.+.+||+|++ +-=||.+ +.+++.+|..  ..+||+|..
T Consensus        40 ~~~~~~~PDLILlDi~MP~mdG~ev~r~Lk~~~~~~~iPVIvl   82 (457)
T PRK09581         40 EICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATAHIPVVMV   82 (457)
T ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEEEE
T ss_conf             9997189998999287799999999999965988899849999


No 228
>KOG0680 consensus
Probab=60.64  E-value=12  Score=17.61  Aligned_cols=55  Identities=16%  Similarity=-0.001  Sum_probs=23.6

Q ss_pred             EEEECCCCCCEEEE---EE--CCCCCC-EEEEHHHCCCCCCCHHHC--------CCCCHHHHHHHHHHH
Q ss_conf             02540577410000---10--246761-023024407842612420--------548989999999998
Q gi|254780767|r  289 VVSIYKSEWIVNFF---IF--YIKTWT-CALPNLIVDYPLVPEYFN--------SMIRSEALVRWIERL  343 (383)
Q Consensus       289 ~IV~Yk~~~lt~~i---~~--lik~~~-i~LpNii~~~~ivPEliQ--------~~~~~~~i~~~~~~l  343 (383)
                      ..+.|-+.=.+.-.   .+  -+|.+. --+.++-..+-.+||++.        .-=-|+.++..+..+
T Consensus       241 ~~i~YvLPDF~T~k~Gyvr~~~vk~~~d~qii~L~nErF~IPEilF~Psdi~I~q~GIpEAV~esl~~~  309 (400)
T KOG0680         241 VMIDYVLPDFSTSKRGYVRNEDVKLPEDEQIITLTNERFTIPEILFSPSDIGIQQPGIPEAVLESLSML  309 (400)
T ss_pred             EEEEEECCCCCCCCCEEEECCCCCCCCCCCEEEECCCCCCCCHHHCCHHHCCCCCCCCHHHHHHHHHHC
T ss_conf             578986477532231267558889987765146103211162330696443856479169999999869


No 229
>PRK06223 malate dehydrogenase; Reviewed
Probab=60.03  E-value=13  Score=17.37  Aligned_cols=60  Identities=18%  Similarity=0.073  Sum_probs=25.7

Q ss_pred             HHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEE--ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHH
Q ss_conf             35523311566888762753025405774100001--0246761023024407842612420548989
Q gi|254780767|r  269 NAAMAASGTVILELALCGIPVVSIYKSEWIVNFFI--FYIKTWTCALPNLIVDYPLVPEYFNSMIRSE  334 (383)
Q Consensus       269 d~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~--~lik~~~i~LpNii~~~~ivPEliQ~~~~~~  334 (383)
                      ..+++.+..--.++.+.+.-.|+-     .+.++-  .-+.--|+|+|=+|-.+.+ .+.+.-..+++
T Consensus       227 ~~~ia~a~~~iv~aIl~d~~~i~~-----~s~~l~g~yg~~~v~~s~P~~ig~~Gi-~~i~~l~L~~~  288 (312)
T PRK06223        227 YYAPAASIVEMVEAILKDKKRVLP-----CSAYLEGEYGIKDVYVGVPVKIGKNGV-EKVIEIELTED  288 (312)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEE-----EEEEECCCCCCCCEEEEEEEEECCCCE-EEECCCCCCHH
T ss_conf             478999999999998678997067-----899852666876679997899869955-99838999999


No 230
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This group includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); its ligand specificity has not been determined experimentally.
Probab=59.92  E-value=13  Score=17.36  Aligned_cols=166  Identities=16%  Similarity=0.164  Sum_probs=75.7

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHH---H
Q ss_conf             9998610012888689851177657999986630134631111002211003663557999998640156774223---2
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEV---M  154 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~---f  154 (383)
                      ..+.+.+...+||+++.+-.|-     +..+++...+||+++-..                 .|      |-+..+   +
T Consensus        50 ~~ia~~l~~~~~DlIva~gTpa-----aqa~~~~~~~iPIVF~~V-----------------~d------Pv~aglv~s~  101 (281)
T cd06325          50 PTIARKFVADKPDLIVAIATPA-----AQAAANATKDIPIVFTAV-----------------TD------PVGAGLVKSL  101 (281)
T ss_pred             HHHHHHHHHCCCCEEEECCHHH-----HHHHHHCCCCCCEEEEEC-----------------CC------HHHCCCCCCC
T ss_conf             9999999854999999877099-----999996279999899951-----------------68------6662754356


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      ++ +|-+++=|-++.    + ....-+..+  .+.++-+.|+++=-+...  ..  -..++.++...++. ++.++....
T Consensus       102 ~~-pg~NvTGvs~~~----~-~~~~l~l~~--~l~P~~k~igvlyn~~e~--ns--~~~~~~~~~~a~~~-Gi~v~~~~v  168 (281)
T cd06325         102 EK-PGGNVTGVSDLV----P-VETQLELLK--KLLPDAKTVGVLYNPSEA--NS--VVQVKELKKAAAKL-GIEVVEATV  168 (281)
T ss_pred             CC-CCCCEEEEECCC----C-HHHHHHHHH--HHCCCCCEEEEEECCCCC--CH--HHHHHHHHHHHHHC-CCEEEEEEC
T ss_conf             78-999579987874----7-899999999--858898589999579986--56--99999999999976-988999945


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEC
Q ss_conf             33688999999604888505520552035788763552331156688876275302540
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIY  293 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Y  293 (383)
                      .+..+. ...........+.+....+. .+.+       .-.+.+-.+.-.++|.+..+
T Consensus       169 ~~~~ei-~~a~~~l~~~~Dal~~~~d~-~v~s-------~~~~i~~~a~~~~iPv~~~~  218 (281)
T cd06325         169 SSSNDV-QQAAQSLAGKVDAIYVPTDN-TVAS-------AMEAVVKVANEAKIPVIASD  218 (281)
T ss_pred             CCHHHH-HHHHHHHHHCCCEEEEECCC-HHHH-------HHHHHHHHHHHCCCCEEECC
T ss_conf             988899-99999756258999991881-2777-------99999999987499889367


No 231
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=59.69  E-value=3.9  Score=20.83  Aligned_cols=81  Identities=16%  Similarity=0.231  Sum_probs=41.7

Q ss_pred             HHHHHCCCEEEECCCCCCEEE----EEECCCCCCEEEEHHH---CCCCCCCHHHCCCC-----CHHHHHHHHHHHHCCHH
Q ss_conf             887627530254057741000----0102467610230244---07842612420548-----98999999999844989
Q gi|254780767|r  281 ELALCGIPVVSIYKSEWIVNF----FIFYIKTWTCALPNLI---VDYPLVPEYFNSMI-----RSEALVRWIERLSQDTL  348 (383)
Q Consensus       281 E~al~g~P~IV~Yk~~~lt~~----i~~lik~~~i~LpNii---~~~~ivPEliQ~~~-----~~~~i~~~~~~ll~d~~  348 (383)
                      ++.-.|+|.|+++ |+|-|.-    ++.+=.+ -++-|+-+   +|++|+.+-+..+.     +++.+.+.  -+++.--
T Consensus       192 ~l~~~~lpyI~vl-t~PttGGvtASfa~lgDi-iiaEp~A~IgFAG~RVIeqti~~~LP~~FQtae~ll~~--G~iD~iv  267 (288)
T PRK05654        192 RLSEAGLPYISVL-TDPTTGGVSASFAMLGDI-IIAEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLEH--GAIDMIV  267 (288)
T ss_pred             HHHHCCCCEEEEE-CCCCCCCEEEEECCCCCE-EEEECCCEEEECCCHHHHHHCCCCCCCCHHHHHHHHHC--CCCCEEE
T ss_conf             9997699689996-689858944430247877-99805845873153899985089899740118999977--9963664


Q ss_pred             HHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999838
Q gi|254780767|r  349 QRRAMLHGFENLWDRMN  365 (383)
Q Consensus       349 ~r~~~~~~~~~~~~~Lg  365 (383)
                      .|+++.+.+..+...+.
T Consensus       268 ~R~~lk~~l~~ll~~~~  284 (288)
T PRK05654        268 HRRELRDTLASLLALHT  284 (288)
T ss_pred             CHHHHHHHHHHHHHHHH
T ss_conf             58999999999999983


No 232
>TIGR02918 TIGR02918 conserved hypothetical protein TIGR02918; InterPro: IPR014267   Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus..
Probab=58.36  E-value=11  Score=18.00  Aligned_cols=145  Identities=16%  Similarity=0.176  Sum_probs=99.8

Q ss_pred             CCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEE-ECCCCHHHHHHH
Q ss_conf             5565059985387430123051118999876402735126201663368899999960488850552-055203578876
Q gi|254780767|r  190 SQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIII-DKEQKKQVFMTC  268 (383)
Q Consensus       190 ~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~-~~~~~~~~l~~s  268 (383)
                      ..++.-.|+--||-.. .+|..=+++|+-+-.+.-|++.|-|=...+.+..++.++.+...+-=|.+ ...+..++++.=
T Consensus       325 ~~Rkp~SiiTASRLA~-EKHiDWLV~AVv~Ak~~~P~l~FDIYG~GgE~~~L~~iI~~n~A~DYI~LkGH~~L~~vY~~Y  403 (511)
T TIGR02918       325 QERKPFSIITASRLAK-EKHIDWLVKAVVKAKKSVPELTFDIYGEGGEKSKLKKIINENQAEDYIRLKGHKNLSEVYKDY  403 (511)
T ss_pred             CCCCCHHHHHHHHHCC-CCCHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCHHHHCCCCCHHHHHCCC
T ss_conf             4645215677734137-671268889999951338851100035637889999987631200124311543356662323


Q ss_pred             HHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCE-EEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCC---HHHHHHH
Q ss_conf             3552331-----156688876275302540577410-000102467610230244078426124205489---8999999
Q gi|254780767|r  269 NAAMAAS-----GTVILELALCGIPVVSIYKSEWIV-NFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIR---SEALVRW  339 (383)
Q Consensus       269 d~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt-~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~---~~~i~~~  339 (383)
                      .+=|++|     |=.=|||---|.||| ..-++.=+ .||+.-            .|--.+|+=...+-+   .+.+|+.
T Consensus       404 elyLsaStSEGFGLTLmEAvGSGLgmI-GFDV~YGN~TFI~d~------------~NGYLIP~~~~~~~~~~I~~~lA~~  470 (511)
T TIGR02918       404 ELYLSASTSEGFGLTLMEAVGSGLGMI-GFDVNYGNPTFIKDN------------KNGYLIPIDEEEDDEDEIITALAEK  470 (511)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCC-CCCCCCCCCCEEECC------------CCCEECCCCCCCCCHHHHHHHHHHH
T ss_conf             223452121441157999975043323-661874388702408------------8840433457878878999999999


Q ss_pred             HHHHH-CCHH
Q ss_conf             99984-4989
Q gi|254780767|r  340 IERLS-QDTL  348 (383)
Q Consensus       340 ~~~ll-~d~~  348 (383)
                      +..+. ++.+
T Consensus       471 Iv~~Fv~~~~  480 (511)
T TIGR02918       471 IVEYFVNEND  480 (511)
T ss_pred             HHHHHCCCCC
T ss_conf             8986126786


No 233
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional
Probab=58.18  E-value=5.7  Score=19.73  Aligned_cols=39  Identities=18%  Similarity=0.478  Sum_probs=25.0

Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             86100128886898-5117765-7999986630134631111
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      .+.+..++||++|+ +.-|+-| +.+.+.+|+. .++|+|..
T Consensus        47 l~~~~~~~~DliilDi~lp~~~Gl~l~~~lr~~-~~~piI~l   87 (240)
T PRK10710         47 LPYVRQTPPDLILLDLMLPGTDGLTLCREIRRF-SDIPIVMV   87 (240)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCHHHHHCC-CCCCEEEE
T ss_conf             999973799899987999888776321122115-76468998


No 234
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=57.84  E-value=11  Score=17.79  Aligned_cols=61  Identities=25%  Similarity=0.406  Sum_probs=33.2

Q ss_pred             EEEEE-ECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC-CHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59999-7682147899999999997389983999971-789994788065044453110136746645999999999986
Q gi|254780767|r    5 KIAVI-AGEISGDLLAGDLIKSLKEMVSYPINLVGVG-GPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         5 ki~i~-aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG-G~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      ||-|+ +|--.--...-.+..+.-.  ..|++.+-+| |.+|+.+-.+                            +..+
T Consensus         4 kiGiiKlGNIg~s~~idl~LDErAd--RedI~vrv~gsGaKm~pe~~~----------------------------~v~~   53 (276)
T PRK00994          4 KIGIIKLGNIGMSPVIDLLLDERAD--REDIDVRVVGSGAKMGPEEVE----------------------------RVVK   53 (276)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHC--CCCCEEEEECCCCCCCHHHHH----------------------------HHHH
T ss_conf             9988974452059999998765413--468549995266777978999----------------------------9999


Q ss_pred             HCCCCCCCEEEEE
Q ss_conf             1001288868985
Q gi|254780767|r   83 LIVSSKPDVLLIV   95 (383)
Q Consensus        83 ~i~~~~Pd~vi~i   95 (383)
                      .+++++||.+|.|
T Consensus        54 ~~~~~~pDf~i~i   66 (276)
T PRK00994         54 KMKEWKPDFIIVI   66 (276)
T ss_pred             HHHHHCCCEEEEE
T ss_conf             9884089989997


No 235
>pfam01761 DHQ_synthase 3-dehydroquinate synthase. The 3-dehydroquinate synthase EC:4.6.1.3 domain is present in isolation in various bacterial 3-dehydroquinate synthases and also present as a domain in the pentafunctional AROM polypeptide. 3-dehydroquinate (DHQ) synthase catalyses the formation of dehydroquinate (DHQ) and orthophosphate from 3-deoxy-D-arabino heptulosonic 7 phosphate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids.
Probab=57.83  E-value=14  Score=17.13  Aligned_cols=87  Identities=18%  Similarity=0.297  Sum_probs=54.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      -|+++++++.--++++.++.+.|++. +.++..+-+-+.                      |..+.+..+.+..+++.+.
T Consensus        20 ~~~~iv~D~~v~~~~~~~i~~~L~~~-~~~~~~~~~~~g----------------------E~~k~~~~~~~i~~~l~~~   76 (310)
T pfam01761        20 RRLVVVTDENVAKLYGEKLEELLKAA-GFEVEVVVIPDG----------------------ETYKTLETVARIYDALLEK   76 (310)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHC-CCCEEEEEECCC----------------------CCCCCHHHHHHHHHHHHHC
T ss_conf             82999989767999999999999877-995799995698----------------------6548999999999999974


Q ss_pred             CCCCCCCEEEEE------CHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             001288868985------1177657999986630134631111
Q gi|254780767|r   84 IVSSKPDVLLIV------DNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        84 i~~~~Pd~vi~i------D~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                       .-.++|++|.|      |--+|   .|.-.+ +  |+|+++.
T Consensus        77 -~~~r~d~iiaiGGG~v~D~ak~---~A~~~~-r--g~~~i~i  112 (310)
T pfam01761        77 -GLTRSDVIIALGGGVIGDLAGF---AAATYM-R--GIPFIQV  112 (310)
T ss_pred             -CCCCCCEEEEECCCCHHHHHHH---HHHHHH-C--CCCEEEE
T ss_conf             -9997754999549621168999---999997-6--9977986


No 236
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional
Probab=57.08  E-value=13  Score=17.31  Aligned_cols=78  Identities=9%  Similarity=0.169  Sum_probs=46.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+|+--|+    ..+.+.+..-++.+ ++++.|..+...++                                  .+.
T Consensus         2 irVLIVEDD~----~v~~~~~~~l~~~~-gf~vv~~a~t~~eA----------------------------------~~~   42 (239)
T PRK10430          2 INVLIVDDDA----MVAELNRRYVAQIP-GFQCCGTASTLEKA----------------------------------KEI   42 (239)
T ss_pred             CEEEEEECCH----HHHHHHHHHHHHCC-CCEEEEEECCHHHH----------------------------------HHH
T ss_conf             8799992989----99999999985189-90899998999999----------------------------------999


Q ss_pred             C--CCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             0--0128886898-5117765-7999986630134631111
Q gi|254780767|r   84 I--VSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        84 i--~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      +  .+.+||++++ |--||.| +-+.+.+|+.++++|||-.
T Consensus        43 l~~~~~~~DLILLDi~mPd~~Glell~~lR~~~~~~~VI~I   83 (239)
T PRK10430         43 IFNSDTPIDLILLDIYMQQENGLDLLPVLHEAGCKSDVIVI   83 (239)
T ss_pred             HHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             96579998589978999999789999999985899819999


No 237
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional
Probab=56.79  E-value=9.3  Score=18.35  Aligned_cols=79  Identities=15%  Similarity=0.234  Sum_probs=50.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973899839999717899947880650444531101367466459999999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQT   80 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~   80 (383)
                      |+. ||+++--++   ..+..|...|+..   ++++.+.....                                   +.
T Consensus         1 M~~-kILlVEDD~---~l~~~l~~~L~~~---g~~V~~~~~~~-----------------------------------~a   38 (224)
T PRK10766          1 MSY-HILVVEDEP---VTRARLQGYFEQE---GYRVSEAASGA-----------------------------------GM   38 (224)
T ss_pred             CCC-EEEEECCCH---HHHHHHHHHHHHC---CCEEEEECCHH-----------------------------------HH
T ss_conf             997-199991999---9999999999987---99999989999-----------------------------------99


Q ss_pred             HHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             86100128886898-5117765-799998663013463111100
Q gi|254780767|r   81 VELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+.+.+++||++|+ +.-|+.| +.+++.+|+. .++|+|..-+
T Consensus        39 ~~~l~~~~~DlvilDi~lp~~~G~el~~~iR~~-~~~piI~lta   81 (224)
T PRK10766         39 REIMQNQHVDLILLDINLPGEDGLMLTRELRSR-STVGIILVTG   81 (224)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHC-CCCCEEEECC
T ss_conf             999960899999988999988766137676304-7855686335


No 238
>cd01148 TroA_a Metal binding protein TroA_a.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=56.62  E-value=15  Score=17.00  Aligned_cols=67  Identities=10%  Similarity=0.074  Sum_probs=36.0

Q ss_pred             HHHCCCCCCCEEEEECHHHHHH---HHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             8610012888689851177657---99998663013463111100221100366355799999864015677
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTH---RVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPF  149 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl---~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpF  149 (383)
                      .+.+..-+||+||.-.+.+...   ...+.+++.  |||++-.-....|.........+.+.+..+--+|--
T Consensus        72 ~E~il~l~PDlIi~~~~~~~~~~~~~~~~~l~~~--gipv~~~~~~~~~~~~~~~~~~~~~~i~~lg~~~g~  141 (284)
T cd01148          72 KETVLAARPDLVFGGWSYGFDKGGLGTPDSLAEL--GIKTYILPESCGQRRGEATLDDVYNDIRNLGKIFDV  141 (284)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHC--CCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             9999736998898345434453203339999865--996899244223567777899999999999999797


No 239
>PRK05920 aromatic acid decarboxylase; Validated
Probab=56.39  E-value=15  Score=16.98  Aligned_cols=37  Identities=22%  Similarity=0.220  Sum_probs=29.1

Q ss_pred             CCCCE-EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             98745-99997682147899999999997389983999971
Q gi|254780767|r    1 MNSLK-IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         1 m~~mk-i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      |+.|| |.+--..+||-.||-+++++|++.   +++.+-+-
T Consensus         1 m~~mkrivvgITGASG~~ya~rll~~L~~~---~~ev~lvi   38 (205)
T PRK05920          1 MSKMKRIVLAITGASGAIYGVRLLECLLAA---DYEVHLVI   38 (205)
T ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHC---CCEEEEEE
T ss_conf             998875999986542799999999999867---99899998


No 240
>pfam04396 consensus
Probab=56.19  E-value=15  Score=16.96  Aligned_cols=113  Identities=17%  Similarity=0.270  Sum_probs=57.4

Q ss_pred             CCHHHHHHHHHHHHHHH-CCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHH--HH--HHHHHHHHHHHHHHHHHCCCC
Q ss_conf             21478999999999973-89983999971789994788065044453110136--74--664599999999998610012
Q gi|254780767|r   13 ISGDLLAGDLIKSLKEM-VSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIM--QV--VRHLPQFIFRINQTVELIVSS   87 (383)
Q Consensus        13 ~SGD~~~a~li~~Lk~~-~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~--ev--l~~~~~~~~~~~~~~~~i~~~   87 (383)
                      .++-..+.++-++|++. +...+.+...|.-...     ..--.++++..|+.  .+  -.+-..-.+.+-.+..+..++
T Consensus        18 ~~~~~V~~~I~~al~~~Gy~g~vsi~aygd~~~~-----~~~~~~~L~stGI~l~hvp~g~k~aad~~m~~d~~~~a~~n   92 (149)
T pfam04396        18 LDARDVAPNIKSALRKLGYRGPVSITAYGDLNKI-----PREILRALSSTGISLAHVPAGAKDARDKKMLVDILLWALDN   92 (149)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCC-----CHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             8999999999999997499986699998746869-----88999999976986885788775347889999999999709


Q ss_pred             CC-CEEEEECH--HHHHHHHHHHHHHHCCCCCCEE----------EECCCCCCCCC
Q ss_conf             88-86898511--7765799998663013463111----------10022110036
Q gi|254780767|r   88 KP-DVLLIVDN--PDFTHRVAKRVRKKMPNLPIIN----------YVCPSVWAWRE  130 (383)
Q Consensus        88 ~P-d~vi~iD~--pgFnl~lak~lkk~~~~ipvi~----------yv~PqvWAWr~  130 (383)
                      .| .-+++|.-  -+|.-.+++..+.++++|=+.|          --++++|-|+.
T Consensus        93 p~Pati~LISgd~~dfa~~l~~L~~~r~Y~vlLa~p~~a~~~~l~~a~~~~w~w~~  148 (149)
T pfam04396        93 PPPANLMLISGDDRDFASALHDLLRKRGYNILLAQPEKASSSPALLAAASEWLWDS  148 (149)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCEECCCC
T ss_conf             99707999957707679999999871285599974897878999987630417767


No 241
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304   This entry represents the NAD-dependent L-lactate dehydrogenases from bacteria and eukaryotes. This enzyme functions as the final step in anaerobic glycolysis. Although lactate dehydrogenases have in some cases been mistaken for malate dehydrogenases due to the similarity of these two substrates and the apparent ease with which evolution can toggle these activities, critical residues have been identified  which can discriminate between the two activities.; GO: 0004459 L-lactate dehydrogenase activity, 0019642 anaerobic glycolysis, 0005737 cytoplasm.
Probab=56.07  E-value=15  Score=16.97  Aligned_cols=59  Identities=15%  Similarity=0.072  Sum_probs=42.0

Q ss_pred             CCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             874301230511189998764027351262016633688999999604888505520552
Q gi|254780767|r  201 SRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQ  260 (383)
Q Consensus       201 SR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~  260 (383)
                      ||-+++.+|.-+|-+.+..+.+..||--|++++- ..+=+-+...+-.+.+.+-++..+-
T Consensus        82 tRL~Lv~~N~~I~K~Iv~~v~k~gf~gI~lvatN-PVDIlTy~~~klSGfP~~rVIGSGT  140 (302)
T TIGR01771        82 TRLELVDRNVKIMKSIVPEVVKSGFDGIFLVATN-PVDILTYVAWKLSGFPKNRVIGSGT  140 (302)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEC-CCHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             8799999889999998546541389847999866-3158999999874787200775066


No 242
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=55.53  E-value=16  Score=16.89  Aligned_cols=43  Identities=21%  Similarity=0.261  Sum_probs=30.5

Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             999998610012888689851177657999986630134631111
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      ......+.+.+.+.+++|+-.+.+-.+.++..+.+.  ++|++..
T Consensus        54 a~~~a~~li~~~~V~~ivG~~~S~~~~a~~~~~~~~--~vp~is~   96 (312)
T cd06333          54 AVTNARKLIEEDKVDAIIGPSTTPATMAVAPVAEEA--KTPMISL   96 (312)
T ss_pred             HHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHC--CCEEEEC
T ss_conf             999999986517933986687737788889999974--9869974


No 243
>cd07368 PhnC_Bs_like PhnC is a Class III Extradiol ring-cleavage dioxygenase involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. This subfamily is composed of Burkholderia sp. PhnC and similar poteins. PhnC is one of nine protein products encoded by the phn locus. These proteins are involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. PhnC is a member of the class III extradiol dioxygenase family, a group os enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=55.49  E-value=13  Score=17.41  Aligned_cols=31  Identities=6%  Similarity=0.135  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH
Q ss_conf             9999999999861001288868985117765
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFT  101 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn  101 (383)
                      ..+.+.+.++.+++++.+||++|.|-...||
T Consensus        29 ~~v~~a~~~~r~~l~~~~PDvvVii~~DH~~   59 (277)
T cd07368          29 EICWHAYAICAERLAALQVTSVVVIGDDHYT   59 (277)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCCCHH
T ss_conf             8999999999999997599989998687244


No 244
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed
Probab=55.44  E-value=16  Score=16.88  Aligned_cols=39  Identities=21%  Similarity=0.440  Sum_probs=28.4

Q ss_pred             CCCCEEEEEECCCCHHHH-----HHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             987459999768214789-----9999999997389983999971
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLL-----AGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~-----~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      |++|||.|++|..|...-     |..+.++|++. +.++...++.
T Consensus         1 M~k~kI~Vl~GG~S~EreVSl~Sg~~v~~~L~~~-~y~v~~i~i~   44 (344)
T PRK01966          1 MMKIRVALLFGGRSAEHEVSLVSAKNILKALDKD-KFEVIPIGID   44 (344)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH-CCEEEEEEEC
T ss_conf             9976899995878821899999999999976150-8859999983


No 245
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G; InterPro: IPR010228   This entry represents the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.; GO: 0016651 oxidoreductase activity acting on NADH or NADPH, 0051536 iron-sulfur cluster binding.
Probab=55.27  E-value=16  Score=16.86  Aligned_cols=46  Identities=24%  Similarity=0.429  Sum_probs=33.3

Q ss_pred             HHHHHCCCCCCCEEEEE------CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCC
Q ss_conf             99861001288868985------117765799998663013463111100221100
Q gi|254780767|r   79 QTVELIVSSKPDVLLIV------DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAW  128 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~i------D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAW  128 (383)
                      .....|  ++.|+|++|      +.|-+|+||=|.+|+.  +--.+.++.|+-|--
T Consensus       390 ~tl~~~--e~~D~~ll~G~d~r~e~P~l~lrlR~~~~k~--~~~~~~~~g~~~~~~  441 (715)
T TIGR01973       390 TTLAEI--EEADLVLLVGADLRQEAPLLNLRLRKAVKKG--GQAKVALIGIEKWDL  441 (715)
T ss_pred             CCHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHHCC--CCEEEEECCCCCCCC
T ss_conf             755543--1278689975886402789999999897638--821899728676564


No 246
>KOG4626 consensus
Probab=55.16  E-value=16  Score=16.85  Aligned_cols=160  Identities=19%  Similarity=0.214  Sum_probs=83.8

Q ss_pred             HHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCH-HHHHHHHHHHCCCCCEEEEECC--
Q ss_conf             9761876556505998538743012305111899987640273512620166336-8899999960488850552055--
Q gi|254780767|r  183 NKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQ-ENLVRCIVSKWDISPEIIIDKE--  259 (383)
Q Consensus       183 ~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~-~~~~~~~~~~~~~~~~i~~~~~--  259 (383)
                      +.+.+++++.-+.    ||=.+ +-+.-|-.+++--.+.++-|+-..++-.-|.. +..++......+++++-++...  
T Consensus       750 r~~y~Lp~d~vvf----~~FNq-LyKidP~~l~~W~~ILk~VPnS~LwllrfPa~ge~rf~ty~~~~Gl~p~riifs~va  824 (966)
T KOG4626         750 RSQYGLPEDAVVF----CNFNQ-LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEQRFRTYAEQLGLEPDRIIFSPVA  824 (966)
T ss_pred             CCCCCCCCCEEEE----EECHH-HHCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCEEECCCC
T ss_conf             7777899870798----53044-542898999999999985886416877245335088999999819994525403431


Q ss_pred             CCHHHH---HHHHHHHC---CCH-HHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCC
Q ss_conf             203578---87635523---311-56688876275302540577410000102467610230244078426124205489
Q gi|254780767|r  260 QKKQVF---MTCNAAMA---ASG-TVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIR  332 (383)
Q Consensus       260 ~~~~~l---~~sd~ai~---~SG-TaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~  332 (383)
                      -+.+-+   +-+|+++-   |.| |.+.+.--.|+|||..---..-+..-.-+  .--.|++-+|++.+           
T Consensus       825 ~k~eHvrr~~LaDv~LDTplcnGhTTg~dvLw~GvPmVTmpge~lAsrVa~Sl--l~~~Gl~hliak~~-----------  891 (966)
T KOG4626         825 AKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGVPMVTMPGETLASRVAASL--LTALGLGHLIAKNR-----------  891 (966)
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCEEECCCHHHHHHHHHHH--HHHCCCHHHHHHHH-----------
T ss_conf             04888876556652015767588665523310377426335088898989999--99816288875128-----------


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             89999999998449899999999999999
Q gi|254780767|r  333 SEALVRWIERLSQDTLQRRAMLHGFENLW  361 (383)
Q Consensus       333 ~~~i~~~~~~ll~d~~~r~~~~~~~~~~~  361 (383)
                       ++-.+-..++-.|.++.++++.++...+
T Consensus       892 -eEY~~iaV~Latd~~~L~~lr~~l~~~r  919 (966)
T KOG4626         892 -EEYVQIAVRLATDKEYLKKLRAKLRKAR  919 (966)
T ss_pred             -HHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             -9999999986057799999999999985


No 247
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911    This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast). This family lacks the GNAT acetyltransferase domain..
Probab=55.10  E-value=12  Score=17.54  Aligned_cols=108  Identities=17%  Similarity=0.271  Sum_probs=72.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCC------CCEEEECCCCCCCCCCCHHHHH
Q ss_conf             6746645999999999986100128886898511776579999866301346------3111100221100366355799
Q gi|254780767|r   64 MQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNL------PIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        64 ~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~i------pvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      +|+|+.....--..+.++..-...+||+|     |+=-|-|-...+++++.|      -+.|+=.=    =+=+|.+.++
T Consensus        95 ve~Lk~~y~~aL~~~~vVGlsvgTRPDC~-----P~~VLDlL~ey~~~GyevWvELGLQtah~~TL----~~INRgHd~~  165 (307)
T TIGR01212        95 VEVLKEMYEQALSEDDVVGLSVGTRPDCV-----PDEVLDLLAEYKERGYEVWVELGLQTAHDRTL----KKINRGHDFA  165 (307)
T ss_pred             HHHHHHHHHHHHHHCCEEEEEECCCCCCC-----HHHHHHHHHHHHHCCEEEEEECCCCCHHHHHH----HHHCCCCCHH
T ss_conf             68888999987632780577536889877-----47899999999549758999605356558999----9851437878


Q ss_pred             HHHHHHCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHH
Q ss_conf             99986401567742232002553147638821122100135588897618765565059985387430123051118999
Q gi|254780767|r  138 AYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAV  217 (383)
Q Consensus       138 ~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~  217 (383)
                      .|+|.+.-.        ++ .|+++.  +|=                          |.=|||--+.       -|++||
T Consensus       166 ~y~~a~~~~--------~k-rGikVC--~H~--------------------------I~GLPgE~~~-------~~~eTa  201 (307)
T TIGR01212       166 CYVDAVKRA--------RK-RGIKVC--SHV--------------------------ILGLPGEDRE-------EMLETA  201 (307)
T ss_pred             HHHHHHHHH--------HH-CCCEEE--EEE--------------------------EECCCCCCHH-------HHHHHH
T ss_conf             999999999--------76-598899--998--------------------------7428988888-------999999


Q ss_pred             HHHHHCC
Q ss_conf             8764027
Q gi|254780767|r  218 ASLVKRN  224 (383)
Q Consensus       218 ~~l~~~~  224 (383)
                      +.+.+-.
T Consensus       202 k~~~~l~  208 (307)
T TIGR01212       202 KIVASLD  208 (307)
T ss_pred             HHHHHCC
T ss_conf             9998379


No 248
>PRK13126 consensus
Probab=54.90  E-value=16  Score=16.82  Aligned_cols=119  Identities=13%  Similarity=0.111  Sum_probs=70.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---ECH--HHCCEEEHHHHHHHHH
Q ss_conf             99997682147899999999997389983999971---------789994788065---044--4531101367466459
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---FDF--SELSVIGIMQVVRHLP   71 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---~~~--~~l~v~G~~evl~~~~   71 (383)
                      .|+.||-++=|.-. .++++|..  .  +.+.=+|         ||--|++....+   ++.  ..+=.||.+.++.   
T Consensus        10 ~yitaG~P~~~~t~-~~l~~l~~--g--aDiiElGiPFSDP~ADGPvIQ~A~~~Al~~G~~~~~~pivlM~Y~N~~~---   81 (237)
T PRK13126         10 VYLTAGWPSADTFL-EALAGLSG--L--VDFFELGIPTPNPKYDGPYIRLAHREAEEPGWDAPKAPTYLMAYWEDYA---   81 (237)
T ss_pred             EEEECCCCCHHHHH-HHHHHHHC--C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHHH---
T ss_conf             88717179879999-99998554--8--9999989988887776899999999999859985687589997298776---


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECHH----HHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             999999999861001288868985117----765799998663013463111100221100366355799999
Q gi|254780767|r   72 QFIFRINQTVELIVSSKPDVLLIVDNP----DFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYI  140 (383)
Q Consensus        72 ~~~~~~~~~~~~i~~~~Pd~vi~iD~p----gFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~  140 (383)
                         ....+..+.+++..-|.+|..|-|    +---......++  .|+..|+.++|+-   .+.|++.+.+..
T Consensus        82 ---~g~~~f~~~~~~aGvdGlIipDLP~e~~ee~~~~~~~~~~--~gl~~I~lv~ptt---~~~ri~~i~~~s  146 (237)
T PRK13126         82 ---GSPAELFETAAEVGARGVLAPDLLIDFPGDLERYLELSRE--YGLAPSFFIPSKF---PHRLLRRLASLE  146 (237)
T ss_pred             ---HHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHH--CCCCEEEEECCCC---HHHHHHHHHHHC
T ss_conf             ---5699999999874997388368887781778999999997--6997799738998---399999999858


No 249
>pfam02310 B12-binding B12 binding domain. This domain binds to B12 (adenosylcobamide), it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase.
Probab=54.89  E-value=16  Score=16.82  Aligned_cols=42  Identities=19%  Similarity=0.412  Sum_probs=26.0

Q ss_pred             HHHHHHCCCCCCCEEEE-E-CHHHH--HHHHHHHHHHHCCCCCCEE
Q ss_conf             99986100128886898-5-11776--5799998663013463111
Q gi|254780767|r   78 NQTVELIVSSKPDVLLI-V-DNPDF--THRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~-i-D~pgF--nl~lak~lkk~~~~ipvi~  119 (383)
                      .++.+.+++++||+|-+ + -...+  -.++++.+|+.+++++++-
T Consensus        41 ~~i~~~i~~~~pdiVgiS~~~~~~~~~~~~l~~~ik~~~p~~~iv~   86 (121)
T pfam02310        41 EDIVEAIRAENPDVVGLSALMTTNLPAAKELARLLKRIRPGVKVVV   86 (121)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999999980999999952321121136899999998598975998


No 250
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins. A family of small methanogenic corrinoid proteins that bind methyl-Co(III) 5-hydroxybenzimidazolylcobamide as a cofactor. They play a role on the methanogenesis from trimethylamine, dimethylamine or monomethylamine, which is initiated by a series of corrinoid-dependent methyltransferases.
Probab=54.81  E-value=16  Score=16.81  Aligned_cols=69  Identities=12%  Similarity=0.131  Sum_probs=37.6

Q ss_pred             HHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCC--CCCEE
Q ss_conf             2320025531476388211221001355888976187655650599853874301230511189998764027--35126
Q gi|254780767|r  152 EVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRN--PFFRF  229 (383)
Q Consensus       152 ~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~--~~~~~  229 (383)
                      .+|+. .|.++.|.|--.-    . +.-.+.-++     .++.+.-+-.|    +...+|-|.++++.+.+..  +++.+
T Consensus       104 ~~l~~-~G~~V~~LG~~vp----~-e~~v~~~~~-----~~~divglS~~----~~~~~~~~~~~i~~lr~~~~~~~v~i  168 (201)
T cd02070         104 TMLEA-NGFEVIDLGRDVP----P-EEFVEAVKE-----HKPDILGLSAL----MTTTMGGMKEVIEALKEAGLRDKVKV  168 (201)
T ss_pred             HHHHH-CCCEEEECCCCCC----H-HHHHHHHHH-----HCCCEEEEECC----CCCCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             99987-8977997789999----7-999999997-----29899999625----66889999999999997289889859


Q ss_pred             EECCCC
Q ss_conf             201663
Q gi|254780767|r  230 SLVTVS  235 (383)
Q Consensus       230 ~i~~~~  235 (383)
                      .+-.++
T Consensus       169 ~vGG~a  174 (201)
T cd02070         169 MVGGAP  174 (201)
T ss_pred             EEECCC
T ss_conf             998801


No 251
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879    PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself . It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well.; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006817 phosphate transport.
Probab=54.01  E-value=12  Score=17.58  Aligned_cols=42  Identities=31%  Similarity=0.561  Sum_probs=30.0

Q ss_pred             HHHHHHHCCCCCCCEEEEEC--HHHHH-HHHHHHHHHHC--CCCCCEE
Q ss_conf             99998610012888689851--17765-79999866301--3463111
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVD--NPDFT-HRVAKRVRKKM--PNLPIIN  119 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD--~pgFn-l~lak~lkk~~--~~ipvi~  119 (383)
                      .+++...|+++.||+++| |  =||-+ +.+|++||+..  -.||||-
T Consensus        35 ~~~A~~~~~E~~PDLILL-DWMLPG~SGIel~R~Lr~~~~Tr~iPIIM   81 (226)
T TIGR02154        35 GDEALTLINERLPDLILL-DWMLPGTSGIELARRLRREPETRAIPIIM   81 (226)
T ss_pred             HHHHHHHHHCCCCCEEEE-CCCCCCCCHHHHHHHHCCCCCCCCCCEEE
T ss_conf             799999986079988996-14789975699998734763314888177


No 252
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. This group includes the ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. They are members of the LacI-GalR family of repressor proteins which are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=53.83  E-value=16  Score=16.71  Aligned_cols=43  Identities=12%  Similarity=0.259  Sum_probs=30.6

Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             999998610012888689851177657999986630134631111
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      ...+..+.+...++|.+|+.-+.+-+....+.+++.  ++|++.+
T Consensus        43 ~e~~~i~~l~~~~vDGiIi~~~~~~~~~~~~~l~~~--~iPvV~i   85 (268)
T cd06289          43 RQEQLLSTMLEHGVAGIILCPAAGTSPDLLKRLAES--GIPVVLV   85 (268)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHC--CCCEEEE
T ss_conf             999999999965999899946888999999999975--9989983


No 253
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=53.82  E-value=17  Score=16.71  Aligned_cols=35  Identities=14%  Similarity=0.169  Sum_probs=26.7

Q ss_pred             CCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             87430123051118999876402735126201663
Q gi|254780767|r  201 SRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVS  235 (383)
Q Consensus       201 SR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~  235 (383)
                      ||...+++|.+++.+.++.+.+..|+-.+++.+.|
T Consensus        87 ~R~dll~~N~~I~~~i~~~i~~~~p~a~iivvtNP  121 (263)
T cd00650          87 GRLDLLKRNVPIVKEIGDNIEKYSPDAWIIVVSNP  121 (263)
T ss_pred             CHHHHHHCHHHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             76566403288999998888732998369973894


No 254
>pfam01497 Peripla_BP_2 Periplasmic binding protein. This family includes bacterial periplasmic binding proteins. Several of which are involved in iron transport.
Probab=53.78  E-value=17  Score=16.70  Aligned_cols=83  Identities=16%  Similarity=0.230  Sum_probs=41.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHH
Q ss_conf             99999999973899839999717899947880650444531101367466459999999999861001288868985117
Q gi|254780767|r   19 AGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNP   98 (383)
Q Consensus        19 ~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~p   98 (383)
                      ...++-+|-    ..=++.|+++..-.... ..-.+..++.++|-..-            --.+.+.+-+||+||.-.+.
T Consensus         8 ~teil~~LG----~~d~ivgv~~~~~~~~~-~~~~~~~~~~~vG~~~~------------~n~E~i~~l~PDlVi~~~~~   70 (236)
T pfam01497         8 YTEILYALG----ATDKLVGVSAKTSDPLD-ARKKPAASIPLVGAYRE------------IDVEKLAALKPDLIIGSAGI   70 (236)
T ss_pred             HHHHHHHCC----CCCEEEEEECCCCCCHH-HHHCCCCCCCCCCCCCC------------CCHHHHHHCCCCEEEEECCC
T ss_conf             999999859----99808999368788444-54210246663489999------------89999971599989972676


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             76579999866301346311110
Q gi|254780767|r   99 DFTHRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        99 gFnl~lak~lkk~~~~ipvi~yv  121 (383)
                      +.+-...+.++   .++|++.+-
T Consensus        71 ~~~~~~~~~~~---~gipvv~~~   90 (236)
T pfam01497        71 GLTDKAYELLS---LIIPTVIFE   90 (236)
T ss_pred             CCHHHHHHHHH---CCCCEEEEC
T ss_conf             73689999995---799789942


No 255
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional
Probab=53.02  E-value=5  Score=20.13  Aligned_cols=157  Identities=13%  Similarity=0.096  Sum_probs=74.1

Q ss_pred             CCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHH
Q ss_conf             76556505998538743012305111899987640273512620166336889999996048885055205520357887
Q gi|254780767|r  188 TPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMT  267 (383)
Q Consensus       188 ~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~  267 (383)
                      ++-+.. +..|-..|..+.     -=+++++++.+++|+.+.++.+..+.+..+...+...+...-+ . .....+.+..
T Consensus        36 ~~~~~v-~~~LmDi~mP~~-----dGL~~~~~L~r~~P~vriLVLTm~d~e~~v~~aL~~aga~Gyl-~-K~~~~~eL~~  107 (205)
T PRK11475         36 ISFSAV-IFSLSAMRSERR-----EGLSCLTELAIKFPRMRRLVIADDDIEARLIGSLSPSPLDGVL-S-KASTLEILQQ  107 (205)
T ss_pred             CCCCCC-EEEEECCCCCCC-----CHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCEEE-E-CCCCHHHHHH
T ss_conf             886664-389853899997-----6699999999978997189997476879999999984166888-5-6788999999


Q ss_pred             HHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCC--CCCCHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             63552331156688876275302540577410000102467610230244078--4261242054898999999999844
Q gi|254780767|r  268 CNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDY--PLVPEYFNSMIRSEALVRWIERLSQ  345 (383)
Q Consensus       268 sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~--~ivPEliQ~~~~~~~i~~~~~~ll~  345 (383)
                      + +..+.+|..              |-..       +.....+..-...+..+  +|..-+-+ -.+...|+..+..=. 
T Consensus       108 A-i~~~~~g~~--------------~~~~-------~~~~~~~~~~~~~Lt~rE~eVl~l~a~-G~s~~eIA~~L~~S~-  163 (205)
T PRK11475        108 E-LFLSLNGVR--------------QATD-------RLNNQWYINQSRMLSPTEREILRFMSR-GYSMPQIAEQLERNI-  163 (205)
T ss_pred             H-HHHHHCCCH--------------HHCH-------HHHCCCCCCCCCCCCHHHHHHHHHHHC-CCCHHHHHHHHCCCH-
T ss_conf             9-999870611--------------3134-------665345677678898589999999976-999999999978888-


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHH-HHHHHHHHHH
Q ss_conf             98999999999999999838999989-9999999986
Q gi|254780767|r  346 DTLQRRAMLHGFENLWDRMNTKKPAG-HMAAEIVLQV  381 (383)
Q Consensus       346 d~~~r~~~~~~~~~~~~~Lg~~~~a~-~~AA~~I~~~  381 (383)
                           +....--.++..+||-...+. -.+|.+++.+
T Consensus       164 -----kTv~thr~~~m~KLgv~s~a~Li~~a~~~~~~  195 (205)
T PRK11475        164 -----KTIRAHKFNVMSKLGVSSDAGLLDAADILLCL  195 (205)
T ss_pred             -----HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             -----89999999999982999879999999999717


No 256
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.
Probab=52.92  E-value=17  Score=16.61  Aligned_cols=38  Identities=21%  Similarity=0.258  Sum_probs=26.9

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC
Q ss_conf             861001288868985117765799998663013463111100
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+.|..-+||+||..+  .++-.+...+++.  ++|+++.-.
T Consensus        84 lE~I~aLkPDLIi~~~--~~~~~~~~~l~~~--~i~v~~~~~  121 (289)
T TIGR03659        84 MEKIKSLKPTVVLSVT--TLEEDLGPKFKQL--GVEATFLNL  121 (289)
T ss_pred             HHHHHHCCCCEEEECC--CCHHHHHHHHHHC--CCEEEEECC
T ss_conf             9999736997899557--4258789999860--975999837


No 257
>CHL00148 orf27 Ycf27; Reviewed
Probab=52.91  E-value=5.3  Score=19.97  Aligned_cols=39  Identities=28%  Similarity=0.580  Sum_probs=25.8

Q ss_pred             HCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             100128886898-5117765-799998663013463111100
Q gi|254780767|r   83 LIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        83 ~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+..++||+||+ +.-||.| +.+++.+|+. .++|+|..-+
T Consensus        45 ~~~~~~~DlviLDi~LP~~dG~~l~~~iR~~-~~~PII~LTa   85 (240)
T CHL00148         45 LFHQEQPDLVILDVMMPKLDGYGVCQEIRKE-SDVPIIMLTA   85 (240)
T ss_pred             HHHHCCCCEEEEECCCCCCCCCEEEECCCCC-CCCCEEEEEC
T ss_conf             9974799999997999988866305414037-9954899816


No 258
>PRK00066 ldh L-lactate dehydrogenase; Reviewed
Probab=52.68  E-value=17  Score=16.59  Aligned_cols=60  Identities=10%  Similarity=0.082  Sum_probs=26.9

Q ss_pred             HHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEE--ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHH
Q ss_conf             35523311566888762753025405774100001--0246761023024407842612420548989
Q gi|254780767|r  269 NAAMAASGTVILELALCGIPVVSIYKSEWIVNFFI--FYIKTWTCALPNLIVDYPLVPEYFNSMIRSE  334 (383)
Q Consensus       269 d~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~--~lik~~~i~LpNii~~~~ivPEliQ~~~~~~  334 (383)
                      ..+++.+.+--.|+-+.+.-.|+.     .+.++-  .-++--|+|+|=+|-.+.+ -+.+.-+++++
T Consensus       233 ~~~ia~a~~~iv~aIl~d~~~vlp-----vs~~l~geYg~~dv~~s~P~vig~~Gv-~~i~~l~L~~~  294 (315)
T PRK00066        233 YYGIAMALARITKAILNDENAVLP-----VSAYLEGQYGEEDIYIGVPAIVNRNGI-REIVELPLNDD  294 (315)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEE-----EEEEECCCCCCCCEEEEEEEEECCCCE-EEECCCCCCHH
T ss_conf             113999999999999769981899-----999842564774569999999844815-48738998999


No 259
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=52.48  E-value=17  Score=16.57  Aligned_cols=104  Identities=20%  Similarity=0.266  Sum_probs=45.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHH--HHHHHHHHH-HH
Q ss_conf             987459999768214789999999999738998399997178999478806504445311013674--664599999-99
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQV--VRHLPQFIF-RI   77 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~ev--l~~~~~~~~-~~   77 (383)
                      |++++|.++.-=-+|-   +.|-.+|-.....--.+-|+.=++  ++|--.. +-+++.++-+--.  |..+..=.. --
T Consensus         1 Mk~i~IALvGNPN~GK---STLFN~LTG~~q~VgNwPGvTVEk--k~G~~~~-~~~~~~ivDLPG~YSL~~~S~e~s~dE   74 (772)
T PRK09554          1 MKKLTIGLIGNPNSGK---TTLFNQLTGARQRVGNWAGVTVER--KEGQFST-TDHQVTLVDLPGTYSLTTISSQTSLDE   74 (772)
T ss_pred             CCCCEEEEECCCCCCH---HHHHHHHHCCCCEEECCCCCEEEE--EEEEEEE-CCCEEEEEECCCCCCCCCCCCCCCCHH
T ss_conf             9735699888998789---999999868998357899764742--3899996-894699997997786999997777308


Q ss_pred             HHHHHHCCCCCCCEEE-EECHHHH--HHHHHHHHHH
Q ss_conf             9998610012888689-8511776--5799998663
Q gi|254780767|r   78 NQTVELIVSSKPDVLL-IVDNPDF--THRVAKRVRK  110 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi-~iD~pgF--nl~lak~lkk  110 (383)
                      .-..+.+.+++||++| .+|..-.  ||.|.-.+..
T Consensus        75 ~Var~~ll~~~pDvvvnVvDAtnLeRnLyLt~QllE  110 (772)
T PRK09554         75 QIACHYILSGDADLLINVVDASNLERNLYLTLQLLE  110 (772)
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             999998613999899998016875442899999997


No 260
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]
Probab=52.24  E-value=17  Score=16.54  Aligned_cols=135  Identities=18%  Similarity=0.234  Sum_probs=74.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHH-HHHHHHCCCCEEEEEECCHHHHHCCCEEE----EC--HHHCC-----E--EEHH-H
Q ss_conf             98745999976821478999999-99997389983999971789994788065----04--44531-----1--0136-7
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLI-KSLKEMVSYPINLVGVGGPSLQKEGLVSL----FD--FSELS-----V--IGIM-Q   65 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li-~~Lk~~~~~~~~~~giGG~~m~~~G~~~~----~~--~~~l~-----v--~G~~-e   65 (383)
                      |.+-+|-|+.||+.|  .|..++ +++++ .+...++.-+|.+.+-+++...+    +.  ...-.     .  ..+. .
T Consensus         1 ~~~~~iAit~GDPaG--IGPEi~~~~~~~-~~~~~~~v~igd~~lL~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~l   77 (332)
T COG1995           1 MTKPRIAITMGDPAG--IGPELVALALAE-LPIKCELVVIGDKALLEAAAALLGLPVFLLEAIPDPYEAFAAGAIDLPDL   77 (332)
T ss_pred             CCCCCEEECCCCCCC--CCHHHHHHHHCC-CCCCCCEEEECCHHHHHHHHHHHCCCCCCHHCCCCHHHHHHCCCCCEEEC
T ss_conf             998856864688666--799999986210-46778769985899999999874665311001466044542147622422


Q ss_pred             HH-------------HHHHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             46-------------645999999999986100128886898------------51177657999986630134631111
Q gi|254780767|r   66 VV-------------RHLPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        66 vl-------------~~~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      .+             .+=...+..++..++...+-+.|.+++            +.|||-.--||...+.   +-|+.-+
T Consensus        78 ~~~~~~~v~~G~~~~~~g~~~~~~l~~A~~~a~~G~~~aivT~PI~K~~l~~AG~~y~GhTe~LA~~s~~---~~~vMml  154 (332)
T COG1995          78 PLPLPAPVEAGQLSAANGAYVFETLKRAVELALAGEVDAIVTAPINKEALNDAGIPYPGHTEFLAELSGT---HDPVMML  154 (332)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHHHCC---CCEEEEE
T ss_conf             4577676568875713408999999999998736734679965647899996489989778999998579---9717986


Q ss_pred             ECCCCCCCCCCCHHHHHHHHH
Q ss_conf             002211003663557999998
Q gi|254780767|r  121 VCPSVWAWREGRARKMCAYIN  141 (383)
Q Consensus       121 v~PqvWAWr~~R~k~~~~~~d  141 (383)
                      .+|++|+-.-..=--+++..|
T Consensus       155 a~~~Lrv~lvTtHipL~~V~~  175 (332)
T COG1995         155 AVPELRVALVTTHIPLKDVPD  175 (332)
T ss_pred             ECCCCEEEEEEECCCHHHHHH
T ss_conf             146417998750461888776


No 261
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this protein family are 6-phospho 3-hexuloisomerase (PHI), or the PHI domain of a fusion protein. This enzyme is part of the ribulose monophosphate (RuMP) pathway, which in one direction removes the toxic metabolite formaldehyde by assimilation into fructose-6-phosphate. In the other direction, in species lacking a complete pentose phosphate pathway, the RuMP pathway yields ribulose-5-phosphate, necessary for nucleotide biosynthesis, at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin.
Probab=52.19  E-value=17  Score=16.54  Aligned_cols=49  Identities=18%  Similarity=0.270  Sum_probs=27.7

Q ss_pred             CCCEEEEECHHHHH---HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             88868985117765---799998663013463111100221100366355799999864015
Q gi|254780767|r   88 KPDVLLIVDNPDFT---HRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISI  146 (383)
Q Consensus        88 ~Pd~vi~iD~pgFn---l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~i  146 (383)
                      +=|++|.+.+.|-+   +.+++.+|+.  |.|++-.-        ...-..+.++.|.++.+
T Consensus        72 ~~Dv~I~iS~SGeT~e~~~~~~~aK~~--ga~ii~IT--------~~~~S~Lak~aD~~l~i  123 (179)
T TIGR03127        72 KGDLLIAISGSGETESLVTVAKKAKEI--GATVAAIT--------TNPESTLGKLADVVVEI  123 (179)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC--CCEEEEEE--------CCCCCHHHHHCCEEEEE
T ss_conf             999999981999968999999999987--99299997--------98989779949999990


No 262
>PRK11517 transcriptional regulatory protein YedW; Provisional
Probab=51.84  E-value=18  Score=16.50  Aligned_cols=76  Identities=14%  Similarity=0.241  Sum_probs=47.2

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+++--|+.   .+..+...|++.   +.++...+.-                                   .+..+.
T Consensus         1 MkILiVEDd~~---l~~~l~~~L~~~---g~~V~~a~~g-----------------------------------~~al~~   39 (223)
T PRK11517          1 MKILLIEDNQR---TQEWVTQGLSEA---GYVIDAVSDG-----------------------------------RDGLYL   39 (223)
T ss_pred             CEEEEEECCHH---HHHHHHHHHHHC---CCEEEEECCH-----------------------------------HHHHHH
T ss_conf             98999969899---999999999988---9999998999-----------------------------------999999


Q ss_pred             CCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEE
Q ss_conf             00128886898-5117765-79999866301346311110
Q gi|254780767|r   84 IVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        84 i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv  121 (383)
                      +.+.+||++|+ +.-||.+ +.+++.+|+. .++|++..-
T Consensus        40 ~~~~~~DlvilDi~lP~~dG~~l~~~iR~~-~~~pII~lt   78 (223)
T PRK11517         40 ALKDDYALIILDIMLPGMDGWQILQTLRTA-KQTPVICLT   78 (223)
T ss_pred             HHCCCCCEEEECCCCCCCCHHHHHHHHHHC-CCCCEEEEE
T ss_conf             852899999984999873689999999856-886489995


No 263
>COG3563 KpsC Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane]
Probab=51.83  E-value=18  Score=16.50  Aligned_cols=197  Identities=16%  Similarity=0.192  Sum_probs=101.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCCCCC---CCCC----------------C---CC---C
Q ss_conf             21100366355799999864015677422320025531476388211---2210----------------0---13---5
Q gi|254780767|r  124 SVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLS---SSPS----------------I---LE---V  178 (383)
Q Consensus       124 qvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl~---d~~~----------------~---~~---~  178 (383)
                      .+-||+.+.....+..-+|-+.+.-.|.-|... -++-+.-+ -|+.   |...                .   ..   .
T Consensus       365 rilaWG~~~~~lv~~A~~h~iPl~~~EDGFlRS-v~LGs~lt-PPlSLv~Dd~~iYFda~~pS~LE~iLq~~~Fd~ddm~  442 (671)
T COG3563         365 RILAWGNGKEALVEFAEQHHIPLLRMEDGFLRS-VGLGSNLT-PPLSLVLDDMGIYFDANTPSRLEDILQNQDFDDDDMQ  442 (671)
T ss_pred             EEEEECCCCHHHHHHHHHHCCCEEEECCCCEEE-CCCCCCCC-CCEEEEECCCEEEECCCCCHHHHHHHHCCCCCHHHHH
T ss_conf             489825896789999987079703422341342-12666678-9716887375047659993259999862687677899


Q ss_pred             HH---------HHH--------HHCCCCCCCCEEEEEECC--CCCCHHHHCCCH---HHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             58---------889--------761876556505998538--743012305111---89998764027351262016633
Q gi|254780767|r  179 YS---------QRN--------KQRNTPSQWKKILLLPGS--RAQEIYKILPFF---ESAVASLVKRNPFFRFSLVTVSS  236 (383)
Q Consensus       179 ~~---------~~~--------~~~~~~~~~~~I~llPGS--R~~EI~~~lP~~---l~~~~~l~~~~~~~~~~i~~~~~  236 (383)
                      +.         ...        ..+........+.|.||-  +..-|..--|-.   ++.+.....++|+..++.-.-|+
T Consensus       443 RAra~~k~L~Es~iSKYNg~~~~~~~~~~k~~krvLV~GQVEdDASi~YG~~~~mtN~DLlr~vr~~NpdAyIIYKPHPD  522 (671)
T COG3563         443 RARALIKLLTESHISKYNGVGARDLGYGEKTRKRVLVPGQVEDDASIRYGCPSIMTNNDLLRTVRARNPDAYIIYKPHPD  522 (671)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCEEEEEEEEECCCCHHCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCH
T ss_conf             99999999998423111566415543253355089965332366300048840034478999887419884798468904


Q ss_pred             H----------HHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEE-E--
Q ss_conf             6----------88999999604888505520552035788763552331156688876275302540577410000-1--
Q gi|254780767|r  237 Q----------ENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFF-I--  303 (383)
Q Consensus       237 ~----------~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i-~--  303 (383)
                      +          .+.+..+..       .+...-...+++..+|-+-+-..++-.|+.+.|++ |.+|-..+-..|- -  
T Consensus       523 VlsGnR~~~~dp~~v~~~ad-------~v~e~~~i~dal~~vDeVhTiTSLaGFEALLRgkk-VttyG~PFYaGWGLT~D  594 (671)
T COG3563         523 VLSGNRPGHSDPDDVARYAD-------QVVEDASILDALRTVDEVHTITSLAGFEALLRGKK-VTTYGLPFYAGWGLTDD  594 (671)
T ss_pred             HHCCCCCCCCCHHHHHHHHH-------HHHHCCCHHHHHHHHHHEEEEHHHHHHHHHHCCCC-CEECCCCCCCCCCCCCC
T ss_conf             53378768899799999999-------98722869999974414055310330899974786-13416764236676545


Q ss_pred             ECC---CCCCEEEEHHHCCCC-CCCHHHCCC
Q ss_conf             024---676102302440784-261242054
Q gi|254780767|r  304 FYI---KTWTCALPNLIVDYP-LVPEYFNSM  330 (383)
Q Consensus       304 ~li---k~~~i~LpNii~~~~-ivPEliQ~~  330 (383)
                      ++-   +..-.+|--+++|-- ++|-++..+
T Consensus       595 r~~~~RR~RkLsleqL~AGalIlYPrYidPk  625 (671)
T COG3563         595 RLPNPRRSRKLSLEQLFAGALILYPRYIDPK  625 (671)
T ss_pred             CCCCCCCCCCCCHHHHHHHHEEECCCCCCCC
T ss_conf             5757411111319998612168444334865


No 264
>cd07367 CarBb CarBb is the B subunit of the Class III Extradiol ring-cleavage dioxygenase, 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBb is the B subunit of 2-aminophenol 1,6-dioxygenase (CarB), which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. It is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, it has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=51.52  E-value=18  Score=16.47  Aligned_cols=30  Identities=17%  Similarity=0.408  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      .+++.-+.++.+++++.+||++|.++.=.+
T Consensus        25 ~~v~~g~~~i~~~~~~~~PDviVv~~~DH~   54 (268)
T cd07367          25 ARVVQGMAEIGRRVRESRPDVLVVISSDHL   54 (268)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             899999999999999839999999807488


No 265
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764    Adenine phosphoribosyltransferase (APRTase, 2.4.2.7 from EC) is a widely distributed enzyme, and its deficiency in humans causes the accumulation of 2,8-dihydroxyadenine. It is the sole catalyst for adenine recycling in most eukaryotes.  AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate  ; GO: 0003999 adenine phosphoribosyltransferase activity, 0006168 adenine salvage.
Probab=51.34  E-value=10  Score=18.14  Aligned_cols=57  Identities=18%  Similarity=0.310  Sum_probs=42.1

Q ss_pred             EECHHHCCEEEH-----HHHHHHHHHHHHHHHHHHHHCCCCC----CCEEEEECHHHHH--HHHHHHH
Q ss_conf             504445311013-----6746645999999999986100128----8868985117765--7999986
Q gi|254780767|r   52 LFDFSELSVIGI-----MQVVRHLPQFIFRINQTVELIVSSK----PDVLLIVDNPDFT--HRVAKRV  108 (383)
Q Consensus        52 ~~~~~~l~v~G~-----~evl~~~~~~~~~~~~~~~~i~~~~----Pd~vi~iD~pgFn--l~lak~l  108 (383)
                      +-++.++.-=|+     +-++.+--.|...++++++++++.+    +|.||+.|+=||=  -.||-.+
T Consensus         5 Ir~ipDfP~~GIlFrDITplL~~~~~f~~~id~l~~~~~~~~~~id~d~iVG~EaRGFifG~~LA~~L   72 (175)
T TIGR01090         5 IRSIPDFPKKGILFRDITPLLNNPELFRFLIDLLVERYKDANGEIDADLIVGLEARGFIFGAALAYKL   72 (175)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             56257887796677661701068778999999999999860795151368767667257788999970


No 266
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]
Probab=51.30  E-value=18  Score=16.45  Aligned_cols=45  Identities=24%  Similarity=0.417  Sum_probs=34.9

Q ss_pred             HHHHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             99986100128886898-5117765-799998663013463111100
Q gi|254780767|r   78 NQTVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      -++.+.+..++||++++ |--||.| +-+|+.++.....+|+|+.-|
T Consensus        34 ~eal~~Le~~kpDLifldI~mp~~ngiefaeQvr~i~~~v~iifIss   80 (361)
T COG3947          34 VEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFISS   80 (361)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             88999998438877999852378608789999987531486899963


No 267
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway.  The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=51.15  E-value=18  Score=16.43  Aligned_cols=86  Identities=8%  Similarity=0.098  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHH
Q ss_conf             99999999861001288868985117765799998663013463111100221100366355799999864015677422
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKE  152 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~  152 (383)
                      -..-++++++...++...++-=||.||-..-..+..-......+...+-.=++-.=.+.-...+++.++.+..+||+.-+
T Consensus        80 T~~di~eiv~YA~~rgI~VIPEID~PGH~~a~~~~~pel~~~~~~~~~~~~~ld~~~~~t~~fl~~v~~Ev~~lF~~~~~  159 (326)
T cd06564          80 TKEEFKELIAYAKDRGVNIIPEIDSPGHSLAFTKAMPELGLKNPFSKYDKDTLDISNPEAVKFVKALFDEYLDGFNPKSD  159 (326)
T ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHCHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             89999999999998499898636783378999985956347887788887756899876999999999999986678788


Q ss_pred             HHHCCCC
Q ss_conf             3200255
Q gi|254780767|r  153 VMQRLGG  159 (383)
Q Consensus       153 ~f~k~~~  159 (383)
                      +|. .+|
T Consensus       160 yiH-iGG  165 (326)
T cd06564         160 TVH-IGA  165 (326)
T ss_pred             EEE-ECC
T ss_conf             898-631


No 268
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=50.96  E-value=18  Score=16.41  Aligned_cols=45  Identities=31%  Similarity=0.442  Sum_probs=33.8

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99998610012888689851177657999986630134631111002
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP  123 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P  123 (383)
                      .....+.|.+.+.|++++-.+++..+.++..+.+.  ++|.+.-.+|
T Consensus        58 v~~a~kLi~~d~V~~i~G~~~S~~~~a~~~~~~~~--~vp~i~~~~~  102 (357)
T cd06337          58 GLVAQELILTDKVDLLLAGGTPDTTNPVSDQCEAN--GVPCISTMAP  102 (357)
T ss_pred             HHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHH--CCCEEECCCC
T ss_conf             99999998657937999567337589899999983--9977862686


No 269
>COG0614 FepB ABC-type Fe3+-hydroxamate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=50.43  E-value=19  Score=16.36  Aligned_cols=39  Identities=21%  Similarity=0.296  Sum_probs=27.9

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             8610012888689851177657999986630134631111002
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP  123 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P  123 (383)
                      .+.+..-+||+||..++ +.+-.+.+.+.+   ++|++.+-.+
T Consensus       108 ~E~i~~lkPDlIi~~~~-~~~~~~~~~~~~---~~pvv~~~~~  146 (319)
T COG0614         108 LEKIVALKPDLIIASSS-SQDDLIYKLLSL---GAPVVVVDYG  146 (319)
T ss_pred             HHHHHHCCCCEEEEECC-CCCHHHHHHHHC---CCCEEEECCC
T ss_conf             99998479989997076-554127999846---9978998887


No 270
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=50.41  E-value=5  Score=20.16  Aligned_cols=79  Identities=15%  Similarity=0.103  Sum_probs=35.9

Q ss_pred             HHHCCCEEEECC---CCCCEEEEEECCCCCCEEEEHHH---CCCCCCCHHHCCCC-----CHHHHHHHHHHHHCCHHHHH
Q ss_conf             762753025405---77410000102467610230244---07842612420548-----98999999999844989999
Q gi|254780767|r  283 ALCGIPVVSIYK---SEWIVNFFIFYIKTWTCALPNLI---VDYPLVPEYFNSMI-----RSEALVRWIERLSQDTLQRR  351 (383)
Q Consensus       283 al~g~P~IV~Yk---~~~lt~~i~~lik~~~i~LpNii---~~~~ivPEliQ~~~-----~~~~i~~~~~~ll~d~~~r~  351 (383)
                      .-.|+|.|+++-   ++..|+-++.+=.+ -++-|+-+   +|++|+.+-+..+.     +++.+.+.  -+++.--.|+
T Consensus       214 ~~~~lpyIsvlt~PTtGGVtASfA~lgDi-iiAEP~AlIGFAG~RVIeqTi~~~LPegFQtaEflleh--G~iD~IV~R~  290 (305)
T CHL00174        214 SNKKLFYISILTSPTTGGVTASFGMLGDI-IIAEPNAYIAFAGKRVIEQTLNKTVPEGSQAAEYLFHK--GLFDLIVPRN  290 (305)
T ss_pred             HCCCCCEEEEECCCCCCCCEEEECCCCCE-EEECCCCEEEECCCHHHHHHHCCCCCCCCCCHHHHHHC--CCCCEEECHH
T ss_conf             45787389997378877801241025665-89758866760561788886189899863226999977--9971676589


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999983
Q gi|254780767|r  352 AMLHGFENLWDRM  364 (383)
Q Consensus       352 ~~~~~~~~~~~~L  364 (383)
                      ++.+.+..+....
T Consensus       291 ~lk~~l~~lL~ih  303 (305)
T CHL00174        291 LLKGVLSELFQLH  303 (305)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999864


No 271
>PRK06924 short chain dehydrogenase; Provisional
Probab=49.99  E-value=19  Score=16.32  Aligned_cols=33  Identities=18%  Similarity=0.408  Sum_probs=23.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             45999976821478999999999973899839999717
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGG   41 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG   41 (383)
                      ||+.+++|-.||  .|..+.+.|-++   +.++..++-
T Consensus         1 MK~alITGas~G--IG~aiA~~la~~---G~~V~~~~r   33 (251)
T PRK06924          1 MRYVIITGTSKG--LGEAIATQLLEK---GTSVISISR   33 (251)
T ss_pred             CCEEEEECCCCH--HHHHHHHHHHHC---CCEEEEEEC
T ss_conf             999999298749--999999999987---999999979


No 272
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins. The type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins, some of which contain a conserved catalytic serine/threonine protein kinase (STKc) domain in the N-terminal region. Members of this group are sequence-similar to the branched-chain amino acid ABC transporter leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=49.94  E-value=19  Score=16.31  Aligned_cols=153  Identities=15%  Similarity=0.141  Sum_probs=71.6

Q ss_pred             HHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC----------CCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             99999861001288868985117765799998663013463111100----------22110036635579999986401
Q gi|254780767|r   76 RINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC----------PSVWAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        76 ~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~----------PqvWAWr~~R~k~~~~~~d~~~~  145 (383)
                      ......+.+.+.+.+++++--+.+-.+-++..+.+.  ++|++.-.+          |.+|.++..-.......++    
T Consensus        56 a~~~a~~li~~d~V~aiiG~~~S~~~~a~~~~~~~~--~vp~i~~~~~~~~~~~~~~~~~F~~~~~~~~~~~~~~~----  129 (336)
T cd06326          56 TVANTRKLIEDDKVFALFGYVGTPTTAAALPLLEEA--GVPLVGPFTGASSLRDPPDRNVFNVRASYADEIAAIVR----  129 (336)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH--CCEEEECCCCCHHHCCCCCCCEEEECCCHHHHHHHHHH----
T ss_conf             999999998528956998888987899999999983--76278336687242279998568967783899999999----


Q ss_pred             CCCCCHHHHHCCCCCCEE---ECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHH
Q ss_conf             567742232002553147---63882112210013558889761876556505998538743012305111899987640
Q gi|254780767|r  146 ILPFEKEVMQRLGGPPTT---FVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVK  222 (383)
Q Consensus       146 ifpFE~~~f~k~~~~~~~---fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~  222 (383)
                             ++.+. |.+..   |.-.+.-...  ...-.+..++.|..    ++.-.+=+..      -.-|-..+.++..
T Consensus       130 -------~~~~~-g~kkvavl~~d~~~g~~~--~~~~~~~~~~~G~~----vv~~~~~~~~------~~Dfs~~l~~i~~  189 (336)
T cd06326         130 -------HLVTL-GLKRIAVFYQDDAFGKDG--LAGVEKALAARGLK----PVATASYERN------TADVAAAVAQLAA  189 (336)
T ss_pred             -------HHHHC-CCCEEEEEECCCHHHHHH--HHHHHHHHHHCCCC----EEEEEEECCC------CCCHHHHHHHHHH
T ss_conf             -------99970-997599993587588999--99999999977993----7999986899------8777999999984


Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             273512620166336889999996048885055
Q gi|254780767|r  223 RNPFFRFSLVTVSSQENLVRCIVSKWDISPEII  255 (383)
Q Consensus       223 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~i~  255 (383)
                      ..|+..++....+..-..+++ +...+....+.
T Consensus       190 ~~pD~v~~~~~~~~~~~~~~q-~~~~G~~~~~~  221 (336)
T cd06326         190 ARPQAVIMVGAYKAAAAFIRA-LRKAGGGAQFY  221 (336)
T ss_pred             CCCCEEEEECCCHHHHHHHHH-HHHCCCCCEEE
T ss_conf             797999992782799999999-99769997599


No 273
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=49.78  E-value=19  Score=16.29  Aligned_cols=42  Identities=12%  Similarity=0.089  Sum_probs=28.4

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             99986100128886898511776579999866301346311110
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv  121 (383)
                      ....+.+.+.+.+++|+--+.+-.+.++..+.+.  ++|++...
T Consensus        60 ~~a~~Li~~d~V~aviG~~~S~~~~a~~~v~~~~--~vp~i~~~  101 (347)
T cd06340          60 TEAERLITEEGVVALVGAYQSAVTLAASQVAERY--GVPFVVDG  101 (347)
T ss_pred             HHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHH--CEEEEECC
T ss_conf             9999999718946974576737666646999862--84588048


No 274
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=49.34  E-value=10  Score=18.06  Aligned_cols=16  Identities=13%  Similarity=-0.074  Sum_probs=9.7

Q ss_pred             CCCCEEEEHHHCCCCC
Q ss_conf             6761023024407842
Q gi|254780767|r  307 KTWTCALPNLIVDYPL  322 (383)
Q Consensus       307 k~~~i~LpNii~~~~i  322 (383)
                      ...|+|+|-+|-...|
T Consensus       260 ~~~y~svP~~iG~~Gv  275 (310)
T cd01337         260 EAPFFATPVELGKNGV  275 (310)
T ss_pred             CCEEEEEEEEEECCEE
T ss_conf             7479999899934816


No 275
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glut
Probab=49.01  E-value=14  Score=17.17  Aligned_cols=107  Identities=26%  Similarity=0.369  Sum_probs=62.0

Q ss_pred             HHHHHHCCCCCCCEEEEECHHH--HHHHHHHHHHHHCCCCCCEEEEC-C---------CCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             9998610012888689851177--65799998663013463111100-2---------2110036635579999986401
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPD--FTHRVAKRVRKKMPNLPIINYVC-P---------SVWAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pg--Fnl~lak~lkk~~~~ipvi~yv~-P---------qvWAWr~~R~k~~~~~~d~~~~  145 (383)
                      ..+.+.++.-+||++|++-.++  |+-.+-|.+.+. ..-|+|+--| |         +.+.|..||+        .+.+
T Consensus        96 ~~L~e~v~~~kptvLIG~S~~~g~Fteevv~~Ma~~-~~~PIIFaLSNPt~~aE~~peda~~~t~G~a--------i~At  166 (254)
T cd00762          96 GDLEDAVEAAKPDFLIGVSRVGGAFTPEVIRAXAEI-NERPVIFALSNPTSKAECTAEEAYTATEGRA--------IFAS  166 (254)
T ss_pred             CCHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHC-CCCCEEEECCCCCCCCCCCHHHHHHHCCCCE--------EEEE
T ss_conf             999999986399889995899898899999977633-8898899778999867799999997518978--------9997


Q ss_pred             CCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEEC-------CCCCCHHHHCCCHHHHHH
Q ss_conf             5677422320025531476388211221001355888976187655650599853-------874301230511189998
Q gi|254780767|r  146 ILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPG-------SRAQEIYKILPFFESAVA  218 (383)
Q Consensus       146 ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPG-------SR~~EI~~~lP~~l~~~~  218 (383)
                      =-||.+--|   +| ++.+.                        .+-+...+|||       ||-..|..-  .++.+++
T Consensus       167 Gspf~pv~~---~g-~~~~~------------------------~Q~NN~~iFPGiglG~l~~~a~~itd~--M~~aAA~  216 (254)
T cd00762         167 GSPFHPVEL---NG-GTYKP------------------------GQGNNLYIFPGVALGVILCRIRHITDD--VFLSAAE  216 (254)
T ss_pred             CCCCCCEEE---CC-EEEEE------------------------CCCCEEEECHHHHHHHHHCCCCCCCHH--HHHHHHH
T ss_conf             897788158---88-48850------------------------564137885035466887087679999--9999999


Q ss_pred             HHHHC
Q ss_conf             76402
Q gi|254780767|r  219 SLVKR  223 (383)
Q Consensus       219 ~l~~~  223 (383)
                      .|...
T Consensus       217 aLA~~  221 (254)
T cd00762         217 AIASS  221 (254)
T ss_pred             HHHHH
T ss_conf             99852


No 276
>PRK13365 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=48.75  E-value=20  Score=16.19  Aligned_cols=30  Identities=13%  Similarity=0.176  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      ..++..+..+.+++++.+||++|.|-.=.|
T Consensus        31 ~~~f~g~~~~r~~l~~~kPDv~viv~nDH~   60 (279)
T PRK13365         31 KPLFDGYTPVAAWLAEQQADVLVFFYNDHC   60 (279)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             999999999999999839998999805657


No 277
>COG1737 RpiR Transcriptional regulators [Transcription]
Probab=48.73  E-value=15  Score=16.97  Aligned_cols=32  Identities=9%  Similarity=0.251  Sum_probs=17.5

Q ss_pred             EHHHHH-HHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             136746-64599999999998610012888689
Q gi|254780767|r   62 GIMQVV-RHLPQFIFRINQTVELIVSSKPDVLL   93 (383)
Q Consensus        62 G~~evl-~~~~~~~~~~~~~~~~i~~~~Pd~vi   93 (383)
                      .+.+.+ .++..+-+.-+++.+.|.++.+++.-
T Consensus         4 ~l~~~I~~~~~~Lt~~er~iA~yil~~~~~~~~   36 (281)
T COG1737           4 NLLERIRERYDSLTKSERKIADYILANPDEVAL   36 (281)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHCHHHHHH
T ss_conf             599999998852599999999999939678856


No 278
>cd01144 BtuF Cobalamin binding protein BtuF.  These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=48.47  E-value=20  Score=16.16  Aligned_cols=73  Identities=19%  Similarity=0.291  Sum_probs=37.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHH-HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             66459999999999861001288868985117765-79999866301346311110022110036635579999986401
Q gi|254780767|r   67 VRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFT-HRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        67 l~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn-l~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~  145 (383)
                      ++++|.+-....--.+.|..-+||+||.-+  ++| -.....+++.  |+|++.+ .|.       ....+.+.+..+-.
T Consensus        36 ~~~~p~vG~~~~p~~E~I~~L~PDLVi~~~--~~~~~~~~~~l~~~--gi~v~~~-~~~-------~~~~~~~~i~~lg~  103 (245)
T cd01144          36 AKKLPRVGGFYQLDLERVLALKPDLVIAWD--DCNVCAVVDQLRAA--GIPVLVS-EPQ-------TLDDILADIRRLGT  103 (245)
T ss_pred             HHCCCCCCCCCCCCHHHHHCCCCCEEEEEC--CCCHHHHHHHHHCC--CCEEEEE-CCC-------CHHHHHHHHHHHHH
T ss_conf             714883378889999999525996477426--87768899987604--9769984-899-------99999999999998


Q ss_pred             CCCCCH
Q ss_conf             567742
Q gi|254780767|r  146 ILPFEK  151 (383)
Q Consensus       146 ifpFE~  151 (383)
                      +|--|.
T Consensus       104 i~g~~~  109 (245)
T cd01144         104 LAGRPA  109 (245)
T ss_pred             HCCCHH
T ss_conf             749746


No 279
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase; InterPro: IPR010175   This clade of mainly archaeal and related bacterial species contains two characterised enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus  which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus. It is possible that all of the sequences within this clade have dual specificity, or that a mix of specificities have evolved within this clade.; GO: 0008270 zinc ion binding, 0016811 hydrolase activity acting on carbon-nitrogen (but not peptide) bonds in linear amides, 0050897 cobalt ion binding, 0009085 lysine biosynthetic process, 0005737 cytoplasm.
Probab=48.30  E-value=9.5  Score=18.30  Aligned_cols=20  Identities=25%  Similarity=0.327  Sum_probs=11.6

Q ss_pred             CCCHHHH-HHHHHHHHHHHCC
Q ss_conf             8214789-9999999997389
Q gi|254780767|r   12 EISGDLL-AGDLIKSLKEMVS   31 (383)
Q Consensus        12 E~SGD~~-~a~li~~Lk~~~~   31 (383)
                      -+|||-+ +|+.+.++++..+
T Consensus        11 spS~~E~~~a~fl~~~~~~~g   31 (352)
T TIGR01902        11 SPSGKEEEAAKFLEELKKELG   31 (352)
T ss_pred             CCCCCHHHHHHHHHHHHHHHC
T ss_conf             987118999999999999708


No 280
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional
Probab=48.23  E-value=6  Score=19.63  Aligned_cols=40  Identities=25%  Similarity=0.423  Sum_probs=29.2

Q ss_pred             HHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             6100128886898-5117765-799998663013463111100
Q gi|254780767|r   82 ELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        82 ~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      +.+.+.+||+||+ +.-||.+ +.+++.+|+. ...|+|..-+
T Consensus        39 ~~~~~~~~DlvilDi~LP~~dG~~l~~~iR~~-~~~PiI~lta   80 (240)
T PRK10701         39 ETILREQPDLVLLDIMLPGKDGMTICRDLRPK-WSGPIVLLTS   80 (240)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCEEEEECCCC-CCCCEEEEEE
T ss_conf             99861799999992899767887876311025-8987899940


No 281
>PRK13856 two-component response regulator VirG; Provisional
Probab=48.23  E-value=19  Score=16.25  Aligned_cols=42  Identities=17%  Similarity=0.260  Sum_probs=27.9

Q ss_pred             HHHHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             986100128886898-5117765-799998663013463111100
Q gi|254780767|r   80 TVELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~yv~  122 (383)
                      ..+.+....||++|+ +.-|+.| +.+.+.+|+. ..+|++-.-+
T Consensus        37 ~~~~l~~~~~DlvIlDi~lp~~~Gl~~~~~ir~~-~~~piiilt~   80 (241)
T PRK13856         37 FNRVLSSETVDVVVVDLNLGREDGLEIVRSLATK-SDVPIIIISG   80 (241)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCHHHHHHHCCC-CCCCEEEEEC
T ss_conf             9999865999999996999876613455564036-9973699972


No 282
>TIGR03288 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, subunit B. Members of this protein family are subunit B of the CoB--CoM heterodisulfide reductase, or simply heterodisulfide reductase, found in methanogenic archaea. Some archaea species have two copies, HdrB1 and HdrB2.
Probab=47.50  E-value=21  Score=16.07  Aligned_cols=20  Identities=15%  Similarity=-0.003  Sum_probs=7.8

Q ss_pred             CCCCEEEEECHHHHHHHHHH
Q ss_conf             28886898511776579999
Q gi|254780767|r   87 SKPDVLLIVDNPDFTHRVAK  106 (383)
Q Consensus        87 ~~Pd~vi~iD~pgFnl~lak  106 (383)
                      ..-|+++..-+-+-+++=+.
T Consensus        69 ~g~divt~C~~C~~~l~~~~   88 (290)
T TIGR03288        69 MGKDILTVCNGCYGSLFEAN   88 (290)
T ss_pred             CCCCEEEECCCHHHHHHHHH
T ss_conf             69968984802888899999


No 283
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed
Probab=47.36  E-value=21  Score=16.05  Aligned_cols=86  Identities=17%  Similarity=0.302  Sum_probs=54.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999768214789999999999738998399997178999478806504445311013674664599999999998610
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELI   84 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i   84 (383)
                      |++|++|+..-+.++..+.+.|++. +.++.+. ++|+.          ..                   ....++.+.+
T Consensus        36 k~lII~d~~v~~~~g~~v~~sL~~~-g~~v~~~-~~~e~----------s~-------------------~~i~~l~~~~   84 (351)
T PRK00843         36 NALIVTGPTTKEIAGKKVEDSLKDA-GFEVDVV-IVKDA----------TM-------------------EEVEKVEEKA   84 (351)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHC-CCEEEEE-ECCCC----------CH-------------------HHHHHHHHHH
T ss_conf             5899989527899999999999866-9859999-37999----------99-------------------9999999999


Q ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCC
Q ss_conf             01288868985117765799998663013463111100221
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSV  125 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~Pqv  125 (383)
                      +..+.|++|.+- .|=-+-++|++--. .|+|++.  -|+.
T Consensus        85 ~~~~~d~vi~~G-gG~~~D~~k~~a~~-~~~p~i~--vpT~  121 (351)
T PRK00843         85 RDSGAGFLIGVG-GGSSIDVAKLASTR-LGIPFIS--VPTA  121 (351)
T ss_pred             HHCCCCEEEEEC-CHHHHHHHHHHHHH-CCCCEEE--ECCC
T ss_conf             845999899956-51684899999998-2999899--5272


No 284
>PRK13136 consensus
Probab=47.11  E-value=21  Score=16.03  Aligned_cols=120  Identities=18%  Similarity=0.216  Sum_probs=58.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC---------CHHHHHCCCEEE---------EC---------HHHC
Q ss_conf             99997682147899999999997389983999971---------789994788065---------04---------4453
Q gi|254780767|r    6 IAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG---------GPSLQKEGLVSL---------FD---------FSEL   58 (383)
Q Consensus         6 i~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG---------G~~m~~~G~~~~---------~~---------~~~l   58 (383)
                      -|+.||.+|=|.-. .++++|-+. +  +.+.=+|         ||--|.+....+         ++         -..+
T Consensus        16 ~yitaG~P~~e~s~-~~~~~l~~~-G--~DiiElGiPfSDP~ADGpvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~pi   91 (253)
T PRK13136         16 AYLTAGDGGLERSL-ESLLALAKG-G--VNILEVGVPFSDPVADGPVIQEASIRALAQGTTLHDVLTLITSFRQHSEIPI   91 (253)
T ss_pred             EEECCCCCCHHHHH-HHHHHHHHC-C--CCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCE
T ss_conf             88648489989999-999999965-9--9989978998886665799999999999869979999999998225789888


Q ss_pred             CEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf             110136746645999999999986100128886898511776-5799998663013463111100221100366355799
Q gi|254780767|r   59 SVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMC  137 (383)
Q Consensus        59 ~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~  137 (383)
                      -.||.+..+.++.      .+..+.+++..-|.+|..|-|-= .-.+.+.+++.  |+..|..|+|+-   ...|++++.
T Consensus        92 vlM~Y~N~i~~~G------~~f~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~--~i~~I~liaPtt---~~eRi~~i~  160 (253)
T PRK13136         92 ILFTYFNPLLAAG------DKIYQQMKSAGVDGCLVVDLPVEEAAPHLTACKTA--KIAPILLISPST---TQERLKKIN  160 (253)
T ss_pred             EEECCCHHHHHHH------HHHHHHHHHCCCCCEECCCCCHHHHHHHHHHHHHC--CCCCEEEECCCC---CHHHHHHHH
T ss_conf             9986517999979------99999999749872006789977769999999975--887125526899---889999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780767|r  138 AYI  140 (383)
Q Consensus       138 ~~~  140 (383)
                      +..
T Consensus       161 ~~a  163 (253)
T PRK13136        161 EHG  163 (253)
T ss_pred             HCC
T ss_conf             608


No 285
>TIGR00504 pyro_pdase pyrrolidone-carboxylate peptidase; InterPro: IPR000816   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad .    This group of cysteine peptidases belong to MEROPS peptidase family C15 (pyroglutamyl peptidase I, clan CF). The type example being pyroglutamyl peptidase I of Bacillus amyloliquefaciens.    Pyroglutamyl/pyrrolidone carboxyl peptidase (Pcp or PYRase) is an exopeptidase that hydrolytically removes the pGlu from pGlu-peptides or pGlu-proteins , . PYRase has been found in prokaryotes and eukaryotes where at least two different classes have been characterised: the first containing bacterial and animal type I PYRases, and the second containing animal type II and serum PYRases. Type I and bacterial PYRases are soluble enzymes, while type II PYRases are membrane-bound. The primary application of PYRase has been its utilisation for protein or peptide sequencing, and bacterial diagnosis . The conserved residues Cys-144 and His-168 have been identified by inhibition and mutagenesis studies , .; GO: 0004219 pyroglutamyl-peptidase I activity, 0006508 proteolysis.
Probab=46.92  E-value=16  Score=16.81  Aligned_cols=87  Identities=18%  Similarity=0.198  Sum_probs=36.7

Q ss_pred             HHHCCC-HHHHHHHH----HHCCCCCEEEECCCCCHHHHHHHHHHHCCCCCE---EEEECCCCHHHHH--------HHHH
Q ss_conf             230511-18999876----402735126201663368899999960488850---5520552035788--------7635
Q gi|254780767|r  207 YKILPF-FESAVASL----VKRNPFFRFSLVTVSSQENLVRCIVSKWDISPE---IIIDKEQKKQVFM--------TCNA  270 (383)
Q Consensus       207 ~~~lP~-~l~~~~~l----~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~---i~~~~~~~~~~l~--------~sd~  270 (383)
                      .+.+|. |.++.+.|    .+..|++.+.+-.+|+..+.--+.+.-+-.+..   +--..++  ...-        +|.+
T Consensus        38 a~~~P~~F~~A~~~l~~~i~~~~P~~vI~~G~~PGR~~IsvERvA~N~~DARryGipDn~G~--qp~De~~~~~GPaAYf  115 (220)
T TIGR00504        38 ARILPVAFKEALEALRQAIDEVEPDIVIALGLAPGRSQISVERVAINLNDARRYGIPDNEGE--QPIDEPIVPDGPAAYF  115 (220)
T ss_pred             EEECCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCC--CCCCCCCCCCCCCEEE
T ss_conf             75355257999999999998509544885157679876508888773576203578878888--6888756888872054


Q ss_pred             HHCCCHHHHHHHHHHCCCEEEECCC
Q ss_conf             5233115668887627530254057
Q gi|254780767|r  271 AMAASGTVILELALCGIPVVSIYKS  295 (383)
Q Consensus       271 ai~~SGTaTLE~al~g~P~IV~Yk~  295 (383)
                      +=.--=..+.+.=-.|+|..|.|-.
T Consensus       116 at~Pvr~mv~~mk~~GipA~vS~tA  140 (220)
T TIGR00504       116 ATLPVRAMVKAMKKAGIPAAVSYTA  140 (220)
T ss_pred             CCCCHHHHHHHHHHCCCCCCHHHHH
T ss_conf             3270899999998669972122353


No 286
>COG0163 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism]
Probab=46.75  E-value=21  Score=15.99  Aligned_cols=152  Identities=17%  Similarity=0.259  Sum_probs=74.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH--HHHCC------------CEEEECHHHCCE---EEHHH
Q ss_conf             74599997682147899999999997389983999971789--99478------------806504445311---01367
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPS--LQKEG------------LVSLFDFSELSV---IGIMQ   65 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~--m~~~G------------~~~~~~~~~l~v---~G~~e   65 (383)
                      +|||.+---.+||-.||-+|++.|++. +.++++.=--+.+  ++.+.            ....+|-++++.   .|=+.
T Consensus         2 ~~riivgisGASG~iygvrlLe~L~~~-~~e~hlviS~~a~~~~~~E~~~~~~~~~~~~~a~~~~~~~D~~A~iASGS~~   80 (191)
T COG0163           2 MKRIIVGISGASGAIYGVRLLEVLREL-GVETHLVISKAAKKTLKYETGNDESLGEVLALADVVHDEKDIGAPIASGSFR   80 (191)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECHHHHHHHHHHHCCCHHHHHHHHHCCEECCHHHCCCCCCCCCCC
T ss_conf             827999973664289999999999746-9569999867899999987476310677742010226787716765578877


Q ss_pred             ---------HHHHHHHHH-----HHHHHHHH-HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCC--
Q ss_conf             ---------466459999-----99999986-1001288868985117765799998663013463111100221100--
Q gi|254780767|r   66 ---------VVRHLPQFI-----FRINQTVE-LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAW--  128 (383)
Q Consensus        66 ---------vl~~~~~~~-----~~~~~~~~-~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAW--  128 (383)
                               -.+.+..+-     .++.+.-+ .+++.+|-+++.=..|=--..|-..+|-...|.    .|.|-+=||  
T Consensus        81 ~~gMiI~PCSmkTla~IA~G~~dnLi~RAAdV~LKErR~LVLv~REtPl~~ihLeNMlkls~~Ga----iI~Pp~PaFY~  156 (191)
T COG0163          81 TDGMIIAPCSMKTLAAIAHGFADNLITRAADVALKERRPLVLVPRETPLSLIHLENMLKLAEMGA----IIMPPMPAFYH  156 (191)
T ss_pred             CCCEEEEECCHHHHHHHHHCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHCCC----EECCCCHHHHC
T ss_conf             68479994727779999811421489898899886178259996378854899999999998889----86579706644


Q ss_pred             CCCCHHHHHH-HHHHHCCCCCCCHHHHHCCCC
Q ss_conf             3663557999-998640156774223200255
Q gi|254780767|r  129 REGRARKMCA-YINQVISILPFEKEVMQRLGG  159 (383)
Q Consensus       129 r~~R~k~~~~-~~d~~~~ifpFE~~~f~k~~~  159 (383)
                      +++.+..+.. .+-+++-.|--|.+.|+++.|
T Consensus       157 kP~sieDlvd~~v~rvLD~lgI~~~l~~RW~~  188 (191)
T COG0163         157 KPQSIEDLVDFVVGRVLDLLGIEHDLYKRWQG  188 (191)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCHHCCCCC
T ss_conf             99889999999999999984899740102377


No 287
>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism]
Probab=46.74  E-value=12  Score=17.67  Aligned_cols=35  Identities=23%  Similarity=0.480  Sum_probs=25.0

Q ss_pred             CCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCCCC
Q ss_conf             6635579999986401567742232002553147638821
Q gi|254780767|r  130 EGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPL  169 (383)
Q Consensus       130 ~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl  169 (383)
                      ++|+-.+-+...+|+..||   + | +++--++.|+|.|.
T Consensus        82 kS~~Vi~GrVtEqlaPffp---~-f-~ynPkD~RfIGTPv  116 (175)
T COG4741          82 KSRAVILGRVTEQLAPFFP---E-F-KYNPKDARFIGTPV  116 (175)
T ss_pred             HHHHHHHHHHHHHHCCCCC---C-C-CCCCCCCEEECCCC
T ss_conf             7688886355765331055---7-7-76975551207971


No 288
>cd07949 PCA_45_Doxase_B_like_1 The B subunit of unknown Class III extradiol dioxygenases with similarity to Protocatechuate 4,5-dioxygenase. This subfamily is composed of proteins of unknown function with similarity to the B subunit of Protocatechuate 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=46.67  E-value=21  Score=15.98  Aligned_cols=31  Identities=19%  Similarity=0.223  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH
Q ss_conf             9999999999861001288868985117765
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFT  101 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn  101 (383)
                      ..++..+..+.+++++.+||++|.|-.=.||
T Consensus        31 ~~~f~a~~~~r~~l~~~~PDvvvvv~~DH~~   61 (276)
T cd07949          31 KPFFDGFPPVHDWLEKAKPDVAVVFYNDHGL   61 (276)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             8999889999999998499989998256787


No 289
>PTZ00325 malate dehydrogenase; Provisional
Probab=46.63  E-value=12  Score=17.69  Aligned_cols=27  Identities=7%  Similarity=-0.095  Sum_probs=13.1

Q ss_pred             CCCCEEEEHHHCCCCCCCHHHCC-CCCHH
Q ss_conf             67610230244078426124205-48989
Q gi|254780767|r  307 KTWTCALPNLIVDYPLVPEYFNS-MIRSE  334 (383)
Q Consensus       307 k~~~i~LpNii~~~~ivPEliQ~-~~~~~  334 (383)
                      ...|+|+|=+|-... +-|.+.- +.|.+
T Consensus       259 ~~~~lg~P~viG~~G-ve~iielp~L~~~  286 (313)
T PTZ00325        259 ECPFFGSPVELGKNG-VEKVLPIPPLNAY  286 (313)
T ss_pred             CCEEEEEEEEEECCE-EEEECCCCCCCHH
T ss_conf             709999998991897-8997778889999


No 290
>PRK04507 consensus
Probab=46.56  E-value=21  Score=15.97  Aligned_cols=104  Identities=14%  Similarity=0.180  Sum_probs=55.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHH-HHHHHHCCCCEEEEEECCHHHHH-----CCCEEE-ECHHH-------CCEEEHHHH
Q ss_conf             98745999976821478999999-99997389983999971789994-----788065-04445-------311013674
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLI-KSLKEMVSYPINLVGVGGPSLQK-----EGLVSL-FDFSE-------LSVIGIMQV   66 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li-~~Lk~~~~~~~~~~giGG~~m~~-----~G~~~~-~~~~~-------l~v~G~~ev   66 (383)
                      |..-+|.|..|+++|  .|..++ +++++. ..+.++..+|.+..-+     .|.+.- .+.++       +.+.-+.+.
T Consensus         1 M~~P~IaIT~GDPaG--IGPEIilK~~~~~-~~~~~~vvigd~~~l~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~   77 (323)
T PRK04507          1 MMVPSLALVPGEPAG--IGPELCVRLAQQP-RSDAHLIAYADPDTLHSAAKALSLPVRLLDPDQPARAPGDLPLHPVRQA   77 (323)
T ss_pred             CCCCEEEEECCCCCH--HHHHHHHHHHHCC-CCCCCEEEEECHHHHHHHHHHCCCCEEECCCCCHHHCCCCCEEEECCCC
T ss_conf             999838991588626--6999999998666-4589989998999999999866998176273204326897225213455


Q ss_pred             ---------HHHHHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHH
Q ss_conf             ---------6645999999999986100128886898------------5117765799998
Q gi|254780767|r   67 ---------VRHLPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKR  107 (383)
Q Consensus        67 ---------l~~~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~  107 (383)
                               -.+-...+..++...+.+++.+.|++|+            .+|||-.--||++
T Consensus        78 ~~~~~G~~~~~~g~~~~~~l~~Av~~~~~g~~~aiVTaPInK~~l~~aG~~f~GHTE~La~~  139 (323)
T PRK04507         78 VPTRFGAPDPANAAAVIAGLRGAAGDCLHGRLQGIVTGPVHKAVINAGGIAYTGTTELLAAQ  139 (323)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHH
T ss_conf             76768986878999999999999999975997799977536999985799989726999887


No 291
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=46.41  E-value=21  Score=15.96  Aligned_cols=42  Identities=14%  Similarity=0.154  Sum_probs=28.7

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             99998610012888689851177657999986630134631111
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      .+...+.+.+.+.+++++-.+.+-.+-++..+.+.  ++|++..
T Consensus        56 ~~~a~~Li~~~~V~aviG~~~S~~~~A~~~~~~~~--~vp~i~~   97 (347)
T cd06335          56 LQNAQELAADEKVVAVLGGLHTPVALANLEFIQQN--KIPLIGP   97 (347)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHC--CEEEECC
T ss_conf             99999999549926874577722345532157757--9438636


No 292
>PRK13364 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=46.37  E-value=21  Score=15.95  Aligned_cols=30  Identities=23%  Similarity=0.232  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      ..++..+..+.+++++.+||++|.|-.=.|
T Consensus        31 ~~~f~a~~~~r~~l~~~~PDvvVvv~nDH~   60 (279)
T PRK13364         31 KPFFDGFPPVREWLEKVKPDVAVVFYNDHG   60 (279)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             999998999999999849998999805668


No 293
>TIGR02875 spore_0_A sporulation transcription factor Spo0A; InterPro: IPR012052   Members of this group are response regulators/transcription factors that contain CheY-like receiver (phosphoacceptor) domain and a unique DNA-binding domain. Spo0A controls the entry of Bacillus subtilis into the developmental process of sporulation . Activation of the Spo0A transcription factor by phosphorylation serves as a developmental checkpoint and to integrate several physiological signals that control entry into the sporulation pathway. The signals are generated by conditions of nutrient deprivation, high cell density, the Krebs cycle, DNA replication, DNA damage, and some aspect of the chromosome partitioning machinery .  Activated Spo0A has multiple functions . It represses promoters (such as the abrB promoter) by binding to sites (0A boxes) downstream from the transcription start site. Spo0A also activates transcription from promoters used by two forms of RNA polymerase that differ by containing either the major sigma factor, sigma A (e.g. the spoIIE and spoIIG promoters) or the alternate sigma factor, sigma H (e.g. the spoIIA promoter). At promoters activated by Spo0A, the 0A boxes lie upstream of the transcription-initiation site.; GO: 0003677 DNA binding, 0005509 calcium ion binding, 0000160 two-component signal transduction system (phosphorelay), 0042173 regulation of sporulation, 0045449 regulation of transcription, 0050906 detection of stimulus during sensory perception.
Probab=46.33  E-value=14  Score=17.27  Aligned_cols=34  Identities=12%  Similarity=0.086  Sum_probs=22.7

Q ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCC
Q ss_conf             3688999999604888505520552035788763552331
Q gi|254780767|r  236 SQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAAS  275 (383)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~S  275 (383)
                      +++..+.+.+.+.+.+.++.   |.  -.|..|= .++.+
T Consensus       155 dLe~~iT~iiHE~GVPAHiK---GY--~YLRdAI-~mV~~  188 (270)
T TIGR02875       155 DLEAEITNIIHEIGVPAHIK---GY--MYLRDAI-LMVLK  188 (270)
T ss_pred             CHHHHHHHHHHHCCCCCCCC---CC--HHHHHHH-HHHHH
T ss_conf             53578999998628988634---21--0588999-98750


No 294
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
Probab=46.19  E-value=22  Score=15.94  Aligned_cols=263  Identities=17%  Similarity=0.213  Sum_probs=131.7

Q ss_pred             CCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEE-----ECCCCCCCCCCCHHHHHHH-----------------HH
Q ss_conf             01288868985-1177657999986630134631111-----0022110036635579999-----------------98
Q gi|254780767|r   85 VSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINY-----VCPSVWAWREGRARKMCAY-----------------IN  141 (383)
Q Consensus        85 ~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~y-----v~PqvWAWr~~R~k~~~~~-----------------~d  141 (383)
                      ...+||-+|-| ||-  =+.+++.||++.++.++-+|     -+|.+|.=-++|-..++..                 ++
T Consensus       127 ~~~~~~D~VWVHDYh--L~llP~~LR~~~~~~~igfFlHiPFPs~eifr~LP~r~eil~glL~~DlIGF~t~~y~r~Fl~  204 (460)
T cd03788         127 EVLRPGDLVWVHDYH--LLLLPQMLRERGPDARIGFFLHIPFPSSEIFRCLPWREELLRGLLGADLIGFQTERYARNFLS  204 (460)
T ss_pred             HHCCCCCEEEEECCH--HHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHCCCHHHHHHHHHHCCEEEECCHHHHHHHHH
T ss_conf             856899879996416--776899999858998489887079999899976976799999987477666468899999999


Q ss_pred             HHCCCCCCCHHHHHCCCCCCEEECCC-------CCCCCC------CCCCCHHHHHHH-CCCCCCCCEEEEEECCCCCCHH
Q ss_conf             64015677422320025531476388-------211221------001355888976-1876556505998538743012
Q gi|254780767|r  142 QVISILPFEKEVMQRLGGPPTTFVGH-------PLSSSP------SILEVYSQRNKQ-RNTPSQWKKILLLPGSRAQEIY  207 (383)
Q Consensus       142 ~~~~ifpFE~~~f~k~~~~~~~fVGH-------Pl~d~~------~~~~~~~~~~~~-~~~~~~~~~I~llPGSR~~EI~  207 (383)
                      .+--+++-|...     ..-+.|-||       |+-=+.      .......+..++ .....+++  .++ |-=+-+-.
T Consensus       205 ~~~r~l~~~~~~-----~~~v~~~gr~v~v~~~PigId~~~~~~~~~~~~~~~~~~~l~~~~~~~~--li~-gvDRlDy~  276 (460)
T cd03788         205 CCSRLLGLEVTD-----DGGVEYGGRRVRVGAFPIGIDPDAFRKLAASPEVQERAAELRERLGGRK--LIV-GVDRLDYS  276 (460)
T ss_pred             HHHHHCCCCCCC-----CCEEEECCEEEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCE--EEE-ECCCCCCC
T ss_conf             999970985247-----9859999989999898040188999998628324799999998737971--999-62532111


Q ss_pred             HHCCCHHHHHHHHHHCCCCC----EEEECCCCCH---------HHHHHHHHH----HCCC---CCEEEE----ECCCCHH
Q ss_conf             30511189998764027351----2620166336---------889999996----0488---850552----0552035
Q gi|254780767|r  208 KILPFFESAVASLVKRNPFF----RFSLVTVSSQ---------ENLVRCIVS----KWDI---SPEIII----DKEQKKQ  263 (383)
Q Consensus       208 ~~lP~~l~~~~~l~~~~~~~----~~~i~~~~~~---------~~~~~~~~~----~~~~---~~~i~~----~~~~~~~  263 (383)
                      +.+|.-+.+.+.+.+++|+.    .++..+.|+.         ...+...+.    +++.   .+...+    ..++...
T Consensus       277 KGi~~kl~Afe~fL~~~Pe~~~kvvlvQia~psr~~v~~y~~l~~~i~~~v~~IN~~fg~~~w~PI~y~~~~~~~~el~a  356 (460)
T cd03788         277 KGIPERLLAFERLLERYPEWRGKVVLVQIAVPSRTDVPEYQELRREVEELVGRINGKFGTLDWTPVRYLYRSLPREELAA  356 (460)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHH
T ss_conf             48788999999999869143377799999258776755789999999999999861437899702999917999999999


Q ss_pred             HHHHHHHHHCCC---H--HHHHHHHHHCC--CEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHH
Q ss_conf             788763552331---1--56688876275--3025405774100001024676102302440784261242054898999
Q gi|254780767|r  264 VFMTCNAAMAAS---G--TVILELALCGI--PVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEAL  336 (383)
Q Consensus       264 ~l~~sd~ai~~S---G--TaTLE~al~g~--P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i  336 (383)
                      ++..||+++++|   |  .++.|..++..  |.|++     |         ..|.|-...+.+--     +=+-.+.+.+
T Consensus       357 ly~~ADv~lVT~lrDGMNLvakEyva~q~~~~GvLI-----L---------SefaGaa~~L~~Al-----~VNP~d~~~~  417 (460)
T cd03788         357 LYRAADVALVTPLRDGMNLVAKEYVACQDDDPGVLI-----L---------SEFAGAAEELSGAL-----LVNPYDIDEV  417 (460)
T ss_pred             HHHHHHEEEECCCCCCCCCCCHHHEEEECCCCCEEE-----E---------ECCCCCHHHHCCCE-----EECCCCHHHH
T ss_conf             998610578553423325341311367559995599-----9---------65524366728787-----9799998999


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99999984498999999999999999838999989999999998
Q gi|254780767|r  337 VRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQ  380 (383)
Q Consensus       337 ~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~  380 (383)
                      ++++..=|.-+.  ++..+..+.+++.+.... +..-+ +..++
T Consensus       418 a~ai~~AL~M~~--~Er~~R~~~l~~~v~~~~-~~~W~-~~fl~  457 (460)
T cd03788         418 ADAIHRALTMPL--EERRERHRKLREYVRTHD-VQAWA-NSFLD  457 (460)
T ss_pred             HHHHHHHHCCCH--HHHHHHHHHHHHHHHHCC-HHHHH-HHHHH
T ss_conf             999999975999--999999999999988579-99999-99999


No 295
>cd07950 Gallate_Doxase_N The N-terminal domain of the Class III extradiol dioxygenase, Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. In this subfamily, the subunits A and B are fused to make a single polypeptide chain. The dimer interface for this subfamily may resemble the tetramer interface of classical LigAB en
Probab=46.18  E-value=22  Score=15.93  Aligned_cols=31  Identities=26%  Similarity=0.359  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH
Q ss_conf             9999999999861001288868985117765
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFT  101 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn  101 (383)
                      ..++..+..+.+++++.+||++|.|-.=.||
T Consensus        31 ~~~f~a~~~~r~~l~~~~PDv~viv~~DH~~   61 (277)
T cd07950          31 APIFDGYEPVKQWLAEQKPDVLFMVYNDHVT   61 (277)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             9999999999999997399989998246787


No 296
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=45.99  E-value=22  Score=15.92  Aligned_cols=50  Identities=10%  Similarity=0.073  Sum_probs=29.4

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE--CCCCCCC
Q ss_conf             999986100128886898511776579999866301346311110--0221100
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV--CPSVWAW  128 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv--~PqvWAW  128 (383)
                      .....+.+...+.+++|+--+.+-.+-.+..+.+.  ++|++..-  +|++..+
T Consensus        56 ~~~a~~Lv~~d~V~~viG~~~S~~~~a~~~v~~~~--~vp~i~~~~~~~~~~~~  107 (344)
T cd06348          56 INAFQTLINKDRVLAIIGPTLSQQAFAADPIAERA--GVPVVGPSNTAKGIPEI  107 (344)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHC--CCCEECCCCCCCCCCCC
T ss_conf             99999998638946995687742555344899875--99276157566555657


No 297
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=45.98  E-value=13  Score=17.45  Aligned_cols=41  Identities=7%  Similarity=0.115  Sum_probs=32.0

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             9998610012888689851177657999986630134631111
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y  120 (383)
                      .++.+.+++.+-=.|+-+|.++=-.++++.|.+.  |++++-+
T Consensus         7 ~~vl~~l~~~~iipVvr~~~~e~a~~~a~aL~~g--Gi~~iEi   47 (223)
T PRK07114          7 IAVLNAMKSTGMVPVFYHSDIEVAKKVVKACYDG--GVRAFEF   47 (223)
T ss_pred             HHHHHHHHHCCEEEEEEECCHHHHHHHHHHHHHC--CCCEEEE
T ss_conf             9999999879979999828999999999999988--9988999


No 298
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=45.90  E-value=22  Score=15.91  Aligned_cols=153  Identities=9%  Similarity=0.135  Sum_probs=71.4

Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE--------CCCCCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             9986100128886898511776579999866301346311110--------02211003663557999998640156774
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV--------CPSVWAWREGRARKMCAYINQVISILPFE  150 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv--------~PqvWAWr~~R~k~~~~~~d~~~~ifpFE  150 (383)
                      ...+.+.+.+.++++.- +.+.+......+.+.  ++|++...        .|..|.|...-.-......+         
T Consensus        58 ~a~~Li~~~~V~ai~G~-~s~~~~~~~~~~~~~--~ip~i~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~---------  125 (341)
T cd06341          58 CARDLVEDDKVVAVVGG-SSGAGGSALPYLAGA--GIPVIGGAGTSAWELTSPNSFPFSGGTPASLTTWGD---------  125 (341)
T ss_pred             HHHHHHHCCCCEEEEEC-CCHHHHHHHHHHHHC--CCEEEECCCCCCCCCCCCCEEEECCCCHHHHHHHHH---------
T ss_conf             99999852892899908-862679999999987--971994687772202788889980687799999999---------


Q ss_pred             HHHHHCCCCCCEEECCCCCCCCCC-CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEE
Q ss_conf             223200255314763882112210-0135588897618765565059985387430123051118999876402735126
Q gi|254780767|r  151 KEVMQRLGGPPTTFVGHPLSSSPS-ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRF  229 (383)
Q Consensus       151 ~~~f~k~~~~~~~fVGHPl~d~~~-~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~  229 (383)
                        |..+..+.+...+.++--+.-. .........++.|..    ++.-.+=.+.      -+-|-..+.++....|+..+
T Consensus       126 --~~~~~~~~k~~~~~~~~~~~g~~~~~~~~~~~~~~G~~----vv~~~~~~~~------~~D~~~~v~~l~~~~pd~V~  193 (341)
T cd06341         126 --FAKDQGGTRAVALVTALSAAVSAAAALLARSLAAAGVS----VAGIVVITAT------APDPTPQAQQAAAAGADAII  193 (341)
T ss_pred             --HHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCC----EEEEEECCCC------CCCHHHHHHHHHHCCCCEEE
T ss_conf             --99964898489999358358899999999999975995----4578744899------98778999999856969999


Q ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             201663368899999960488850552
Q gi|254780767|r  230 SLVTVSSQENLVRCIVSKWDISPEIII  256 (383)
Q Consensus       230 ~i~~~~~~~~~~~~~~~~~~~~~~i~~  256 (383)
                      .....+..-..+++ .++.+....+..
T Consensus       194 ~~~~~~~~~~~~k~-~~~~G~~~~~~~  219 (341)
T cd06341         194 TVLDAAVCASVLKA-VRAAGLTPKVVL  219 (341)
T ss_pred             EECCCHHHHHHHHH-HHHCCCCCCEEE
T ss_conf             90684789999999-997699971899


No 299
>KOG1192 consensus
Probab=45.80  E-value=22  Score=15.90  Aligned_cols=39  Identities=21%  Similarity=-0.053  Sum_probs=26.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             7459999768214789999999999738998399997178
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGP   42 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~   42 (383)
                      ...|++..-..|...-...+++.|..+ +.++.+.-....
T Consensus         6 ~~~il~~~p~~sH~~~~~~la~~L~~~-gh~vt~~~~~~~   44 (496)
T KOG1192           6 AHNILVPFPGQSHLNPMLQLAKRLAER-GHNVTVVTPSFN   44 (496)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCC
T ss_conf             079999898704899999999999978-994999956541


No 300
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]
Probab=45.80  E-value=22  Score=15.90  Aligned_cols=71  Identities=23%  Similarity=0.455  Sum_probs=38.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCHH------HHHCCC--EEEECHHHCCEEEHHHHHHHHHHHHH-----HHHHHHHHC
Q ss_conf             99999999997389983999971789------994788--06504445311013674664599999-----999998610
Q gi|254780767|r   18 LAGDLIKSLKEMVSYPINLVGVGGPS------LQKEGL--VSLFDFSELSVIGIMQVVRHLPQFIF-----RINQTVELI   84 (383)
Q Consensus        18 ~~a~li~~Lk~~~~~~~~~~giGG~~------m~~~G~--~~~~~~~~l~v~G~~evl~~~~~~~~-----~~~~~~~~i   84 (383)
                      +|-.=++.|++   ..+-+.|+||-.      +...|+  -++.|++++.+.-.=   +++..+..     ...-+++.+
T Consensus        20 ~G~~~lekl~~---~~V~VvGiGGVGSw~veALaRsGig~itlID~D~v~vTN~N---RQi~A~~~~iGk~Kv~vm~eri   93 (263)
T COG1179          20 YGEDGLEKLKQ---AHVCVVGIGGVGSWAVEALARSGIGRITLIDMDDVCVTNTN---RQIHALLGDIGKPKVEVMKERI   93 (263)
T ss_pred             CCHHHHHHHHC---CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECHHCCCCCCC---HHHHHHHHHCCCHHHHHHHHHH
T ss_conf             27668999750---94899945845399999999818881899712010222321---2667766231437899999999


Q ss_pred             CCCCCCEEEE
Q ss_conf             0128886898
Q gi|254780767|r   85 VSSKPDVLLI   94 (383)
Q Consensus        85 ~~~~Pd~vi~   94 (383)
                      +.-+|.+=|.
T Consensus        94 ~~InP~c~V~  103 (263)
T COG1179          94 KQINPECEVT  103 (263)
T ss_pred             HHHCCCCEEE
T ss_conf             8619874676


No 301
>PRK13931 stationary phase survival protein SurE; Provisional
Probab=45.78  E-value=13  Score=17.40  Aligned_cols=35  Identities=23%  Similarity=0.307  Sum_probs=16.8

Q ss_pred             CCCCCCEEEEECHHHHHH--------HHHHHHHHHCCCCCCEE
Q ss_conf             012888689851177657--------99998663013463111
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTH--------RVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl--------~lak~lkk~~~~ipvi~  119 (383)
                      +..+||+||-==..|-|+        -++..+-....|||-|=
T Consensus        84 ~~~~PDLVvSGIN~G~NlG~dv~ySGTVgAA~Eg~~~gipsIA  126 (261)
T PRK13931         84 KDAPPDLVLSGVNRGNNSAENVLYSGTVGGAMEAALQGLPAIA  126 (261)
T ss_pred             CCCCCCEEEECCCCCCCCEEEEECHHHHHHHHHHHHCCCCCEE
T ss_conf             4899888996765887654514331888999999983999578


No 302
>cd04795 SIS SIS domain. SIS (Sugar ISomerase) domains are found in many phosphosugar isomerases and phosphosugar binding proteins. SIS domains are also found in proteins that regulate the expression of genes involved in synthesis of phosphosugars.
Probab=45.75  E-value=21  Score=16.05  Aligned_cols=32  Identities=19%  Similarity=0.317  Sum_probs=21.0

Q ss_pred             CCCCEEEEECHHHHHH---HHHHHHHHHCCCCCCEEE
Q ss_conf             2888689851177657---999986630134631111
Q gi|254780767|r   87 SKPDVLLIVDNPDFTH---RVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        87 ~~Pd~vi~iD~pgFnl---~lak~lkk~~~~ipvi~y  120 (383)
                      .+=|++|.|.+.|-.-   ..++.+|++  |+|++=.
T Consensus        46 ~~~D~vi~iS~SG~t~e~~~~~~~ak~~--g~~vi~I   80 (87)
T cd04795          46 RKGDVVIALSYSGRTEELLAALEIAKEL--GIPVIAI   80 (87)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHC--CCCEEEE
T ss_conf             8999899997997988999999999987--9989998


No 303
>CHL00067 rps2 ribosomal protein S2
Probab=45.68  E-value=22  Score=15.89  Aligned_cols=18  Identities=33%  Similarity=0.512  Sum_probs=12.6

Q ss_pred             HHHHHHHCCCEEEECCCC
Q ss_conf             688876275302540577
Q gi|254780767|r  279 ILELALCGIPVVSIYKSE  296 (383)
Q Consensus       279 TLE~al~g~P~IV~Yk~~  296 (383)
                      -.||..+|+|.|-+-.|+
T Consensus       173 i~Ea~kL~IPvIaivDTn  190 (227)
T CHL00067        173 LRECIKLGIPTISIVDTN  190 (227)
T ss_pred             HHHHHHCCCCEEEEEECC
T ss_conf             999987599989996389


No 304
>pfam03959 FSH1 Serine hydrolase (FSH1). This is a family of serine hydrolases.
Probab=45.67  E-value=22  Score=15.88  Aligned_cols=44  Identities=20%  Similarity=0.311  Sum_probs=31.4

Q ss_pred             CCCEEEEE-ECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH
Q ss_conf             87459999-7682147899999999997389983999971789994
Q gi|254780767|r    2 NSLKIAVI-AGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQK   46 (383)
Q Consensus         2 ~~mki~i~-aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~   46 (383)
                      ++|||+.. ....||++.-..+ +.|++....+++|..+-||.-..
T Consensus         3 ~k~riLcLHG~g~n~~if~~q~-~~l~~~L~~~~ef~f~daP~~~~   47 (210)
T pfam03959         3 KKLKILCLHGFGQSGEIFRAKT-GALRKLLKKGVELVYLDAPFPLA   47 (210)
T ss_pred             CCCEEEEECCCCCCHHHHHHHH-HHHHHHHHCCCEEEEECCCCCCC
T ss_conf             7766998799997999999999-99999860474699707863468


No 305
>pfam06838 Alum_res Aluminium resistance protein. This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria.
Probab=45.34  E-value=19  Score=16.24  Aligned_cols=24  Identities=29%  Similarity=0.634  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECH
Q ss_conf             999999986100128886898511
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDN   97 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~   97 (383)
                      ...++++.+.+++.+||++|+||.
T Consensus       175 i~~I~~~i~~vk~~~pd~ivfVDN  198 (405)
T pfam06838       175 IAEIKEMIKFVKEINPNVIVFVDN  198 (405)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             999999999999768993999978


No 306
>cd07364 PCA_45_Dioxygenase_B Subunit B of the Class III extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of protocatechuate. Protocatechuate 4,5-dioxygenase (LigAB) catalyzes the oxidization and subsequent ring-opening of protocatechuate (or 3,4-dihydroxybenzoic acid, PCA), an intermediate in the breakdown of lignin and other compounds. Protocatechuate 4,5-dioxygenase is an aromatic ring opening dioxygenase belonging to the class III extradiol enzyme family, a group of enyzmes that cleaves aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon using a non-heme Fe(II). LigAB is composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. The B subunit (LigB) is the catalytic subunit of LigAB.
Probab=45.32  E-value=22  Score=15.85  Aligned_cols=30  Identities=27%  Similarity=0.311  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      ..++..+..+.+++++.+||++|.|-.=.|
T Consensus        31 ~~~f~g~~~~r~~l~~~~PDv~viv~nDH~   60 (277)
T cd07364          31 KPLFKGYQPARDWIKKNKPDVAIIVYNDHA   60 (277)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             999988899999999739998999815668


No 307
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=45.24  E-value=22  Score=15.84  Aligned_cols=95  Identities=11%  Similarity=0.125  Sum_probs=51.9

Q ss_pred             EEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCCCCC
Q ss_conf             68985117765799998663013463111100221100366355799999864015677422320025531476388211
Q gi|254780767|r   91 VLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLS  170 (383)
Q Consensus        91 ~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl~  170 (383)
                      -||.+-|.-|--.+++.+++.  |+|++-.         +.....+               +.-+++ |.++.| |.+- 
T Consensus       402 ~VII~G~GR~Gq~var~L~~~--gi~~vvi---------D~d~~~V---------------~~~r~~-G~~v~y-GDat-  452 (602)
T PRK03659        402 QVIIVGFGRFGQVIGRLLMAN--KMRITVL---------ERDISAV---------------NLMRKY-GYKVYY-GDAT-  452 (602)
T ss_pred             CEEEECCCHHHHHHHHHHHHC--CCCEEEE---------ECCHHHH---------------HHHHHC-CCEEEE-ECCC-
T ss_conf             989978875689999999978--9998999---------7867999---------------999978-990897-5899-


Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             2210013558889761876556505998538743012305111899987640273512620
Q gi|254780767|r  171 SSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSL  231 (383)
Q Consensus       171 d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i  231 (383)
                              +.+..+.-|.++.+-.|.-.|....         -.++++..++.+|++..+.
T Consensus       453 --------~~~vL~~AGi~~A~~vViai~d~~~---------~~~iv~~~r~~~P~l~I~a  496 (602)
T PRK03659        453 --------QLELLRAAGAEKAEAIVITCNEPED---------TMKLVELCQQHFPHLHILA  496 (602)
T ss_pred             --------CHHHHHHCCCCCCCEEEEEECCHHH---------HHHHHHHHHHHCCCCEEEE
T ss_conf             --------9999986790405889998298999---------9999999998786996999


No 308
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=45.23  E-value=22  Score=15.84  Aligned_cols=31  Identities=16%  Similarity=0.184  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEEEECCHHH
Q ss_conf             21478999999999973899839999717899
Q gi|254780767|r   13 ISGDLLAGDLIKSLKEMVSYPINLVGVGGPSL   44 (383)
Q Consensus        13 ~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m   44 (383)
                      .|.+-|+..+.+.|... ..++.+....|...
T Consensus        29 RS~~~yp~~~a~~l~~~-~~~~~~~aCsGA~~   59 (259)
T cd01823          29 RSSNSYPTLLARALGDE-TLSFTDVACSGATT   59 (259)
T ss_pred             CCCCCHHHHHHHHHCCC-CCEEEEEECCCCCC
T ss_conf             67446999999982888-75166763038622


No 309
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins. Periplasmic solute-binding domain of active transport proteins found in bacteria and Archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.
Probab=45.13  E-value=22  Score=15.83  Aligned_cols=40  Identities=15%  Similarity=0.314  Sum_probs=25.2

Q ss_pred             CCCCCEEEEECHHHHHHHHHHHHHHHC-----CCCCCEEEE--CCCC
Q ss_conf             128886898511776579999866301-----346311110--0221
Q gi|254780767|r   86 SSKPDVLLIVDNPDFTHRVAKRVRKKM-----PNLPIINYV--CPSV  125 (383)
Q Consensus        86 ~~~Pd~vi~iD~pgFnl~lak~lkk~~-----~~ipvi~yv--~Pqv  125 (383)
                      +.+.+++|+--+.+-.+.++..+.+.+     .++|++...  +|++
T Consensus        64 ~~~v~~iiG~~~S~~~~a~~~~~~~~~~~a~~~~vp~i~~~~~~~~l  110 (342)
T cd06329          64 DDGVRLVVQGNSSSVALALTEAVRKHNQRNPGKEVLYLNYASVAPAL  110 (342)
T ss_pred             HCCCCEEECCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHH
T ss_conf             76994998897858899989999985133112680699538777132


No 310
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=44.95  E-value=20  Score=16.22  Aligned_cols=36  Identities=14%  Similarity=0.279  Sum_probs=22.9

Q ss_pred             CCCCEEEEECHHHH--HHHHHHHHHHHCCCCCCEEEECCCCCCC
Q ss_conf             28886898511776--5799998663013463111100221100
Q gi|254780767|r   87 SKPDVLLIVDNPDF--THRVAKRVRKKMPNLPIINYVCPSVWAW  128 (383)
Q Consensus        87 ~~Pd~vi~iD~pgF--nl~lak~lkk~~~~ipvi~yv~PqvWAW  128 (383)
                      ..+|+||.  +||.  +-+..++++++  |||++.+  +++.||
T Consensus        66 ~~~d~vV~--Sp~I~~~~p~~~~a~~~--gi~v~~~--~e~l~~  103 (459)
T PRK00421         66 KGADVVVV--SSAIKPDNPELVAAREL--GIPVVRR--AEMLAE  103 (459)
T ss_pred             CCCCEEEE--CCCCCCCCHHHHHHHHC--CCCEEEH--HHHHHH
T ss_conf             99999998--99859989999999987--9979889--999999


No 311
>pfam07014 Hs1pro-1_C Hs1pro-1 protein C-terminus. This family represents the C-terminus (approximately 270 residues) of a number of plant Hs1pro-1 proteins, which are believed to confer nematode resistance.
Probab=44.70  E-value=23  Score=15.79  Aligned_cols=11  Identities=18%  Similarity=0.283  Sum_probs=5.2

Q ss_pred             CEEEEEECCHH
Q ss_conf             83999971789
Q gi|254780767|r   33 PINLVGVGGPS   43 (383)
Q Consensus        33 ~~~~~giGG~~   43 (383)
                      .+++..|+-|.
T Consensus        20 ~L~YD~Vc~P~   30 (261)
T pfam07014        20 NLEYDAVCRPN   30 (261)
T ss_pred             CCCCCCCCCHH
T ss_conf             54303544788


No 312
>KOG3349 consensus
Probab=44.68  E-value=23  Score=15.79  Aligned_cols=35  Identities=11%  Similarity=0.181  Sum_probs=21.5

Q ss_pred             CCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEEC
Q ss_conf             5203578876355233115668-8876275302540
Q gi|254780767|r  259 EQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSIY  293 (383)
Q Consensus       259 ~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~Y  293 (383)
                      ....+.++.||++|.-.|+-|- |.--.|.|.||+-
T Consensus        72 psl~e~I~~AdlVIsHAGaGS~letL~l~KPlivVv  107 (170)
T KOG3349          72 PSLTEDIRSADLVISHAGAGSCLETLRLGKPLIVVV  107 (170)
T ss_pred             CCHHHHHHHCCEEEECCCCCHHHHHHHCCCCEEEEE
T ss_conf             417888753458874587420999997499779992


No 313
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=44.62  E-value=23  Score=15.78  Aligned_cols=80  Identities=19%  Similarity=0.424  Sum_probs=45.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |||+|..+   +-.+|..|.+.|.    ++.++.+.....         .|+++                   ...+.+.
T Consensus         1 M~iLi~G~---~GqLG~~L~~~l~----~~~~v~a~~~~~---------~Ditd-------------------~~~v~~~   45 (281)
T COG1091           1 MKILITGA---NGQLGTELRRALP----GEFEVIATDRAE---------LDITD-------------------PDAVLEV   45 (281)
T ss_pred             CCEEEECC---CCHHHHHHHHHHC----CCCEEEECCCCC---------CCCCC-------------------HHHHHHH
T ss_conf             95899769---8767999999717----784399515765---------55568-------------------5899999


Q ss_pred             CCCCCCCEEEE------EC----HHH----HH----HHHHHHHHHHCCCCCCEEE
Q ss_conf             00128886898------51----177----65----7999986630134631111
Q gi|254780767|r   84 IVSSKPDVLLI------VD----NPD----FT----HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        84 i~~~~Pd~vi~------iD----~pg----Fn----l~lak~lkk~~~~ipvi~y  120 (383)
                      +++.+||+||=      ||    -|.    .|    ..+|+.+++.  |.++||+
T Consensus        46 i~~~~PDvVIn~AAyt~vD~aE~~~e~A~~vNa~~~~~lA~aa~~~--ga~lVhi   98 (281)
T COG1091          46 IRETRPDVVINAAAYTAVDKAESEPELAFAVNATGAENLARAAAEV--GARLVHI   98 (281)
T ss_pred             HHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH--CCEEEEE
T ss_conf             9861999899873203654133898997776779999999999971--9769996


No 314
>PRK13366 protocatechuate 4,5-dioxygenase subunit beta; Provisional
Probab=44.51  E-value=23  Score=15.77  Aligned_cols=30  Identities=20%  Similarity=0.275  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999999986100128886898511776
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      ..++..+..+.+++++.+||++|.|-.=.|
T Consensus        31 ~~~f~g~~~~r~~l~~~kPDVlViv~nDH~   60 (284)
T PRK13366         31 QPVFKGYEFSKQWLKEEKPDVIFLVYNDHA   60 (284)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             999977799999999729998999806678


No 315
>PRK11752 putative glutathione S-transferase YghU; Provisional
Probab=44.51  E-value=6.2  Score=19.50  Aligned_cols=22  Identities=23%  Similarity=0.649  Sum_probs=17.9

Q ss_pred             EEEECCCCCCCCCCCHHHHHHH
Q ss_conf             1110022110036635579999
Q gi|254780767|r  118 INYVCPSVWAWREGRARKMCAY  139 (383)
Q Consensus       118 i~yv~PqvWAWr~~R~k~~~~~  139 (383)
                      -.|++|.||.|.+.+.-++...
T Consensus         4 ~~y~~p~~w~~~~~~~~~~~~~   25 (264)
T PRK11752          4 NTYQPPKVWTWDKSNGGAFANI   25 (264)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCC
T ss_conf             7877986410137888721345


No 316
>TIGR00421 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases; InterPro: IPR004507   This family contains flavoproteins, which are aromatic acid decarboxylases. An example is the Saccharomyces cerevisiae gene, PAD1 that encodes phenylacrylic acid decarboxylase. Mutations of this gene are viable and confer resistance to cinnamic acid. ; GO: 0016831 carboxy-lyase activity.
Probab=44.12  E-value=23  Score=15.73  Aligned_cols=141  Identities=17%  Similarity=0.210  Sum_probs=74.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH----HHHCCCEEEECHHHCCEEEHH-------------H--
Q ss_conf             599997682147899999999997389983999971789----994788065044453110136-------------7--
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPS----LQKEGLVSLFDFSELSVIGIM-------------Q--   65 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~----m~~~G~~~~~~~~~l~v~G~~-------------e--   65 (383)
                      ||-+.=..+||-+||-||++.||+.   ++|..-|=-+-    |+.|-.=-..+.++|+.--+-             .  
T Consensus         1 ~ivVa~TGAsGvI~G~RLL~~Lk~~---GvE~~LviS~~A~~tiK~Etd~~~~~v~~LAT~~Y~~~D~~a~i~SGSf~~D   77 (181)
T TIGR00421         1 KIVVAITGASGVIYGIRLLEVLKEL---GVEVHLVISKWAKKTIKYETDYDPGEVEELATKYYDEDDFAAPIASGSFKFD   77 (181)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHHHC---CCEEEEEECHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHCCCCCCCC
T ss_conf             9578622244899999999999867---9368786355899999885389988999996753261121100015786768


Q ss_pred             -------HHHHHHHHH-----HHHHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCC------CCEEEECCCCC
Q ss_conf             -------466459999-----999999861001288868985-11776579999866301346------31111002211
Q gi|254780767|r   66 -------VVRHLPQFI-----FRINQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNL------PIINYVCPSVW  126 (383)
Q Consensus        66 -------vl~~~~~~~-----~~~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~i------pvi~yv~PqvW  126 (383)
                             -.|.+..|.     ..+-+.-+-..++|=++|+.. -.|==...|--.|+=...|.      |=+|=      
T Consensus        78 gm~VvPCSmKtLsaIa~G~a~NLitRAADV~LKErRkLvL~~REtPL~SiHLENmL~L~~~G~IIlPP~PaFY~------  151 (181)
T TIGR00421        78 GMVVVPCSMKTLSAIANGYAENLITRAADVALKERRKLVLVPRETPLNSIHLENMLRLSRMGAIILPPVPAFYN------  151 (181)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHCCCEEECCCCCCCC------
T ss_conf             26886485678999985110556888975542205424640367887515489999998279253279554447------


Q ss_pred             CCCCCCHHHHH-HHHHHHCCCCCCCHHHHHC
Q ss_conf             00366355799-9998640156774223200
Q gi|254780767|r  127 AWREGRARKMC-AYINQVISILPFEKEVMQR  156 (383)
Q Consensus       127 AWr~~R~k~~~-~~~d~~~~ifpFE~~~f~k  156 (383)
                        |++.+..+. ..+-+++=+|=-|.+.|+|
T Consensus       152 --rPkS~~Dl~~~~VgR~LD~lGI~~d~f~R  180 (181)
T TIGR00421       152 --RPKSVEDLIDFIVGRVLDQLGIENDLFRR  180 (181)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             --89887889867798777762443788889


No 317
>TIGR00863 P2X cation transporter protein; InterPro: IPR001429   P2X purinoceptors are cell membrane ion channels, gated by adenosine 5'-triphosphate (ATP) and other nucleotides; they have been found to be widely expressed on mammalian cells, and, by means of their functional properties, can be differentiated into three sub-groups. The first group is almost equally well activated by ATP and its analogue alphabetamethyleneATP, whereas, the second group is not activated by the latter compound. A third type of receptor (also called P2Z) is distinguished by the fact that repeated or prolonged agonist application leads to the opening of much larger pores, allowing large molecules to traverse the cell membrane. This increased permeability rapidly leads to cell death, and lysis.   Molecular cloning studies have identified seven P2X receptor subtypes, designated P2X1-P2X7. These receptors are proteins that share 35-48% amino acid identity, and possess two putative transmembrane (TM) domains, separated by a long (~270 residues) intervening sequence, which is thought to form an extracellular loop. Around 1/4 of the residues within the loop are invariant between the cloned subtypes, including 10 characteristic cysteines.   Studies of the functional properties of heterologously expressed P2X receptors, together with the examination of their distribution in native tissues, suggests they likely occur as both homo- and heteromultimers in vivo , .   This entry represents all P2X purinoreceptor subtypes.; GO: 0004872 receptor activity, 0005216 ion channel activity, 0005524 ATP binding, 0006811 ion transport, 0016020 membrane.
Probab=44.11  E-value=3.5  Score=21.19  Aligned_cols=18  Identities=11%  Similarity=0.433  Sum_probs=11.3

Q ss_pred             HHHHHHHCCCCCEEEEEC
Q ss_conf             999996048885055205
Q gi|254780767|r  241 VRCIVSKWDISPEIIIDK  258 (383)
Q Consensus       241 ~~~~~~~~~~~~~i~~~~  258 (383)
                      .+..++.+++..+|++..
T Consensus       313 ~RtL~KaYGIRFDvlV~G  330 (377)
T TIGR00863       313 TRTLLKAYGIRFDVLVTG  330 (377)
T ss_pred             EEEEEEECCEEEEEEEEC
T ss_conf             124555404067688507


No 318
>PRK13933 stationary phase survival protein SurE; Provisional
Probab=43.37  E-value=16  Score=16.85  Aligned_cols=36  Identities=14%  Similarity=0.227  Sum_probs=15.2

Q ss_pred             HCCCCCCCEEEEECHHHHHH--------HHHHHHHHHCCCCCCE
Q ss_conf             10012888689851177657--------9999866301346311
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTH--------RVAKRVRKKMPNLPII  118 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl--------~lak~lkk~~~~ipvi  118 (383)
                      .+...+||+||-==..|.|+        -++..+-....|||=|
T Consensus        82 ~l~~~~pDLVvSGIN~G~NlG~dv~ySGTVgAA~Ea~l~GiPsI  125 (253)
T PRK13933         82 KLLPDNIDMVISGINKGLNIGNDILYSGTVSAAIEGAIYKVPSI  125 (253)
T ss_pred             HHCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEE
T ss_conf             21589999999788177478838230678899999987499828


No 319
>COG0052 RpsB Ribosomal protein S2 [Translation, ribosomal structure and biogenesis]
Probab=43.25  E-value=24  Score=15.64  Aligned_cols=38  Identities=21%  Similarity=0.354  Sum_probs=24.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCC
Q ss_conf             88850552055203578876355233115668887627530254057741
Q gi|254780767|r  249 DISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWI  298 (383)
Q Consensus       249 ~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~l  298 (383)
                      +..+++++..+..++..+            -.|+..+|+|.|-+-.|+--
T Consensus       154 ~~~Pd~l~ViDp~~e~iA------------v~EA~klgIPVvAlvDTn~d  191 (252)
T COG0052         154 KGLPDVLFVIDPRKEKIA------------VKEANKLGIPVVALVDTNCD  191 (252)
T ss_pred             CCCCCEEEEECCCHHHHH------------HHHHHHCCCCEEEEECCCCC
T ss_conf             679998999688176899------------99999759998998418999


No 320
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed
Probab=42.86  E-value=24  Score=15.60  Aligned_cols=77  Identities=22%  Similarity=0.231  Sum_probs=46.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999768214789999999999738998399997178999478806504445311013674664599999999998610
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELI   84 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i   84 (383)
                      =+++++|..|.-++..++-++.+++ +-++++..+|....+..--..-|   |+-.+|        |..+..++++.+..
T Consensus         4 ILLvCaaGMSTSmlv~km~~~A~~~-G~dveI~Av~~~e~~~~i~~~~y---Dv~Llg--------PQVr~~~~~~k~~a   71 (104)
T PRK09590          4 ALIICAAGMSSSLMAKKTTEFLKGK-GKDIEVDAISATEGGKAIAAAAF---DLYLVS--------PQTKMYFKQFEEAG   71 (104)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHC-CCCEEEEEEEHHHHHHHHCCCCC---CEEEEC--------HHHHHHHHHHHHHH
T ss_conf             9999689987999999999999976-98369998488898876322688---789988--------76887899999999


Q ss_pred             CC-CCCCEEE
Q ss_conf             01-2888689
Q gi|254780767|r   85 VS-SKPDVLL   93 (383)
Q Consensus        85 ~~-~~Pd~vi   93 (383)
                      .+ .+|=.+|
T Consensus        72 ~~~giPv~vI   81 (104)
T PRK09590         72 SKAGKPVVQI   81 (104)
T ss_pred             HHCCCCEEEE
T ss_conf             8729977887


No 321
>PRK05693 short chain dehydrogenase; Provisional
Probab=42.84  E-value=24  Score=15.60  Aligned_cols=32  Identities=19%  Similarity=0.340  Sum_probs=25.1

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             4599997682147899999999997389983999971
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      ||+.+++|-.||  .|-.+.++|.++   +.++++.+
T Consensus         1 MKvvlITGassG--IG~alA~~la~~---G~~V~~~~   32 (274)
T PRK05693          1 MPVVLITGCSSG--IGRALADAFKAA---GYEVWATA   32 (274)
T ss_pred             CCEEEECCCCCH--HHHHHHHHHHHC---CCEEEEEE
T ss_conf             998999488858--999999999987---99999997


No 322
>PRK13935 stationary phase survival protein SurE; Provisional
Probab=42.75  E-value=14  Score=17.08  Aligned_cols=39  Identities=21%  Similarity=0.328  Sum_probs=18.7

Q ss_pred             HHCCCCCCCEEEEECHHHHHH--------HHHHHHHHHCCCCCCEEE
Q ss_conf             610012888689851177657--------999986630134631111
Q gi|254780767|r   82 ELIVSSKPDVLLIVDNPDFTH--------RVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~pgFnl--------~lak~lkk~~~~ipvi~y  120 (383)
                      +.+...+||+||-==..|.|+        -++..+-....|||=|=+
T Consensus        80 ~~l~~~~pDLVvSGIN~G~NlG~dv~YSGTVgAA~Eg~l~GipsIAv  126 (255)
T PRK13935         80 DVIMKKKPDLVISGINRGPNLGTDVLYSGTVSGALEGAIAGVPSIAI  126 (255)
T ss_pred             HHHCCCCCCEEEECCCCCCCCCCCEEECCHHHHHHHHHHCCCCEEEE
T ss_conf             64058999889968748877771377200367789897549986999


No 323
>pfam02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase. This is a family of 1-deoxy-D-xylulose 5-phosphate reductoisomerases. This enzyme catalyses the formation of 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose-5-phosphate in the presence of NADPH. This reaction is part of the terpenoid biosynthesis pathway.
Probab=42.56  E-value=23  Score=15.72  Aligned_cols=44  Identities=11%  Similarity=0.129  Sum_probs=18.5

Q ss_pred             HHHHHHHCCCCCEEEEECCCCHHHHHH--HHHHHC-CCHHHHHHHHH
Q ss_conf             999996048885055205520357887--635523-31156688876
Q gi|254780767|r  241 VRCIVSKWDISPEIIIDKEQKKQVFMT--CNAAMA-ASGTVILELAL  284 (383)
Q Consensus       241 ~~~~~~~~~~~~~i~~~~~~~~~~l~~--sd~ai~-~SGTaTLE~al  284 (383)
                      .+..+.....+.++....+...++.+.  +|.+++ .||++-|+.++
T Consensus        62 l~~~~~~~~~~~~i~~g~~~l~~~~~~~~~D~vi~AIsG~aGL~pt~  108 (129)
T pfam02670        62 LKEALAGAGLKTEVLAGEEGLCELAALPEADIVVNAIVGAAGLLPTL  108 (129)
T ss_pred             HHHHCCCCCCCCEEEECHHHHHHHHCCCCCCEEEEECCCCCHHHHHH
T ss_conf             99863247887379878899999970778899998156501399999


No 324
>PRK13529 malate dehydrogenase; Provisional
Probab=42.53  E-value=23  Score=15.82  Aligned_cols=26  Identities=23%  Similarity=0.484  Sum_probs=12.5

Q ss_pred             CCCCCCCCCCHH------HHHHHHHHHCCCCC
Q ss_conf             221100366355------79999986401567
Q gi|254780767|r  123 PSVWAWREGRAR------KMCAYINQVISILP  148 (383)
Q Consensus       123 PqvWAWr~~R~k------~~~~~~d~~~~ifp  148 (383)
                      |..--||+.|++      .+.+++..+...||
T Consensus       208 PlYlG~r~~R~~g~~Y~~fidefv~av~~~fP  239 (563)
T PRK13529        208 PLYLGWRHPRITGEEYDEFVDEFVQAVKRRFP  239 (563)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             63357678888768899999999999999789


No 325
>PRK10949 protease 4; Provisional
Probab=42.53  E-value=25  Score=15.57  Aligned_cols=20  Identities=15%  Similarity=0.418  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEEE
Q ss_conf             999999999738998399997
Q gi|254780767|r   19 AGDLIKSLKEMVSYPINLVGV   39 (383)
Q Consensus        19 ~a~li~~Lk~~~~~~~~~~gi   39 (383)
                      -..++++|++... |=++.|+
T Consensus        97 L~Div~aI~~Aa~-D~rI~gi  116 (618)
T PRK10949         97 LFDIVNTIRQAKD-DRNITGI  116 (618)
T ss_pred             HHHHHHHHHHHCC-CCCEEEE
T ss_conf             9999999998514-9982599


No 326
>TIGR03190 benz_CoA_bzdN benzoyl-CoA reductase, bzd-type, N subunit. Members of this family are the N subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=42.33  E-value=25  Score=15.55  Aligned_cols=38  Identities=13%  Similarity=0.113  Sum_probs=23.3

Q ss_pred             CCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC-CCC
Q ss_conf             88868985117765799998663013463111100-221
Q gi|254780767|r   88 KPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC-PSV  125 (383)
Q Consensus        88 ~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~-Pqv  125 (383)
                      --|.||+.+.-|---++...++...++++-.||+. ||-
T Consensus        88 ~~d~vv~~~tCD~kkkm~e~~~~~~p~~~~~~~~~lP~~  126 (377)
T TIGR03190        88 YAEGVTLTQSCIQYRQTFGSWRQHVPTVKWDYYVPMPNE  126 (377)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             211455137977889999999974787661168718997


No 327
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=41.89  E-value=25  Score=15.51  Aligned_cols=93  Identities=18%  Similarity=0.292  Sum_probs=39.3

Q ss_pred             HHHHHHHHC--CCHHHHH-HHHHHCCCEEEECCCCCCEEE----EEECCCCCCEEEEHHH---CCCCCC--------CHH
Q ss_conf             887635523--3115668-887627530254057741000----0102467610230244---078426--------124
Q gi|254780767|r  265 FMTCNAAMA--ASGTVIL-ELALCGIPVVSIYKSEWIVNF----FIFYIKTWTCALPNLI---VDYPLV--------PEY  326 (383)
Q Consensus       265 l~~sd~ai~--~SGTaTL-E~al~g~P~IV~Yk~~~lt~~----i~~lik~~~i~LpNii---~~~~iv--------PEl  326 (383)
                      |+.+-+++.  +.=||.| .+.-.+.|.|++ =|+|-|.-    +..+=.+ .++=|.-+   +|.+|+        ||=
T Consensus       171 MQEg~lSLMQMaktsaAl~~l~ea~lpyIsV-Lt~PTtGGVsASfA~lGDi-~iAEP~AlIGFAGpRVIEQTire~LPeg  248 (294)
T COG0777         171 MQEGILSLMQMAKTSAALKRLSEAGLPYISV-LTDPTTGGVSASFAMLGDI-IIAEPGALIGFAGPRVIEQTIREKLPEG  248 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE-ECCCCCCCHHHHHHHCCCE-EECCCCCCCCCCCCHHHHHHHCCCCCCC
T ss_conf             7688999999999999999998759966999-5589866646767752674-6517630001576324465644316862


Q ss_pred             HCCCCCHHHHHHH--HHHHHCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             2054898999999--999844989999999999999998389
Q gi|254780767|r  327 FNSMIRSEALVRW--IERLSQDTLQRRAMLHGFENLWDRMNT  366 (383)
Q Consensus       327 iQ~~~~~~~i~~~--~~~ll~d~~~r~~~~~~~~~~~~~Lg~  366 (383)
                      +|   ++|.+.+.  ++.+..    |.++...+..+...+..
T Consensus       249 fQ---~aEfLlehG~iD~iv~----R~elr~tla~ll~~~~~  283 (294)
T COG0777         249 FQ---TAEFLLEHGMIDMIVH----RDELRTTLASLLAKLTP  283 (294)
T ss_pred             HH---HHHHHHHCCCCCEEEC----HHHHHHHHHHHHHHHCC
T ss_conf             34---6899997587305633----58899999999997378


No 328
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF). This group includes the periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF), found in Methylophilus methylotrophus, and its homologs from other bacteria. FmdD, a type I periplasmic binding protein, is induced by short-chain amides and urea and repressed by excess ammonia, while FmdE and FmdF are hydrophobic transmembrane proteins. FmdDEF is predicted to be an ATP-dependent transporter and closely resembles the periplasmic binding protein and the two transmembrane proteins present in various hydrophobic amino acid-binding transport systems.
Probab=41.81  E-value=25  Score=15.50  Aligned_cols=22  Identities=23%  Similarity=0.236  Sum_probs=10.7

Q ss_pred             CHHHHHHHHHHCCCCCEEEECC
Q ss_conf             1189998764027351262016
Q gi|254780767|r  212 FFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       212 ~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      -|-..+.++...+|+..|....
T Consensus       176 Dfs~~l~ki~~a~pD~v~~~~~  197 (348)
T cd06355         176 DFQSIINKIKAAKPDVVVSTVN  197 (348)
T ss_pred             CHHHHHHHHHHCCCCEEEEECC
T ss_conf             6799999999769999999476


No 329
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional
Probab=41.74  E-value=12  Score=17.68  Aligned_cols=38  Identities=21%  Similarity=0.409  Sum_probs=24.2

Q ss_pred             HHCCCCCCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCEEE
Q ss_conf             6100128886898-5117765-7999986630134631111
Q gi|254780767|r   82 ELIVSSKPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPIINY  120 (383)
Q Consensus        82 ~~i~~~~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi~y  120 (383)
                      ..+..++||++|+ +.-||.+ +.+++++|+. ..+|+|..
T Consensus        39 ~~~~~~~~DlviLDi~lP~~dG~~l~~~iR~~-~~~pII~l   78 (225)
T PRK10529         39 LEAATRKPDLIILDLGLPDGDGIEFIRDLRQW-SAIPVIVL   78 (225)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCEEEEECC-CCCCEEEE
T ss_conf             98611799899980788888876331000127-99878999


No 330
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=41.50  E-value=25  Score=15.47  Aligned_cols=24  Identities=21%  Similarity=0.286  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             4789999999999738998399997178
Q gi|254780767|r   15 GDLLAGDLIKSLKEMVSYPINLVGVGGP   42 (383)
Q Consensus        15 GD~~~a~li~~Lk~~~~~~~~~~giGG~   42 (383)
                      |-.+.+.+.|.|    +.++-=.|++|.
T Consensus        19 ~~a~~~~l~r~l----g~~viNlG~sG~   42 (177)
T cd01844          19 GMAWTAILARRL----GLEVINLGFSGN   42 (177)
T ss_pred             CCCHHHHHHHHC----CCCEEECCCCCC
T ss_conf             441699999854----997771466754


No 331
>pfam11633 Nsp3 Replicase polyprotein 1ab. This family of proteins represents Nsp3, the product of ORF1a in group 2 coronavirus.This is the largest replicase subunit.
Probab=41.30  E-value=26  Score=15.45  Aligned_cols=32  Identities=19%  Similarity=0.228  Sum_probs=22.8

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHC
Q ss_conf             999986100128886898511776579999866301
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKM  112 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~  112 (383)
                      ++.++++.++..--+.|++|||.|    .|-||+++
T Consensus        25 ~r~mv~hake~g~l~pIc~Dy~A~----~k~Lkrkg   56 (142)
T pfam11633        25 FRAMVRHAKETGLLCPICIDYPAF----MKVLKRKG   56 (142)
T ss_pred             HHHHHHHHHHCCCEEEEEECCHHH----HHHHHHCC
T ss_conf             899998666328355799652889----99998548


No 332
>TIGR00087 surE 5'/3'-nucleotidase SurE; InterPro: IPR002828   This entry represents a SurE-like structural domain with a 3-layer alpha/bete/alpha topology that bears some topological similarity to the N-terminal domain of the glutaminase/asparaginase family. This domain is found in the stationary phase survival protein SurE, a metal ion-dependent phosphatase found in eubacteria, archaea and eukaryotes. In Escherichia coli, SurE also has activity as a nucleotidase and exopolyphosphatase, and may be involved in the stress response . E. coli cells with mutations in the surE gene survive poorly in stationary phase . The structure of SurE homologues have been determined from Thermotoga maritima  and the archaea Pyrobaculum aerophilum . The T. maritima SurE homologue has phosphatase activity that is inhibited by vanadate or tungstate, both of which bind adjacent to the divalent metal ion.    This domain is found in acid phosphatases (3.1.3.2 from EC), 5'-nucleotidases (3.1.3.5 from EC), 3'-nucleotidases (3.1.3.6 from EC) and exopolyphosphatases (3.6.1.11 from EC).; GO: 0016787 hydrolase activity.
Probab=41.23  E-value=16  Score=16.88  Aligned_cols=93  Identities=17%  Similarity=0.271  Sum_probs=49.2

Q ss_pred             EEEEECCCCCCHHHHC---CCHHHHHHHHHHCCCCCEEEECCCCCH--HHHHHHHHHHC--CCCCEEEEECCCCHHHHHH
Q ss_conf             5998538743012305---111899987640273512620166336--88999999604--8885055205520357887
Q gi|254780767|r  195 ILLLPGSRAQEIYKIL---PFFESAVASLVKRNPFFRFSLVTVSSQ--ENLVRCIVSKW--DISPEIIIDKEQKKQVFMT  267 (383)
Q Consensus       195 I~llPGSR~~EI~~~l---P~~l~~~~~l~~~~~~~~~~i~~~~~~--~~~~~~~~~~~--~~~~~i~~~~~~~~~~l~~  267 (383)
                      +.|.-+=|..+++-.-   |..+.+  ++.+.. .-.+.+-.+|.-  .--+...+.+.  .+.+++++..-+.-.=|..
T Consensus        72 ~Tl~~p~r~~~~~~~~~~~~~vLna--ei~~~~-~~~~~~dGTP~DcV~lG~~~~~~~~~nnitpDLV~SGiN~G~NlG~  148 (326)
T TIGR00087        72 LTLFEPIRVEQVKVENGKLGYVLNA--EIDKDD-IHIYAVDGTPTDCVILGIHELMPEVHNNITPDLVISGINLGENLGA  148 (326)
T ss_pred             CCHHHCCEEEEEECCCCCCCEEEEC--CCCCCC-CEEEEEECCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCH
T ss_conf             2520111221431368888703314--388774-3589971886899999999870431234453258806668886773


Q ss_pred             HHHHHCCCHHHHH--HHHHHC-CCEEEE
Q ss_conf             6355233115668--887627-530254
Q gi|254780767|r  268 CNAAMAASGTVIL--ELALCG-IPVVSI  292 (383)
Q Consensus       268 sd~ai~~SGTaTL--E~al~g-~P~IV~  292 (383)
                        ..++.|||+.-  |++..| +|.|-+
T Consensus       149 --~~~~~SGTvgAA~E~~~~Gn~paIA~  174 (326)
T TIGR00087       149 --EDVTYSGTVGAAMEAAIHGNVPAIAI  174 (326)
T ss_pred             --HHHHHCCHHHHHHHHHHHCCCCCEEE
T ss_conf             --33310253899888665178640464


No 333
>pfam04227 Indigoidine_A Indigoidine synthase A like protein. Indigoidine is a blue pigment synthesized by Erwinia chrysanthemi implicated in pathogenicity and protection from oxidative stress. IdgA is involved in indigoidine biosynthesis, but its specific function is unknown.
Probab=40.67  E-value=22  Score=15.84  Aligned_cols=48  Identities=21%  Similarity=0.203  Sum_probs=34.0

Q ss_pred             HHHHHHHHHHHCCCH-------HHHHHHH-HHCCCEEEECCCCCCEEEEEE--CCCCCC
Q ss_conf             357887635523311-------5668887-627530254057741000010--246761
Q gi|254780767|r  262 KQVFMTCNAAMAASG-------TVILELA-LCGIPVVSIYKSEWIVNFFIF--YIKTWT  310 (383)
Q Consensus       262 ~~~l~~sd~ai~~SG-------TaTLE~a-l~g~P~IV~Yk~~~lt~~i~~--lik~~~  310 (383)
                      ...|+....+++|||       -.|||.. -+|+| |+.|+++-+-.|+.+  -+++++
T Consensus       136 L~eL~~tpv~VVcaG~KsILDi~~TlE~LET~GV~-V~gy~td~fPaFy~~~Sg~~~~~  193 (293)
T pfam04227       136 LTELARTPVAVVCAGAKSILDIPKTLEYLETQGVP-VIGYGTDEFPAFYSRDSGFKVPY  193 (293)
T ss_pred             HHHHHCCCEEEEECCCHHHHCCHHHHHHHHHCCCE-EEEECCCCCCCEEECCCCCCCCC
T ss_conf             78881597599942607650544689999975943-89745876564230588998866


No 334
>PRK09814 hypothetical protein; Provisional
Probab=40.62  E-value=26  Score=15.38  Aligned_cols=109  Identities=13%  Similarity=0.230  Sum_probs=59.3

Q ss_pred             HHCCCCCCCEEEEECHH-----HHHHHHHHHHHHHCCCCCCEEEEC---CCCCC----CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             61001288868985117-----765799998663013463111100---22110----0366355799999864015677
Q gi|254780767|r   82 ELIVSSKPDVLLIVDNP-----DFTHRVAKRVRKKMPNLPIINYVC---PSVWA----WREGRARKMCAYINQVISILPF  149 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~p-----gFnl~lak~lkk~~~~ipvi~yv~---PqvWA----Wr~~R~k~~~~~~d~~~~ifpF  149 (383)
                      ..+..-+..-+|++-||     .|...+.+++|++  +++++-+|-   |==..    +-..+-..+-..+|.+++-=+.
T Consensus        57 ~i~~~l~~gDivi~QyP~~~~~~~~~~l~~~lk~~--~~K~i~~IHDie~LR~~~~~~~~~~~ei~~ln~aD~iIvhn~~  134 (337)
T PRK09814         57 GILASLNRGDIVVFQYPTYNGFEFDLLFIDKLKKK--QIKIIILIHDIEPLRFGKSNYYLMKEEIDMLNLSDVVIVHNKK  134 (337)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHC--CCEEEEEECCCHHHHCCCCCHHHHHHHHHHHHHCCEEEECCHH
T ss_conf             99957799999999789870788999999999975--9879999776589865677703679999998528999979999


Q ss_pred             CHHHHHCCCCCCE-EECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCC
Q ss_conf             4223200255314-7638821122100135588897618765565059985387
Q gi|254780767|r  150 EKEVMQRLGGPPT-TFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSR  202 (383)
Q Consensus       150 E~~~f~k~~~~~~-~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR  202 (383)
                      -.+|+.+ +|+++ ..|-=.+.|........         .++...-..+.|+=
T Consensus       135 M~~~L~~-~G~~~~kiv~l~ifDYl~~~~~~---------~~~~~k~I~fAGNL  178 (337)
T PRK09814        135 MTDWLVE-EGVTVDKIIDQEIFDYLVDIDLE---------TPSFQKKIIFAGNL  178 (337)
T ss_pred             HHHHHHH-CCCCCCCEEEECCCCCCCCCCCC---------CCCCCCEEEEECCH
T ss_conf             9999997-79986864785787758875556---------65677439981672


No 335
>PRK06182 short chain dehydrogenase; Validated
Probab=40.52  E-value=26  Score=15.37  Aligned_cols=34  Identities=24%  Similarity=0.426  Sum_probs=25.6

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9874599997682147899999999997389983999971
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG   40 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG   40 (383)
                      |++ |+.+++|-.||  .|..+.+.|-++   +..+++.+
T Consensus         1 mk~-Kv~lITGassG--IG~a~a~~la~~---G~~V~~~~   34 (273)
T PRK06182          1 MKK-KVALVTGASSG--IGKATARKLIAE---GFTVYGAA   34 (273)
T ss_pred             CCC-CEEEEECCCHH--HHHHHHHHHHHC---CCEEEEEE
T ss_conf             946-98999063209--999999999987---99899997


No 336
>PRK13934 stationary phase survival protein SurE; Provisional
Probab=40.33  E-value=18  Score=16.38  Aligned_cols=34  Identities=15%  Similarity=0.161  Sum_probs=15.4

Q ss_pred             CCCCCEEEEECHHHHHH---------HHHHHHHHHCCCCCCEE
Q ss_conf             12888689851177657---------99998663013463111
Q gi|254780767|r   86 SSKPDVLLIVDNPDFTH---------RVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        86 ~~~Pd~vi~iD~pgFnl---------~lak~lkk~~~~ipvi~  119 (383)
                      ..+||+||-==.-|.|+         -++..+-....|||=|=
T Consensus        82 ~~~PDLVvSGIN~G~NlG~dvi~ySGTV~AA~Eg~~~GiPsIA  124 (266)
T PRK13934         82 GRKYDLVLSGINLGDNTSLQVILSSGTLGAAFQAALLGIPAVA  124 (266)
T ss_pred             CCCCCEEEECCCCCCCCCCCCEECCHHHHHHHHHHHCCCCEEE
T ss_conf             7898889967757886672401514588999999856998599


No 337
>KOG3946 consensus
Probab=40.30  E-value=13  Score=17.38  Aligned_cols=12  Identities=0%  Similarity=0.335  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             579999986401
Q gi|254780767|r  134 RKMCAYINQVIS  145 (383)
Q Consensus       134 k~~~~~~d~~~~  145 (383)
                      ..+++..|+.+|
T Consensus       150 l~laq~l~~~~~  161 (338)
T KOG3946         150 LNLAQALDKILC  161 (338)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999874


No 338
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CbiT subunit of precorrin-6Y C5,15-methyltransferase (2.1.1.132 from EC) from the anaerobic pathway, a bifunctional enzyme that catalyses two methylations (at C-5 and C-15) in precorrin-6Y, as well as the decarboxylation of the acetate side chain located in ring C, in order to generate precorrin-8X. In the anaerobic pathway, two enzymes are required to produce precorrin-8X: CbiE and CbiT, which can be fused as CbiET (sometimes called CobL) . In the aerobic pathway, the bifunctional enzyme is CobL .; GO: 0008276 protein methyltransferase activity, 0009236 cobalamin biosynthetic process.
Probab=40.22  E-value=13  Score=17.30  Aligned_cols=69  Identities=22%  Similarity=0.146  Sum_probs=30.3

Q ss_pred             CCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECC--CCCCE-EEEHH-HCCCCCCCHHHCCCCCHH-HHHHHHHH
Q ss_conf             3311566888762753025405774100001024--67610-23024-407842612420548989-99999999
Q gi|254780767|r  273 AASGTVILELALCGIPVVSIYKSEWIVNFFIFYI--KTWTC-ALPNL-IVDYPLVPEYFNSMIRSE-ALVRWIER  342 (383)
Q Consensus       273 ~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~li--k~~~i-~LpNi-i~~~~ivPEliQ~~~~~~-~i~~~~~~  342 (383)
                      +.|||+|+|+|.+-=+..-+|-.--=-..+ .++  +.... ...|+ |...++.|+++..++.++ ....+.+.
T Consensus        29 aGtGS~~iE~~~~~p~~g~v~aiEr~~~~~-~~~~~N~~~~c~~~~~~i~~g~ap~~~~~~~~~~~~~~~~~~Da  102 (135)
T TIGR02469        29 AGTGSVTIEAARLVPNSGRVYAIERNPEAL-RLIERNLRRFCGVSNIVIVEGDAPEELLNSDAPEDSAKLPEPDA  102 (135)
T ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECCHHHH-HHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCHHHCCCCCCCE
T ss_conf             574838999997359860799985376898-79999999828999632563556843336777710058874688


No 339
>cd07369 PydA_Rs_like PydA is a Class III Extradiol ring-cleavage dioxygenase required for the degradation of 3-hydroxy-4-pyridone (HP). This subfamily is composed of Rhizobium sp. PydA and similar proteins. PydA is required for the degradation of 3-hydroxy-4-pyridone (HP), an intermediate in the Leucaena toxin mimosine degradation pathway. It is a member of the class III extradiol dioxygenase family, a group of enzymes that use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Probab=40.13  E-value=27  Score=15.33  Aligned_cols=31  Identities=13%  Similarity=0.194  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHH
Q ss_conf             9999999999861001288868985117765
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFT  101 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFn  101 (383)
                      ..+...+..+.+++++.+||++|.|-.=.||
T Consensus        29 ~~v~~a~~~~r~~l~~~~PDvvVi~~~DH~~   59 (329)
T cd07369          29 ARTEEATLKLGRTLTAARPDVIIAFLDDHFE   59 (329)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             9999999999999997199989998644776


No 340
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=40.09  E-value=27  Score=15.33  Aligned_cols=48  Identities=25%  Similarity=0.448  Sum_probs=31.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC--CHHHHH-CCCEEE----ECHHH
Q ss_conf             4599997682147899999999997389983999971--789994-788065----04445
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG--GPSLQK-EGLVSL----FDFSE   57 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG--G~~m~~-~G~~~~----~~~~~   57 (383)
                      |||-|++  +||-. |+++.++.+++   +.+..++-  -.+|.+ .|+..+    ||.+.
T Consensus         1 mKIaiIg--AsG~~-Gs~i~~EA~~R---GHeVTAivRn~~K~~~~~~~~i~q~Difd~~~   55 (211)
T COG2910           1 MKIAIIG--ASGKA-GSRILKEALKR---GHEVTAIVRNASKLAARQGVTILQKDIFDLTS   55 (211)
T ss_pred             CEEEEEE--CCCHH-HHHHHHHHHHC---CCEEEEEEECHHHCCCCCCCEEECCCCCCHHH
T ss_conf             9078995--37456-79999999867---98048998076766522353020002227456


No 341
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=39.74  E-value=27  Score=15.29  Aligned_cols=33  Identities=18%  Similarity=0.206  Sum_probs=20.7

Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             899987640273512620166336889999996
Q gi|254780767|r  214 ESAVASLVKRNPFFRFSLVTVSSQENLVRCIVS  246 (383)
Q Consensus       214 l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~  246 (383)
                      +++.+.+.+.+|+.++++.+.......+...+.
T Consensus        62 ~e~~~~l~~~~p~~~vvvlt~~~~~~~v~~~l~   94 (211)
T COG2197          62 LEALKQLRARGPDIKVVVLTAHDDPAYVIRALR   94 (211)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHH
T ss_conf             999999998689972999967789899999997


No 342
>PRK06395 phosphoribosylamine--glycine ligase; Provisional
Probab=39.66  E-value=27  Score=15.29  Aligned_cols=88  Identities=15%  Similarity=0.325  Sum_probs=47.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC--CHHHHHCCCEEE-ECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             74599997682147899999999997389983999971--789994788065-044453110136746645999999999
Q gi|254780767|r    3 SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVG--GPSLQKEGLVSL-FDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         3 ~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG--G~~m~~~G~~~~-~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      +|||+|+....--+.    |..+|++ .+ ...+...|  ++.|...+-+.. .+.+                   -+..
T Consensus         2 ~MkVLViGsGGREHA----la~kl~~-s~-~~~~~~~g~gn~g~~~~~~~~~~~~~~-------------------d~~~   56 (435)
T PRK06395          2 TMKVMLVGSGGREDA----IARAIKR-SG-AILFSVIGHENPSIKKLSKKYLFYDEK-------------------DYDL   56 (435)
T ss_pred             CCEEEEECCCHHHHH----HHHHHHC-CC-CCEEEEECCCCHHHHHHCCCCCCCCCC-------------------CHHH
T ss_conf             877999887889999----9999855-98-844999899967877623234656856-------------------9999


Q ss_pred             HHHHCCCCCCCEEEE-ECHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             986100128886898-511776579999866301346311
Q gi|254780767|r   80 TVELIVSSKPDVLLI-VDNPDFTHRVAKRVRKKMPNLPII  118 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~-iD~pgFnl~lak~lkk~~~~ipvi  118 (383)
                      +.++++++++|+||. -..| .-.-++-.+++.  |+|++
T Consensus        57 i~~~a~~~~idLvvvGPE~p-L~~Gi~D~l~~~--gi~vF   93 (435)
T PRK06395         57 IEDFALKNNVDIVFVGPDPV-LATPLVNNLLKR--GIKVA   93 (435)
T ss_pred             HHHHHHHCCCCEEEECCCHH-HHCCHHHHHHHC--CCCEE
T ss_conf             99999984999999897678-866145599768--99466


No 343
>pfam02075 RuvC Crossover junction endodeoxyribonuclease RuvC.
Probab=39.58  E-value=27  Score=15.28  Aligned_cols=75  Identities=12%  Similarity=0.240  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH--HHHHHHHH---------HHHCCCCCCEEEECCCCCCC--CCCCHH--H
Q ss_conf             999999999986100128886898511776--57999986---------63013463111100221100--366355--7
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF--THRVAKRV---------RKKMPNLPIINYVCPSVWAW--REGRAR--K  135 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF--nl~lak~l---------kk~~~~ipvi~yv~PqvWAW--r~~R~k--~  135 (383)
                      -++.....++.+.|.+++||.+..= .+=|  |.+-|-++         -....++|+..|-+-||+-.  +.||+.  .
T Consensus        40 ~RL~~I~~~l~~ii~~~~P~~~aiE-~~F~~~N~~ta~~lgqaRGvill~~~~~~i~v~ey~P~~VKk~itG~G~A~KeQ  118 (148)
T pfam02075        40 ERLLAIFDAVEEVLDTHQPNAVAIE-QVFFAKNVDSALKLAQARGVAILAAAERGISVFEYTPSQVKKAVTGNGSADKRQ  118 (148)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEHH-HHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCHHH
T ss_conf             9999999999999996499867475-877712869999999999999999998079805788899888873798587999


Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999864015
Q gi|254780767|r  136 MCAYINQVISI  146 (383)
Q Consensus       136 ~~~~~d~~~~i  146 (383)
                      +...+..++-+
T Consensus       119 V~~mV~~ll~l  129 (148)
T pfam02075       119 VQHMVKRLLNL  129 (148)
T ss_pred             HHHHHHHHHCC
T ss_conf             99999998098


No 344
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR).  Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.
Probab=39.49  E-value=27  Score=15.27  Aligned_cols=152  Identities=16%  Similarity=0.284  Sum_probs=82.9

Q ss_pred             HHHHHHCCCCCCCEEEEE-----------CHHHHHHHHHHHHHHHCCCCCCEEEECCCC-CCCCCCCHHHHHHHHHHHCC
Q ss_conf             999861001288868985-----------117765799998663013463111100221-10036635579999986401
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIV-----------DNPDFTHRVAKRVRKKMPNLPIINYVCPSV-WAWREGRARKMCAYINQVIS  145 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~i-----------D~pgFnl~lak~lkk~~~~ipvi~yv~Pqv-WAWr~~R~k~~~~~~d~~~~  145 (383)
                      ++++..+++.+|+.+|++           |--    ++|+++.++ +++||+-|-++-+ -+--++    -....+.|+.
T Consensus        76 ~r~v~~i~~~r~p~~iFlvgtCpseVIk~DLe----~~A~rls~~-~~v~Vv~vs~sGiettFTQG----EDa~LaAlvp  146 (396)
T cd01979          76 DRVVTQIKRDRNPSVIFLIGSCTTEVIKMDLE----GAAPRLSAE-IGVPILVASASGLDYTFTQG----EDTVLAALVP  146 (396)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH----HHHHHHHHC-CCCEEEEEECCCCCCCHHHH----HHHHHHHHHH
T ss_conf             99999999748994799972585777752499----998875326-79559995268754757679----9999999986


Q ss_pred             CCCCCHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHH---------HCCCHHHH
Q ss_conf             567742232002553147638821122100135588897618765565059985387430123---------05111899
Q gi|254780767|r  146 ILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYK---------ILPFFESA  216 (383)
Q Consensus       146 ifpFE~~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~---------~lP~~l~~  216 (383)
                      ..|-+.   ..  .-+..+||- +-|.+...  -....+++|+.    .+..||++|..|...         .-|.+-++
T Consensus       147 ~~P~~~---~~--~~~LvlvGs-l~d~vedq--~~~ll~~lGI~----vv~~LP~~~~~eLp~vg~~t~v~l~qPfL~~T  214 (396)
T cd01979         147 RCPEKP---SP--ERSLVLVGS-LPDIVEDQ--LRRELEQLGIP----VVGFLPPRRYTDLPVIGPGTYVLGIQPFLSRT  214 (396)
T ss_pred             HCCCCC---CC--CCCEEEEEE-CCCHHHHH--HHHHHHHCCCC----EEEECCCCCCCCCCCCCCCCEEEEECHHHHHH
T ss_conf             474323---78--886489970-58168999--99999976992----46775887611021358871899837179999


Q ss_pred             HHHHHHCCC--CCEEEECCC-CCHHHHHHHHHHHCCC
Q ss_conf             987640273--512620166-3368899999960488
Q gi|254780767|r  217 VASLVKRNP--FFRFSLVTV-SSQENLVRCIVSKWDI  250 (383)
Q Consensus       217 ~~~l~~~~~--~~~~~i~~~-~~~~~~~~~~~~~~~~  250 (383)
                      +..|.++..  -+...+|.. .+...+++.....++.
T Consensus       215 A~~L~~r~~~~~i~apFP~G~eGT~~Wl~aiA~~Fg~  251 (396)
T cd01979         215 ATTLMRRRKCKLLSAPFPIGPDGTRAWLEAICSAFGI  251 (396)
T ss_pred             HHHHHHHCCCCEECCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             9999970488620478987951499999999998398


No 345
>cd01149 HutB Hemin binding protein HutB.  These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=38.73  E-value=26  Score=15.40  Aligned_cols=40  Identities=18%  Similarity=0.380  Sum_probs=26.2

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             8610012888689851177657999986630134631111002
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP  123 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P  123 (383)
                      .+.+..-+||+||.-++-+ .-.....+++.  |||++.+-.+
T Consensus        51 ~E~il~l~PDLVi~~~~~~-~~~~~~~L~~~--gi~v~~~~~~   90 (235)
T cd01149          51 AEGVLSLKPTLVIASDEAG-PPEALDQLRAA--GVPVVTVPST   90 (235)
T ss_pred             HHHHHHCCCCEEEEECCCC-HHHHHHHHHHC--CCCEEECCCC
T ss_conf             9999737998899817768-39999999962--9907955898


No 346
>TIGR01465 cobM_cbiF precorrin-4 C11-methyltransferase; InterPro: IPR006362   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CobM and CibF precorrin-4 C11-methyltransferase (2.1.1.133 from EC), both as stand-alone enzymes and when CobJ forms part of a bifunctional enzyme. In the aerobic pathway, CobM catalyses the methylation of precorrin-4 at C-11 to yield precorrin-5. The extruded acyl group is then removed in the subsequent step catalysed by CobF. In the anaerobic pathway, CibF catalyses the methylation of cobalt-precorrin-4 to cobalt-precoriin-5 .    Nomenclature note: occasionally precorrin-4 C11-methyltransferase is one of two methyltransferases often referred to as precorrin-3 methylase (the other is precorrin-3 methylase (the other is precorrin-4 C11-methyltransferase, 2.1.1.131 from EC). ; GO: 0046026 precorrin-4 C11-methyltransferase activity, 0009236 cobalamin biosynthetic process.
Probab=38.63  E-value=17  Score=16.55  Aligned_cols=164  Identities=16%  Similarity=0.188  Sum_probs=87.4

Q ss_pred             HHHHHHHHHCCCCCC-EE---EECCCCCCCCCCCHH-------HHHHHHHHHCCCCCCCHHHHHCCCCCCEEE--CCCCC
Q ss_conf             999986630134631-11---100221100366355-------799999864015677422320025531476--38821
Q gi|254780767|r  103 RVAKRVRKKMPNLPI-IN---YVCPSVWAWREGRAR-------KMCAYINQVISILPFEKEVMQRLGGPPTTF--VGHPL  169 (383)
Q Consensus       103 ~lak~lkk~~~~ipv-i~---yv~PqvWAWr~~R~k-------~~~~~~d~~~~ifpFE~~~f~k~~~~~~~f--VGHPl  169 (383)
                      |=.|.+-    ..++ +|   .|+|+.|||-+.-++       .+...+|.|.-       .+. . |..|.-  .|=|-
T Consensus        17 kG~~lle----~ADvilYAGSLV~~~~L~~~r~~Ae~~~sA~m~L~ei~~~m~~-------a~~-~-GK~VvRLHsGDPs   83 (252)
T TIGR01465        17 KGRKLLE----SADVILYAGSLVPPELLAHCRPGAEVVNSAAMSLEEIVDIMVD-------AVR-E-GKLVVRLHSGDPS   83 (252)
T ss_pred             HHHHHHH----CCCEEEECCCCCHHHHHHHCCCCCEEEECCCCCHHHHHHHHHH-------HHH-C-CCEEEEEECCCHH
T ss_conf             9998863----1997999687781789972789888860502698899999999-------986-6-9849998508755


Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCC
Q ss_conf             12210013558889761876556505998538743012305111899987640273512620166336889999996048
Q gi|254780767|r  170 SSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWD  249 (383)
Q Consensus       170 ~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~  249 (383)
                      .--  .....-...+..|++     .-+-||         .+-|..++-.|...     +.+|-..-  ..+-...+.-.
T Consensus        84 IYG--A~~EQ~~~L~~~gI~-----~e~vPG---------vSsf~AAAA~l~~E-----LT~P~vsQ--tvilTR~eG~R  140 (252)
T TIGR01465        84 IYG--AIAEQMQLLEALGIP-----YEVVPG---------VSSFFAAAAALGAE-----LTVPEVSQ--TVILTRAEGRR  140 (252)
T ss_pred             HHH--HHHHHHHHHHHCCCC-----EEEECC---------CHHHHHHHHHHHCC-----CCCCCCEE--EEEEECCCCCC
T ss_conf             776--699999999867897-----798688---------73898999973001-----47884034--24467543435


Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCHHHHHH----HH----HHCCCEEEECCCCCCEEEEEE
Q ss_conf             88505520552035788763552331156688----87----627530254057741000010
Q gi|254780767|r  250 ISPEIIIDKEQKKQVFMTCNAAMAASGTVILE----LA----LCGIPVVSIYKSEWIVNFFIF  304 (383)
Q Consensus       250 ~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE----~a----l~g~P~IV~Yk~~~lt~~i~~  304 (383)
                      .  .+=..+.-..-+-++|.+||-.|.+..=+    +.    --.||.+||||.+|--..|.|
T Consensus       141 t--PmPe~E~l~~lA~hgaTm~IfLs~~~~~~vv~~L~~~GY~~DTPV~vVyratWPDE~I~R  201 (252)
T TIGR01465       141 T--PMPEGEKLADLAKHGATMAIFLSAHIIDKVVKELIEGGYSEDTPVAVVYRATWPDEKIVR  201 (252)
T ss_pred             C--CCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEEEE
T ss_conf             4--577667899887412313567789999999999983776888878989851487565897


No 347
>PRK00346 surE stationary phase survival protein SurE; Provisional
Probab=38.48  E-value=19  Score=16.29  Aligned_cols=10  Identities=30%  Similarity=0.720  Sum_probs=5.6

Q ss_pred             CCCCCCEEEE
Q ss_conf             0128886898
Q gi|254780767|r   85 VSSKPDVLLI   94 (383)
Q Consensus        85 ~~~~Pd~vi~   94 (383)
                      ...+||+||-
T Consensus        79 ~~~~PDLVvS   88 (246)
T PRK00346         79 LDEKPDLVVS   88 (246)
T ss_pred             CCCCCCEEEE
T ss_conf             4899878996


No 348
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819   Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound . This compound is produced by the combined action of two enzymes, sucrose-phosphate synthase (2.4.1.14 from EC) and sucrose-phosphate phosphatase (3.1.3.24 from EC), via the intermediate sucrose 6-phosphate. Several studies have shown a positive correlation between sucrose-phosphate synthase activity and plant growth rate and yield in agronomically important plants, though direct proof of a causal link is lacking.   This entry represents sucrose-phosphate synthase from plants, which is known to exist in multigene families in several species of both monocots and dicots. The enzyme contains an N-terminal domain glucosyltransferase domain, a variable linker region, and a C-terminal domain similar to that of sucrose-phosphate phosphatase, the next and final enzyme of sucrose biosynthesis. The C-terminal domain is likely to serve a binding - not a catalytic - function, as sucrose-phosphate phosphatase is always encoded by a distinct protein. ; GO: 0046524 sucrose-phosphate synthase activity, 0005985 sucrose metabolic process.
Probab=38.27  E-value=28  Score=15.15  Aligned_cols=239  Identities=16%  Similarity=0.209  Sum_probs=122.0

Q ss_pred             CCCCEEEE-----EC-----HHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC-HHHHHHHHHHHCCCCC---CCHH
Q ss_conf             28886898-----51-----177657999986630134631111002211003663-5579999986401567---7422
Q gi|254780767|r   87 SKPDVLLI-----VD-----NPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGR-ARKMCAYINQVISILP---FEKE  152 (383)
Q Consensus        87 ~~Pd~vi~-----iD-----~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R-~k~~~~~~d~~~~ifp---FE~~  152 (383)
                      ---.+||+     ||     |-||...|.|+||.+.                  +| +...-||-=.|.+|=|   |..=
T Consensus       381 DasE~ViTSTrQEIeEQW~LYdGFD~~LerkLRaR~------------------rRgVsC~GRfMPRM~vIPPGmeF~~i  442 (1072)
T TIGR02468       381 DASEIVITSTRQEIEEQWGLYDGFDVVLERKLRARA------------------RRGVSCYGRFMPRMAVIPPGMEFSHI  442 (1072)
T ss_pred             CCCEEEEECCCCCHHHHCCCCCCCCCEEEHHHHHCC------------------CCCCCCCCCCCCCCEECCCCCCCCCC
T ss_conf             110001004442137515654775201101022111------------------26864246527732004879654410


Q ss_pred             HH---HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCC--CCC
Q ss_conf             32---0025531476388211221001355888976187655650599853874301230511189998764027--351
Q gi|254780767|r  153 VM---QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRN--PFF  227 (383)
Q Consensus       153 ~f---~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~--~~~  227 (383)
                      .-   .. .+++....|++-........-=.+.- ++-.++.+|.|+=|  ||.. =++|+-.+++|.=+...-+  -|+
T Consensus       443 ~~~~~~d-~d~~~~~~~~~~~~~~~~PpIWseim-RFftnp~KPmILAL--aRPD-PkKNiTTLvKAFGECRpLRELANL  517 (1072)
T TIGR02468       443 VPQEDHD-GDMDTETEGNEESSAKADPPIWSEIM-RFFTNPRKPMILAL--ARPD-PKKNITTLVKAFGECRPLRELANL  517 (1072)
T ss_pred             CCCCCCC-CCHHHHHHCCCCCCCCCCCCCHHHHH-HHHCCCCCCEEEEC--CCCC-CCCHHHHHHHHHCCCCCHHHHHHH
T ss_conf             2357775-53134432133567778784178899-86318898779732--6878-730147788763378614677657


Q ss_pred             EEEEC----------CCCCHHHHHHHHHHHCCCCCEEEEE----CCCCHHHHHHHH--------HHHC-CCHHHHHHHHH
Q ss_conf             26201----------6633688999999604888505520----552035788763--------5523-31156688876
Q gi|254780767|r  228 RFSLV----------TVSSQENLVRCIVSKWDISPEIIID----KEQKKQVFMTCN--------AAMA-ASGTVILELAL  284 (383)
Q Consensus       228 ~~~i~----------~~~~~~~~~~~~~~~~~~~~~i~~~----~~~~~~~l~~sd--------~ai~-~SGTaTLE~al  284 (383)
                      ..++-          +..++--.+...+.+|++--.|-..    ..+-.+++.-|-        -|++ .-|-.=.|+|+
T Consensus       518 tLImGNRD~IDems~~~~sVL~svLkLID~YDLYGqVAYPKHHkqsDVP~IYRLAAktKGVFINPA~~EPFGLTLIEAAa  597 (1072)
T TIGR02468       518 TLIMGNRDDIDEMSSGSASVLTSVLKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGVFINPALIEPFGLTLIEAAA  597 (1072)
T ss_pred             HHHHCCCCCHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEECCCCCCCCCHHHHHHHH
T ss_conf             74414752235451555589999998862003565546776788888724889974279657523210456436899986


Q ss_pred             HCCCEEEECCC-CCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHH-HHHHHHHH
Q ss_conf             27530254057-74100001024676102302440784261242054898999999999844989999999-99999999
Q gi|254780767|r  285 CGIPVVSIYKS-EWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAML-HGFENLWD  362 (383)
Q Consensus       285 ~g~P~IV~Yk~-~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~-~~~~~~~~  362 (383)
                      .|.|||.. |- +|+.             +-+.+-|-=+    + +-=..+.|++++.+|+.|...=.+.+ +++++++ 
T Consensus       598 ~GLP~VAT-KNGGPVD-------------I~~vL~NGLL----v-DPHdq~aIa~ALLkLvadK~LW~~CR~NGLkNIH-  657 (1072)
T TIGR02468       598 YGLPMVAT-KNGGPVD-------------IHRVLDNGLL----V-DPHDQEAIADALLKLVADKQLWAKCRQNGLKNIH-  657 (1072)
T ss_pred             CCCCEEEE-CCCCCHH-------------HHHHHHCCCC----C-CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-
T ss_conf             39977983-5868133-------------8877317873----3-6776688999999986215778999736450245-


Q ss_pred             HHCCCC
Q ss_conf             838999
Q gi|254780767|r  363 RMNTKK  368 (383)
Q Consensus       363 ~Lg~~~  368 (383)
                      ....|.
T Consensus       658 ~FSWPe  663 (1072)
T TIGR02468       658 LFSWPE  663 (1072)
T ss_pred             CCCCHH
T ss_conf             676755


No 349
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]
Probab=38.19  E-value=29  Score=15.14  Aligned_cols=113  Identities=19%  Similarity=0.164  Sum_probs=57.2

Q ss_pred             CCCCEEEEEECCCCH---H---------HHHHHHHHHHHHHCCCCEEEEEECCH-HHHHCCCEEEECHHHCCEEEHHHHH
Q ss_conf             987459999768214---7---------89999999999738998399997178-9994788065044453110136746
Q gi|254780767|r    1 MNSLKIAVIAGEISG---D---------LLAGDLIKSLKEMVSYPINLVGVGGP-SLQKEGLVSLFDFSELSVIGIMQVV   67 (383)
Q Consensus         1 m~~mki~i~aGE~SG---D---------~~~a~li~~Lk~~~~~~~~~~giGG~-~m~~~G~~~~~~~~~l~v~G~~evl   67 (383)
                      |++|...|.||..|-   |         -+-..+++.|+.... .+-+..-... ++..-|+..+.|...-.  |-...+
T Consensus         2 ~~~~~~vILAGG~srRm~dK~l~~~~g~~lie~v~~~L~~~~~-~vvi~~~~~~~~~~~~g~~vv~D~~~~~--GPL~Gi   78 (192)
T COG0746           2 MTPMTGVILAGGKSRRMRDKALLPLNGRPLIEHVIDRLRPQVD-VVVISANRNQGRYAEFGLPVVPDELPGF--GPLAGI   78 (192)
T ss_pred             CCCCEEEEECCCCCCCCCCCEEEEECCEEHHHHHHHHHHCCCC-EEEEECCCCHHHHHCCCCCEEECCCCCC--CCHHHH
T ss_conf             9873699977875356788745787982899999998740188-7999768734244316985754788888--878999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC-EEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCH
Q ss_conf             64599999999998610012888-6898511776579999866301346311110022110036635
Q gi|254780767|r   68 RHLPQFIFRINQTVELIVSSKPD-VLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRA  133 (383)
Q Consensus        68 ~~~~~~~~~~~~~~~~i~~~~Pd-~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~  133 (383)
                      .          ...++..  .+. .++-+|.|=++-.+..++.....+.+     +.-+|+|..+|.
T Consensus        79 ~----------~al~~~~--~~~~~v~~~D~P~i~~~lv~~l~~~~~~~~-----~~~~~~~~~g~~  128 (192)
T COG0746          79 L----------AALRHFG--TEWVLVLPCDMPFIPPELVERLLSAFKQTG-----AAIVPAHDDGRL  128 (192)
T ss_pred             H----------HHHHHCC--CCEEEEEECCCCCCCHHHHHHHHHHHCCCC-----CCEEEECCCCCE
T ss_conf             9----------9998579--875999816778789999999998623478-----847886589937


No 350
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators. This group includes the ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators. The binding of CelR to the celE promoter is inhibited specifically by cellobiose. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn chang
Probab=37.85  E-value=29  Score=15.10  Aligned_cols=134  Identities=17%  Similarity=0.290  Sum_probs=63.6

Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEE---ECCCCCCC-CCCCHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             998610012888689851177657999986630134631111---00221100-36635579999986401567742232
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY---VCPSVWAW-REGRARKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~y---v~PqvWAW-r~~R~k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      ++.+.+...+.|.+|++.. +.+-...+.+.+.  ++|+|.+   ....-|.| ...........+++++.         
T Consensus        55 ~~~~~l~~~~vdGiIi~~~-~~~~~~~~~l~~~--~iPvV~~d~~~~~~~~~~V~~d~~~a~~~~~~~L~~---------  122 (275)
T cd06295          55 WLARYLASGRADGVILIGQ-HDQDPLPERLAET--GLPFVVWGRPLPGQPYCYVGSDNVGGGRLATEHLLA---------  122 (275)
T ss_pred             HHHHHHHHCCCCEEEEECC-CCCHHHHHHHHHC--CCCEEEECCCCCCCCCCEEEECHHHHHHHHHHHHHH---------
T ss_conf             9999998489988999799-8997999999957--999999986268999978982879999999999998---------


Q ss_pred             HCCCCCCEEECCCCCCCCCC--CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             00255314763882112210--0135588897618765565059985387430123051118999876402735126201
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPS--ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLV  232 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~--~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~  232 (383)
                       + +.-+..|+|.|.-....  ......+..++.++....  ..+.+++-..|      --.++++.+.++.+...-++.
T Consensus       123 -~-G~~~I~~i~~~~~~~~~~~R~~Gf~~a~~~~~~~~~~--~~~~~~~~~~~------~~~~~~~~~l~~~~~~~ai~~  192 (275)
T cd06295         123 -R-GRRRIAFLGGPQDMPEGEERLEGYREALAEAGLPLDP--RLVAPGDFTEE------SGRAAMRALLERGPDFDAVFA  192 (275)
T ss_pred             -H-CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCC--CEEEECCCCHH------HHHHHHHHHHHCCCCCCEEEE
T ss_conf             -0-9987987058866726999999999999986999994--17996577668------799998889854999870341


Q ss_pred             CC
Q ss_conf             66
Q gi|254780767|r  233 TV  234 (383)
Q Consensus       233 ~~  234 (383)
                      ..
T Consensus       193 ~n  194 (275)
T cd06295         193 AS  194 (275)
T ss_pred             CC
T ss_conf             47


No 351
>KOG2892 consensus
Probab=37.67  E-value=29  Score=15.08  Aligned_cols=76  Identities=9%  Similarity=0.118  Sum_probs=38.5

Q ss_pred             CCEEEEEECCCCH--HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEE-CHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             7459999768214--78999999999973899839999717899947880650-44453110136746645999999999
Q gi|254780767|r    3 SLKIAVIAGEISG--DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLF-DFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         3 ~mki~i~aGE~SG--D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~-~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
                      .++++=+.+--|-  =+..-.+...|++++| +.+|-=+-   |+-.|.+.+. ...++.-       |.++     -++
T Consensus         4 ~~~~irIGtRKSkLAvIQs~~v~~~Lek~YP-~l~f~I~t---~~T~GDkIl~k~L~~ig~-------KsLf-----TkE   67 (320)
T KOG2892           4 RTAVIRIGTRKSKLAVIQSYHVREKLEKKYP-ELAFEIIT---MSTTGDKILSKPLAKIGG-------KSLF-----TKE   67 (320)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCC-CCEEEEEE---ECCCCHHHHHCHHHHHCC-------CCHH-----HHH
T ss_conf             6548971476661012307999999986598-86357998---314336776144766265-------4100-----788


Q ss_pred             HHHHCCCCCCCEEEE
Q ss_conf             986100128886898
Q gi|254780767|r   80 TVELIVSSKPDVLLI   94 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~   94 (383)
                      +-+.+.+...|++|-
T Consensus        68 LE~aL~~~~~divVH   82 (320)
T KOG2892          68 LEDALINGHVDIVVH   82 (320)
T ss_pred             HHHHHHCCCCCEEEE
T ss_conf             999985398528987


No 352
>PTZ00117 malate dehydrogenase; Provisional
Probab=37.66  E-value=29  Score=15.08  Aligned_cols=59  Identities=10%  Similarity=0.009  Sum_probs=28.2

Q ss_pred             HHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEE--ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHH
Q ss_conf             5523311566888762753025405774100001--02467610230244078426124205489899
Q gi|254780767|r  270 AAMAASGTVILELALCGIPVVSIYKSEWIVNFFI--FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEA  335 (383)
Q Consensus       270 ~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~--~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~  335 (383)
                      .+++.+-.--.|+-+.+...++-     .+.++-  .-+.--|+|+|=+|-.+.| .+ +.-+.++++
T Consensus       230 ~gia~a~~~iv~aIl~d~~~vlp-----vs~~l~g~yg~~dv~lsvP~viG~~Gv-e~-ve~~L~~~E  290 (313)
T PTZ00117        230 FAPAAAIVKMIKSYLKNEKSLLT-----CAVYLNGQYNCSNLFVGVTAVINKNGA-EP-VEFNLTDEE  290 (313)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEE-----EEEECCCCCCCCCEEEEEEEEECCCCE-EE-CCCCCCHHH
T ss_conf             04899999999999769995899-----898703666873579998899927814-88-489999999


No 353
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only]
Probab=37.62  E-value=29  Score=15.08  Aligned_cols=13  Identities=8%  Similarity=0.151  Sum_probs=5.0

Q ss_pred             CCCEEEEEECCCC
Q ss_conf             5650599853874
Q gi|254780767|r  191 QWKKILLLPGSRA  203 (383)
Q Consensus       191 ~~~~I~llPGSR~  203 (383)
                      -++++-|+--++.
T Consensus       107 yrP~vfLiTDG~P  119 (207)
T COG4245         107 YRPWVFLITDGEP  119 (207)
T ss_pred             CCEEEEEECCCCC
T ss_conf             4417999538996


No 354
>PRK05086 malate dehydrogenase; Provisional
Probab=37.55  E-value=20  Score=16.18  Aligned_cols=33  Identities=24%  Similarity=0.392  Sum_probs=17.2

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCC--CCEEEEEE
Q ss_conf             4599997682147899999999997389--98399997
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVS--YPINLVGV   39 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~--~~~~~~gi   39 (383)
                      |||-|+-.  || .-|+.+.-.|+.+.+  .++-++-+
T Consensus         1 mKV~IiGA--~G-~VG~s~A~~l~~~~~~~~el~L~Di   35 (312)
T PRK05086          1 MKVAVLGA--AG-GIGQALALLLKTQLPAGSELSLYDI   35 (312)
T ss_pred             CEEEEECC--CC-HHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             98999989--98-6999999999828987774999758


No 355
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=37.47  E-value=29  Score=15.06  Aligned_cols=34  Identities=15%  Similarity=0.237  Sum_probs=19.9

Q ss_pred             CEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             50599853874301230511189998764027351262016
Q gi|254780767|r  193 KKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVT  233 (383)
Q Consensus       193 ~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~  233 (383)
                      +.|++.-+.-..       .+-+....+.+++|.+++.+..
T Consensus       136 ~~IgvITS~tgA-------a~~Di~~~~~~R~p~~~i~l~p  169 (443)
T PRK00286        136 KRIGVITSPTGA-------AIRDILTVLSRRFPSVEVIIYP  169 (443)
T ss_pred             CEEEEEECCCHH-------HHHHHHHHHHCCCCCEEEEEEE
T ss_conf             579998368438-------9999999985049965999981


No 356
>PRK13367 protocatechuate 4,5-dioxygenase; Provisional
Probab=37.45  E-value=22  Score=15.91  Aligned_cols=79  Identities=13%  Similarity=0.096  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEE-EC----CCCCCCCCCCHH------HHHH
Q ss_conf             999999999986100128886898511776-57999986630134631111-00----221100366355------7999
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINY-VC----PSVWAWREGRAR------KMCA  138 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~y-v~----PqvWAWr~~R~k------~~~~  138 (383)
                      ..++.-+..+.+++++.+||++|.|=.-.| |+-+-        .+|++-. ++    |-==-|++..+.      .+++
T Consensus        31 ~p~F~gf~p~r~WL~e~kPDVli~vyNDH~~~FflD--------~~PtFaIGva~~y~pADEG~Gpr~vP~v~Gh~eLa~  102 (418)
T PRK13367         31 APIFESFAPLRDWLQQKRPDVLFYIYNDHVTSFFFD--------HYSAFALGVDDQYHVADEGGGPRDLPPIRGHAALSR  102 (418)
T ss_pred             HHHHCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHH--------CCCHHEEEECCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             777505568999999709998999926458887775--------497230532544688766779989998899989999


Q ss_pred             HHHHHCCCCCCCHHHHHCC
Q ss_conf             9986401567742232002
Q gi|254780767|r  139 YINQVISILPFEKEVMQRL  157 (383)
Q Consensus       139 ~~d~~~~ifpFE~~~f~k~  157 (383)
                      .+-.-+.-=.|...++.+.
T Consensus       103 HI~~sLv~deFD~t~~~em  121 (418)
T PRK13367        103 HIGQSLMADEFDMSFFQDK  121 (418)
T ss_pred             HHHHHHHHCCCCHHHHCCC
T ss_conf             9999987547677776466


No 357
>PRK13373 putative dioxygenase; Provisional
Probab=37.39  E-value=29  Score=15.06  Aligned_cols=34  Identities=12%  Similarity=0.304  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHH
Q ss_conf             9999999999861001288868985117765799
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRV  104 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~l  104 (383)
                      -++...+.++.+.++..+||++|.+-.=.||--.
T Consensus        29 ~~v~~a~~~~r~~l~a~~PDvvVv~~~DH~~~Ff   62 (344)
T PRK13373         29 RRLLQAADRLGRSLDAARPDVIIAFLDDHFENHF   62 (344)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHH
T ss_conf             9999999999999997299989998720787631


No 358
>cd07373 2A5CPDO_A The alpha subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO) catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the alpha subunit, which does not contain a potential metal binding site and may not possess catalytic activity.
Probab=37.18  E-value=30  Score=15.03  Aligned_cols=31  Identities=26%  Similarity=0.383  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECHH
Q ss_conf             6459999999999861001288868985117
Q gi|254780767|r   68 RHLPQFIFRINQTVELIVSSKPDVLLIVDNP   98 (383)
Q Consensus        68 ~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~p   98 (383)
                      +..-++...++++.+.|.+.+||++|..|.-
T Consensus        22 ~~w~~lr~ay~~~~~~i~~~~pD~ivV~stH   52 (271)
T cd07373          22 PSWGQFAAATRQAGKALAASRPDVVLVYSTQ   52 (271)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             5589999999999999985399989998787


No 359
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]
Probab=36.98  E-value=30  Score=15.01  Aligned_cols=31  Identities=26%  Similarity=0.618  Sum_probs=11.7

Q ss_pred             CCCEEEE-ECHHHHH-HHHHHHHHHHCCCCCCE
Q ss_conf             8886898-5117765-79999866301346311
Q gi|254780767|r   88 KPDVLLI-VDNPDFT-HRVAKRVRKKMPNLPII  118 (383)
Q Consensus        88 ~Pd~vi~-iD~pgFn-l~lak~lkk~~~~ipvi  118 (383)
                      .||+|++ +.-||-+ +-+-+.+++..+++|||
T Consensus        48 ~~~lvl~Di~mp~~~Gl~ll~~i~~~~~~~pVI   80 (464)
T COG2204          48 PFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVI   80 (464)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEE
T ss_conf             999899816789996699999999638999889


No 360
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=36.87  E-value=30  Score=15.00  Aligned_cols=77  Identities=21%  Similarity=0.279  Sum_probs=39.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEEEC--CHHHHHCCCEEEECHHHCCEE---------------------------EHHHHHHH
Q ss_conf             9999999997389983999971--789994788065044453110---------------------------13674664
Q gi|254780767|r   19 AGDLIKSLKEMVSYPINLVGVG--GPSLQKEGLVSLFDFSELSVI---------------------------GIMQVVRH   69 (383)
Q Consensus        19 ~a~li~~Lk~~~~~~~~~~giG--G~~m~~~G~~~~~~~~~l~v~---------------------------G~~evl~~   69 (383)
                      +..+..++++.....+.+.=+|  |- -+++-++++++-..-.+-                           ||.|--.-
T Consensus        17 ~~el~a~~~~~~~~sltILvlGKtGV-GKSsTINSifgE~~~~~~aF~~~t~r~~~v~~tv~G~kl~iIDTPGL~~~~~~   95 (249)
T cd01853          17 ALELEAKGKEELDFSLTILVLGKTGV-GKSSTINSIFGERKAATSAFQSETLRVREVSGTVDGFKLNIIDTPGLLESVMD   95 (249)
T ss_pred             HHHHHHCCCCCCCCEEEEEEEECCCC-CHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEECCCCCCCCCCC
T ss_conf             99998513524564369999806876-45776776508541344776778865089987533448998608987766542


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             599999999998610012888689851
Q gi|254780767|r   70 LPQFIFRINQTVELIVSSKPDVLLIVD   96 (383)
Q Consensus        70 ~~~~~~~~~~~~~~i~~~~Pd~vi~iD   96 (383)
                      -..=.+.+..+++.+++..||+|..+|
T Consensus        96 ~~~N~k~l~~iKr~l~~~~~DvvLYvD  122 (249)
T cd01853          96 QRVNRKILSSIKRYLKKKTPDVVLYVD  122 (249)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             213099999999996289997899984


No 361
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT); however their ligand specificity has not been determined experimentally.
Probab=36.75  E-value=30  Score=14.99  Aligned_cols=49  Identities=24%  Similarity=0.230  Sum_probs=32.5

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE--CCCCCCC
Q ss_conf             99986100128886898511776579999866301346311110--0221100
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV--CPSVWAW  128 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv--~PqvWAW  128 (383)
                      ....+.+.+.+.+++|.--+.+-.+.++..+.+.  ++|++...  +|++...
T Consensus        61 ~~a~~Li~~d~V~~viG~~~S~~~~a~~~~~~~~--~ip~i~~~a~~~~l~~~  111 (345)
T cd06338          61 RAYERLITQDKVDFLLGPYSSGLTLAAAPVAEKY--GVPMVAGSGASDSIFAQ  111 (345)
T ss_pred             HHHHHHHHCCCCEEEECCCCHHHHHCCCHHHHHC--CCEEECCCCCCCHHHCC
T ss_conf             9999999618953997686614320010378871--96662566568222227


No 362
>PRK13370 mhpB 3-(2,3-dihydroxyphenyl)propionate dioxygenase; Provisional
Probab=36.73  E-value=30  Score=14.99  Aligned_cols=49  Identities=12%  Similarity=0.257  Sum_probs=32.4

Q ss_pred             HHCCEEEHHHHHHH-HHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHH
Q ss_conf             45311013674664-59999999999861001288868985117765799
Q gi|254780767|r   56 SELSVIGIMQVVRH-LPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRV  104 (383)
Q Consensus        56 ~~l~v~G~~evl~~-~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~l  104 (383)
                      ++-..+|+.++-.. .-.+...+.++.+.+.+.+||++|.+-.=.||--+
T Consensus         9 SHsPl~g~~dp~~~~~~~v~~a~~~~r~~l~~~~PDvvVv~~~DH~~~Ff   58 (313)
T PRK13370          9 SHSPLVGYVDPAQEVLDEVNAAIAAARERVAAFDPELVVLFAPDHYNGFF   58 (313)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHC
T ss_conf             66876789998889999999999999999998299989998525887630


No 363
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Probab=36.63  E-value=8.6  Score=18.58  Aligned_cols=46  Identities=7%  Similarity=0.185  Sum_probs=34.7

Q ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC
Q ss_conf             012888689851177657999986630134631111002211003663
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGR  132 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R  132 (383)
                      .....+.+|.|.+|.-..++.+++++.  +++..-+|.|+.+-|+.-+
T Consensus        53 ~~~~~~~~IaIG~~~~R~ki~~~l~~~--~~~~~niIhp~a~i~~~~~   98 (197)
T cd03360          53 PPPDDEFVVAIGDNKLRRKLAEKLLAA--GYRFATLIHPSAVVSPSAV   98 (197)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHC--CCEEEEEECCCCEECCCCE
T ss_conf             677778999839879999999999868--9967899999959877747


No 364
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein. Members of this protein family are ABC transporter substrate-binding proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Members of this protein family tend to have the twin-arginine signal for Sec-independent transport across the plasma membrane.
Probab=36.55  E-value=30  Score=14.97  Aligned_cols=54  Identities=17%  Similarity=0.123  Sum_probs=23.1

Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHH---HHHHHHHHCCC
Q ss_conf             3368899999960488850552055203578876355233115---66888762753
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGT---VILELALCGIP  288 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGT---aTLE~al~g~P  288 (383)
                      +..+.+.+.+.++++..+.........|+.+..-..||-..||   ..+-.||.++.
T Consensus       255 p~~~~f~~~y~~~~g~~~~~~~~~~~~Yd~~~~la~Aie~AGs~D~~av~~AL~~~~  311 (359)
T TIGR03407       255 PANKKFVKAFKAKYGDDRVTNDPMEAAYLGVYLWKAAVEKAGSFDVDAVRDAAIGIE  311 (359)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCC
T ss_conf             245999999999848999888799999999999999999848999999999972797


No 365
>PRK06179 short chain dehydrogenase; Provisional
Probab=36.40  E-value=30  Score=14.95  Aligned_cols=36  Identities=22%  Similarity=0.401  Sum_probs=29.2

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             98745999976821478999999999973899839999717
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGG   41 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG   41 (383)
                      |++-|+.+++|-.||  .|..+.+.|-++   +.++.+.+-
T Consensus         1 M~~~KvalITGassG--IG~a~A~~la~~---G~~V~~~~r   36 (270)
T PRK06179          1 MSNKKVALVTGASSG--IGRATAEALARA---GYRVFGTSR   36 (270)
T ss_pred             CCCCCEEEEECCCCH--HHHHHHHHHHHC---CCEEEEEEC
T ss_conf             989958999072469--999999999987---999999968


No 366
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type. Members of this protein family are identified as the substrate-binding protein of a urea ABC transport system by similarity to a known urea transporter from Corynebacterium glutamicum, operon structure, proximity of its operons to urease (urea-utilization protein) operons, and by Partial Phylogenetic Profiling vs. urea utilization.
Probab=36.22  E-value=31  Score=14.94  Aligned_cols=42  Identities=21%  Similarity=0.253  Sum_probs=17.6

Q ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHH
Q ss_conf             368899999960488850552055203578876355233115
Q gi|254780767|r  236 SQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGT  277 (383)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGT  277 (383)
                      ..+.+++.+.++++..+.+.......|+.+..-..||-..||
T Consensus       254 ~n~~Fv~~y~~kyg~~p~~~~~a~~aY~av~lla~Aie~AGS  295 (374)
T TIGR03669       254 ENEAFVERFYAKFPDAPYINQEAENNYFSVYMYKQAVEEAGT  295 (374)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             899999999997599998766999999999999999999789


No 367
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff.
Probab=36.06  E-value=31  Score=14.92  Aligned_cols=101  Identities=15%  Similarity=0.220  Sum_probs=59.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999768214789999999999738998399997178999478806504445311013674664599999999998610
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELI   84 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i   84 (383)
                      ||+|+.+.-    ||..++.-+++  . +.++.|+-.+.-...+    ..+..+.+.|..+.+.++              
T Consensus         1 KiiIiGaGg----~ar~v~~~~~~--~-~~~v~gfiDd~~~~~~----~~~~~~~vlg~~~~~~~~--------------   55 (201)
T TIGR03570         1 KLVIIGAGG----HGRVVADIAES--S-GWEIVGFLDDNPALQG----TSVDGLPVLGGDEDLLKL--------------   55 (201)
T ss_pred             CEEEECCCH----HHHHHHHHHHH--C-CCEEEEEEECCCCCCC----CCCCCEEEECCHHHHHHC--------------
T ss_conf             999996788----99999999996--8-9939999989830067----515882486707888754--------------


Q ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC
Q ss_conf             012888689851177657999986630134631111002211003663
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGR  132 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R  132 (383)
                      ....-..++.|-+|..--++.+++++.  +++..-+|.|+.+-|+.-+
T Consensus        56 ~~~~~~~~iaIG~~~~R~ki~~~l~~~--~~~f~~lIhp~a~i~~~~~  101 (201)
T TIGR03570        56 PPDEVDLVVAIGDNKLRRRLVEKLKAK--GYRFATLIHPSAIVSPSAS  101 (201)
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHC--CCEEEEEECCCCEECCCCE
T ss_conf             856668999919989999999999868--9967899999809889867


No 368
>TIGR01284 alt_nitrog_alph nitrogenase alpha chain; InterPro: IPR005974    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene. Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes. It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I.    This model represents the alpha chains of various forms of the nitrogen-fixing enzyme nitrogenase: vanadium-iron, iron-iron, and molybdenum-iron. Most examples of NifD, the molybdenum-iron type nitrogenase alpha chain, are excluded from this model and described instead by equivalog model IPR005972 from INTERPRO.; GO: 0016163 nitrogenase activity, 0051536 iron-sulfur cluster binding, 0009399 nitrogen fixation.
Probab=36.04  E-value=15  Score=17.03  Aligned_cols=39  Identities=21%  Similarity=0.488  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHH--------------HHHHHHHCCCCCCC-EEEEECHHHHH
Q ss_conf             36746645999999--------------99998610012888-68985117765
Q gi|254780767|r   63 IMQVVRHLPQFIFR--------------INQTVELIVSSKPD-VLLIVDNPDFT  101 (383)
Q Consensus        63 ~~evl~~~~~~~~~--------------~~~~~~~i~~~~Pd-~vi~iD~pgFn  101 (383)
                      +.|+++.+|.+++.              ++-+.+.+.++.|| =|+.|.+|||.
T Consensus       127 i~EAf~efP~ikr~~~Y~TC~TaLIGDDI~Aia~eV~ee~p~vDvf~~n~PGFa  180 (468)
T TIGR01284       127 ILEAFKEFPEIKRMIVYATCATALIGDDIDAIAKEVMEEIPDVDVFAVNAPGFA  180 (468)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             999986054332377841678743244478999998752799428998177898


No 369
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]
Probab=36.04  E-value=31  Score=14.92  Aligned_cols=305  Identities=14%  Similarity=0.121  Sum_probs=150.7

Q ss_pred             CCCCHHHH---HHHHHHHHHHHCCCC-EEEEEEC-C-H---HHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHH-HHHHH
Q ss_conf             68214789---999999999738998-3999971-7-8---999478806504445311013674664599999-99999
Q gi|254780767|r   11 GEISGDLL---AGDLIKSLKEMVSYP-INLVGVG-G-P---SLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIF-RINQT   80 (383)
Q Consensus        11 GE~SGD~~---~a~li~~Lk~~~~~~-~~~~giG-G-~---~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~-~~~~~   80 (383)
                      |=-|+|++   -+-+++.+-+..+.+ +|++..- | +   .|++-               +.-.+-|...+.+ -..+.
T Consensus       263 GylS~dlr~Havg~l~~~v~e~hDRdkfEvfay~~g~~~~dal~~r---------------I~a~~~~~~~~~~~dd~e~  327 (620)
T COG3914         263 GYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDALQER---------------ISAAVEKWYPIGRMDDAEI  327 (620)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHCHHHEEEEEEECCCCCCHHHHHH---------------HHHHHHHEECCCCCCHHHH
T ss_conf             8852546411389999999987350015899996588773167888---------------8876531410588688999


Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHH----CCCCCCCHHHHHC
Q ss_conf             861001288868985117765799998663013463111100221100366355799999864----0156774223200
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQV----ISILPFEKEVMQR  156 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~----~~ifpFE~~~f~k  156 (383)
                      .+.|+...-|++|-+|.---+-|..=.++|-   -|+.       =-|--+=+..-..+.|..    .++=|-++++|..
T Consensus       328 a~~I~~d~IdILvDl~g~T~d~r~~v~A~Rp---APiq-------vswlGy~aT~g~p~~DY~I~D~y~vPp~ae~yysE  397 (620)
T COG3914         328 ANAIRTDGIDILVDLDGHTVDTRCQVFAHRP---APIQ-------VSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSE  397 (620)
T ss_pred             HHHHHHCCCEEEEECCCCEECCCHHHHHCCC---CCEE-------EEECCCCCCCCCCCCEEEEECCEECCCHHHHHHHH
T ss_conf             9998725870999656721034003663577---7648-------76226566668876307850760368147789989


Q ss_pred             -CCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC-
Q ss_conf             -255314763882112210013558889761876556505998538743012305111899987640273512620166-
Q gi|254780767|r  157 -LGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV-  234 (383)
Q Consensus       157 -~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~-  234 (383)
                       .--++-+|.+|--...+.+.    ..|.+.|++++.  +..+-|-+.+.+.   |-..+.=..+.+.-|+-.+++-.. 
T Consensus       398 kl~RLp~cy~p~d~~~~v~p~----~sR~~lglp~~a--vVf~c~~n~~K~~---pev~~~wmqIL~~vP~Svl~L~~~~  468 (620)
T COG3914         398 KLWRLPQCYQPVDGFEPVTPP----PSRAQLGLPEDA--VVFCCFNNYFKIT---PEVFALWMQILSAVPNSVLLLKAGG  468 (620)
T ss_pred             HHHHCCCCCCCCCCCCCCCCC----CCHHHCCCCCCE--EEEEECCCCCCCC---HHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             987330136887775658899----432105999980--8999668864478---7999999999984898579982689


Q ss_pred             --CCHHHHHHHHHHHCCCCCEEEEEC-----CCCHHHHHHHHHHHCCC----HHHHHHHHHHCCCEEEECCCCCCEEEEE
Q ss_conf             --336889999996048885055205-----52035788763552331----1566888762753025405774100001
Q gi|254780767|r  235 --SSQENLVRCIVSKWDISPEIIIDK-----EQKKQVFMTCNAAMAAS----GTVILELALCGIPVVSIYKSEWIVNFFI  303 (383)
Q Consensus       235 --~~~~~~~~~~~~~~~~~~~i~~~~-----~~~~~~l~~sd~ai~~S----GTaTLE~al~g~P~IV~Yk~~~lt~~i~  303 (383)
                        ++....++...+..+...+-....     .....-+..+|+++-+-    +|.|+|+--+|+|++.-+--.|.+..-.
T Consensus       469 ~~~~~~~~l~~la~~~Gv~~eRL~f~p~~~~~~h~a~~~iADlvLDTyPY~g~TTa~daLwm~vPVlT~~G~~FasR~~~  548 (620)
T COG3914         469 DDAEINARLRDLAEREGVDSERLRFLPPAPNEDHRARYGIADLVLDTYPYGGHTTASDALWMGVPVLTRVGEQFASRNGA  548 (620)
T ss_pred             CCHHHHHHHHHHHHHCCCCHHHEEECCCCCCHHHHHHHCHHHEEEECCCCCCCCCHHHHHHHCCCEEEECCHHHHHHHHH
T ss_conf             86889999999999708981334626999988999862313246524667886426777873584465111778876059


Q ss_pred             ECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             024676102302440784261242054898999999999844989999999999999998
Q gi|254780767|r  304 FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDR  363 (383)
Q Consensus       304 ~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~  363 (383)
                      -+            +..--+||++-.  +.+.-......+=.|...|++....++.-++.
T Consensus       549 si------------~~~agi~e~vA~--s~~dYV~~av~~g~dral~q~~r~~l~~~r~t  594 (620)
T COG3914         549 SI------------ATNAGIPELVAD--SRADYVEKAVAFGSDRALRQQVRAELKRSRQT  594 (620)
T ss_pred             HH------------HHHCCCCHHHCC--CHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCC
T ss_conf             99------------986698024218--88899999998534177787557999840326


No 370
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=35.96  E-value=31  Score=14.91  Aligned_cols=23  Identities=4%  Similarity=0.271  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             99999999861001288868985
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIV   95 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~i   95 (383)
                      +.+.++++++.+++..|++.|++
T Consensus        79 ~~~~~~~~I~~ir~~~P~a~ill  101 (189)
T cd01825          79 YRQQLREFIKRLRQILPNASILL  101 (189)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999999999997589980999


No 371
>PRK07735 NADH dehydrogenase subunit C; Validated
Probab=35.93  E-value=21  Score=16.02  Aligned_cols=33  Identities=18%  Similarity=0.307  Sum_probs=14.7

Q ss_pred             HHHHHHCCCCCCCHHHHHCCCCCCEEECCCCCCCC
Q ss_conf             99986401567742232002553147638821122
Q gi|254780767|r  138 AYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSS  172 (383)
Q Consensus       138 ~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl~d~  172 (383)
                      ..+|.+=..|+=-+++.. . =++-.||||||...
T Consensus       380 EayDLLGi~F~GHpnL~R-I-~mpddWvGhPLRKD  412 (420)
T PRK07735        380 EAYDLLGIVFKGHPNLSR-I-LMPDDWVGHPLRKD  412 (420)
T ss_pred             HHHHHHCCCCCCCCCCEE-E-ECCCCCCCCCCCCC
T ss_conf             566540211269988000-1-16644457843355


No 372
>pfam01973 MAF_flag10 Protein of unknown function DUF115. This family of archaebacterial proteins has no known function.
Probab=35.28  E-value=32  Score=14.84  Aligned_cols=82  Identities=24%  Similarity=0.380  Sum_probs=39.6

Q ss_pred             HHHHHHHCCCCEEEEEEC-CHHHHHCCCEEEECHH-HCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999997389983999971-7899947880650444-53110136746645999999999986100128886898511776
Q gi|254780767|r   23 IKSLKEMVSYPINLVGVG-GPSLQKEGLVSLFDFS-ELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        23 i~~Lk~~~~~~~~~~giG-G~~m~~~G~~~~~~~~-~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      ++.|+.... +..++=+| ||.+++. ++.+-+.. +.-+++.--.++.+          .+  ...+||.++.+|....
T Consensus        15 ~~~l~~~~~-g~~~~IvgaGPSL~~~-i~~Lk~~~~~~~iia~~~a~~~L----------~~--~gI~Pd~~v~~D~~~~   80 (169)
T pfam01973        15 LKELLNKKK-GKPAIIVGAGPSLDKH-LPLLKKNRDKAVIIAADSALKAL----------LK--HGIKPDIVVSLDRQEI   80 (169)
T ss_pred             HHHHHHHHC-CCEEEEECCCCCHHHH-HHHHHHHCCCEEEEEECHHHHHH----------HH--CCCCCEEEEEECCCHH
T ss_conf             999988748-9719999568998999-99999716983999966799999----------97--7998149999748645


Q ss_pred             HHHHHHHHHHHCCCCCCEE
Q ss_conf             5799998663013463111
Q gi|254780767|r  101 THRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus       101 nl~lak~lkk~~~~ipvi~  119 (383)
                      +....+...+. ..++.++
T Consensus        81 ~~~~~~~~~~~-~~~~lv~   98 (169)
T pfam01973        81 SYEFFKEAFKE-GDIPLVH   98 (169)
T ss_pred             HHHHHHHHCCC-CCEEEEE
T ss_conf             69998643125-8848999


No 373
>pfam01993 MTD methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase. This enzyme family is involved in formation of methane from carbon dioxide EC:1.5.99.9. The enzyme requires coenzyme F420.
Probab=35.16  E-value=32  Score=14.83  Aligned_cols=62  Identities=23%  Similarity=0.434  Sum_probs=32.1

Q ss_pred             EEEEE-ECCCCHHHHHHHHHHHHHHHCCCCEEEEEEC-CHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59999-7682147899999999997389983999971-789994788065044453110136746645999999999986
Q gi|254780767|r    5 KIAVI-AGEISGDLLAGDLIKSLKEMVSYPINLVGVG-GPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVE   82 (383)
Q Consensus         5 ki~i~-aGE~SGD~~~a~li~~Lk~~~~~~~~~~giG-G~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~   82 (383)
                      ||-|+ +|--.--...-.+..+.-.  ..|++.+-+| |.+|+.+-++              ++             ..+
T Consensus         3 kiGiiK~GNIg~s~~idl~LDErAd--RedI~vrv~gsGaKm~pe~~e--------------~~-------------~~~   53 (276)
T pfam01993         3 KIGIIKCGNIGTSPVVDLLLDERAD--REDIEVRVVGSGAKMDPECVE--------------EV-------------VLD   53 (276)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHC--CCCCEEEEECCCCCCCHHHHH--------------HH-------------HHH
T ss_conf             5888974452159999998776523--468649995266667988899--------------99-------------999


Q ss_pred             HCCCCCCCEEEEE
Q ss_conf             1001288868985
Q gi|254780767|r   83 LIVSSKPDVLLIV   95 (383)
Q Consensus        83 ~i~~~~Pd~vi~i   95 (383)
                      .+++++||.+|.|
T Consensus        54 ~l~~~~pDf~i~i   66 (276)
T pfam01993        54 MLEEFEPDFVIYI   66 (276)
T ss_pred             HHHHHCCCEEEEE
T ss_conf             9986189989997


No 374
>pfam09861 DUF2088 Uncharacterized conserved protein (DUF2088). This domain, found in various hypothetical prokaryotic proteins, has no known function.
Probab=35.15  E-value=32  Score=14.83  Aligned_cols=57  Identities=14%  Similarity=0.150  Sum_probs=34.5

Q ss_pred             CCCCEEEEEE-CCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCCCC---HHHHHHHHHH
Q ss_conf             5565059985-3874301230511189998764027351262016633---6889999996
Q gi|254780767|r  190 SQWKKILLLP-GSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSS---QENLVRCIVS  246 (383)
Q Consensus       190 ~~~~~I~llP-GSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~~~---~~~~~~~~~~  246 (383)
                      +.+++..+.| .+|..--+..+|.+++.+...--+..++.+++++..+   .++.++..+.
T Consensus        53 ~~~~V~Ivv~D~TRp~p~~~il~~ll~~L~~~Gv~~~~I~iv~A~G~Hr~~t~eE~~~~lG  113 (203)
T pfam09861        53 PGEKVVIVVSDITRPTPSDIILPLLLEELNAVGIPDEDITILVATGTHRPMTEEELKKILG  113 (203)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             9997999957978888567559999999997599812589998268799999899999860


No 375
>PRK11544 hycI hydrogenase 3 maturation protease; Provisional
Probab=34.94  E-value=26  Score=15.43  Aligned_cols=23  Identities=35%  Similarity=0.463  Sum_probs=17.2

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHH
Q ss_conf             86100128886898511776579
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHR  103 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~  103 (383)
                      ...++..+||.+|.||.-+|++.
T Consensus        47 ~~~i~~~~p~~iIiVDA~d~G~~   69 (156)
T PRK11544         47 IVAIRELRPTRLLIVDATDMGLN   69 (156)
T ss_pred             HHHHHCCCCCEEEEEECHHCCCC
T ss_conf             99987018997999971440989


No 376
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome.  SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2.  Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
Probab=34.90  E-value=32  Score=14.80  Aligned_cols=117  Identities=13%  Similarity=0.141  Sum_probs=67.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHCCCCEEEE---EECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9997682147899999999997389983999---9717899947880650444531101367466459999999999861
Q gi|254780767|r    7 AVIAGEISGDLLAGDLIKSLKEMVSYPINLV---GVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         7 ~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~---giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      +.+.|.+.-|.   ..++++|++ ++++.+.   -+||-           +.++     |..++..=-.-.+..+.+++.
T Consensus        44 ~~~~g~~d~d~---~~l~~lk~~-~~~~kilPri~~~gw-----------~~~~-----~~~~ls~~~~R~~~i~~iv~~  103 (318)
T cd02876          44 FVIEGTHDIDK---GWIEEVRKA-NKNIKILPRVLFEGW-----------SYQD-----LQSLLNDEQEREKLIKLLVTT  103 (318)
T ss_pred             EECCCCCCCCH---HHHHHHHHH-CCCCEEEEEEEECCC-----------CHHH-----HHHHHCCHHHHHHHHHHHHHH
T ss_conf             44268542266---899999971-998679888856798-----------8789-----999963999999999999999


Q ss_pred             CCCCCCCEEEEECH---H-------------HHHHHHHHHHHHHCCCCCCEEEECCCCCCCC------CCCHHHHHHHHH
Q ss_conf             00128886898511---7-------------7657999986630134631111002211003------663557999998
Q gi|254780767|r   84 IVSSKPDVLLIVDN---P-------------DFTHRVAKRVRKKMPNLPIINYVCPSVWAWR------EGRARKMCAYIN  141 (383)
Q Consensus        84 i~~~~Pd~vi~iD~---p-------------gFnl~lak~lkk~~~~ipvi~yv~PqvWAWr------~~R~k~~~~~~d  141 (383)
                      ++++.-|-+.+ |+   |             .|-..+++.+++.  |..++.-|+|..-+..      +.-.+.+.+++|
T Consensus       104 ~~~~gfDGidi-D~w~~~~~~~~~~~~~~~~~fv~el~~~l~~~--g~~l~l~vp~~~~~~~~~~~~~~~d~~~l~~~vD  180 (318)
T cd02876         104 AKKNHFDGIVL-EVWSQLAAYGVPDKRKELIQLVIHLGETLHSA--NLKLILVIPPPREKGNQNGLFTRKDFEKLAPHVD  180 (318)
T ss_pred             HHHHCCCCEEE-ECCHHCCCCCCHHHHHHHHHHHHHHHHHHHHC--CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99819985888-23100143368768999999999999999865--9889999836756555656554542999986422


Q ss_pred             HHCCC
Q ss_conf             64015
Q gi|254780767|r  142 QVISI  146 (383)
Q Consensus       142 ~~~~i  146 (383)
                      .+...
T Consensus       181 ~v~lM  185 (318)
T cd02876         181 GFSLM  185 (318)
T ss_pred             EEEEE
T ss_conf             46786


No 377
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity.  Members of this group include ABC
Probab=34.77  E-value=32  Score=14.79  Aligned_cols=38  Identities=13%  Similarity=0.116  Sum_probs=27.6

Q ss_pred             HCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC
Q ss_conf             1001288868985117765799998663013463111100
Q gi|254780767|r   83 LIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        83 ~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~  122 (383)
                      .+.+.+.+++|+--+.+-...++..+.+.  ++|++...+
T Consensus        61 ~l~~~~v~~iiG~~~s~~~~~~~~~~~~~--~ip~i~~~~   98 (298)
T cd06268          61 ELVDDGVDAVIGPLSSGVALAAAPVAEEA--GVPLISPGA   98 (298)
T ss_pred             HHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCEEEECCC
T ss_conf             86327973997477578889999999871--921880575


No 378
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of  the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin.  Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=34.68  E-value=32  Score=14.78  Aligned_cols=84  Identities=17%  Similarity=0.173  Sum_probs=53.0

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCC--------CCCCCHHHHHHHHHHHC
Q ss_conf             9999999986100128886898511776579999866301346311110022110--------03663557999998640
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWA--------WREGRARKMCAYINQVI  144 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWA--------Wr~~R~k~~~~~~d~~~  144 (383)
                      -..-++++++....+...++-=||.||-.....+.-...  +.....+..++.|.        =++.--..+++.+|.+.
T Consensus        66 T~~d~~eiv~yA~~rgI~ViPEiD~PgHs~a~~~~yPel--~~~~~~~~~~~~~~~~~~~L~p~~~~ty~fl~~vl~Ev~  143 (311)
T cd06570          66 TQEQIREVVAYARDRGIRVVPEIDVPGHASAIAVAYPEL--ASGPGPYVIERGWGVFEPLLDPTNEETYTFLDNLFGEMA  143 (311)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCHHH--CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             899999999999985998965333741479999869885--478887665667786672236898899999999999999


Q ss_pred             CCCCCCHHHHHCCCCCC
Q ss_conf             15677422320025531
Q gi|254780767|r  145 SILPFEKEVMQRLGGPP  161 (383)
Q Consensus       145 ~ifpFE~~~f~k~~~~~  161 (383)
                      .+||.+  +| -.+|=+
T Consensus       144 ~lFp~~--y~-HiGGDE  157 (311)
T cd06570         144 ELFPDE--YF-HIGGDE  157 (311)
T ss_pred             HHCCCC--EE-EECCCC
T ss_conf             857864--15-645754


No 379
>pfam01975 SurE Survival protein SurE. E. coli cells with the surE gene disrupted are found to survive poorly in stationary phase. It is suggested that SurE may be involved in stress response. Yeast also contains a member of the family. A sequence from Yarrowia lipolytica can complement a mutation in acid phosphatase, suggesting that members of this family could be phosphatases.
Probab=34.57  E-value=25  Score=15.54  Aligned_cols=21  Identities=48%  Similarity=0.741  Sum_probs=17.2

Q ss_pred             HCCCHHH--HHHHHHHCCCEEEE
Q ss_conf             2331156--68887627530254
Q gi|254780767|r  272 MAASGTV--ILELALCGIPVVSI  292 (383)
Q Consensus       272 i~~SGTa--TLE~al~g~P~IV~  292 (383)
                      +.-|||+  .+|++++|+|.|-+
T Consensus       103 v~ySGTVgAA~Ea~~~GipsIA~  125 (190)
T pfam01975       103 VLYSGTVGAAMEAALLGIPSIAV  125 (190)
T ss_pred             EECHHHHHHHHHHHHCCCCEEEE
T ss_conf             75257778899999759986999


No 380
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=34.44  E-value=33  Score=14.75  Aligned_cols=89  Identities=15%  Similarity=0.198  Sum_probs=39.0

Q ss_pred             EEECCCCHHHH--HHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHH-HHHHHHHHHHHHHHHHC
Q ss_conf             99768214789--9999999997389983999971789994788065044453110136746-64599999999998610
Q gi|254780767|r    8 VIAGEISGDLL--AGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVV-RHLPQFIFRINQTVELI   84 (383)
Q Consensus         8 i~aGE~SGD~~--~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl-~~~~~~~~~~~~~~~~i   84 (383)
                      ++.|-+.||.|  |.++++.+-+..  +++...+|-+.-.++=++. ..-++..++|++-.+ .+++.+++..+.+.+. 
T Consensus         2 vvi~~v~gD~H~iG~~iv~~~l~~~--G~~V~~lG~~vp~e~~v~~-a~~~~~d~I~lS~~~~~~~~~~~~~i~~l~~~-   77 (119)
T cd02067           2 VVIATVGGDGHDIGKNIVARALRDA--GFEVIDLGVDVPPEEIVEA-AKEEDADAIGLSGLLTTHMTLMKEVIEELKEA-   77 (119)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHC--CCEEEECCCCCCHHHHHHH-HHHCCCCEEEEECCCCCCHHHHHHHHHHHHHC-
T ss_conf             8999639856778999999999978--9989989999999999999-99709999999622024268999999999976-


Q ss_pred             CCCCCCEEEEECHHHHHH
Q ss_conf             012888689851177657
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFTH  102 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFnl  102 (383)
                        ..+|+-|+|=-.-||.
T Consensus        78 --g~~~i~v~vGG~~~~~   93 (119)
T cd02067          78 --GLDDIPVLVGGAIVTR   93 (119)
T ss_pred             --CCCCCEEEEECCCCCH
T ss_conf             --9999859998998974


No 381
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed
Probab=34.36  E-value=33  Score=14.74  Aligned_cols=121  Identities=17%  Similarity=0.222  Sum_probs=67.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHH-HHHHHHH-CCCCEEEEEECCHH-----HHHCCCEEEE----CHH--------HCCEE
Q ss_conf             9874599997682147899999-9999973-89983999971789-----9947880650----444--------53110
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDL-IKSLKEM-VSYPINLVGVGGPS-----LQKEGLVSLF----DFS--------ELSVI   61 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~l-i~~Lk~~-~~~~~~~~giGG~~-----m~~~G~~~~~----~~~--------~l~v~   61 (383)
                      |.+-+|.|+.||++|  .|-.+ +++|.+. .....++.=+|.++     ++..|++.-+    +.+        .+.+.
T Consensus         2 m~Kp~IaIT~GDPaG--IGpEIilKal~~~~~~~~~~~viigd~~~l~~~~~~lg~~~~~~~i~~~~~~~~~~~~~i~v~   79 (334)
T PRK00232          2 MMKPRIAITPGDPAG--IGPELIAKLLAQPDVRWPAHLVVIADRALLEERAAILGLPLDLRPYSPDAPAAPQAAGTLTLL   79 (334)
T ss_pred             CCCCCEEEECCCCCH--HHHHHHHHHHHCCCCCCCCCEEEEECHHHHHHHHHHCCCCCCEEEECCHHHHHHCCCCCCEEE
T ss_conf             999828996888635--389999999848130489888999889999999998599970687377455443458982598


Q ss_pred             ------------EHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEE------------ECHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             ------------136746645999999999986100128886898------------51177657999986630134631
Q gi|254780767|r   62 ------------GIMQVVRHLPQFIFRINQTVELIVSSKPDVLLI------------VDNPDFTHRVAKRVRKKMPNLPI  117 (383)
Q Consensus        62 ------------G~~evl~~~~~~~~~~~~~~~~i~~~~Pd~vi~------------iD~pgFnl~lak~lkk~~~~ipv  117 (383)
                                  |-.. -.+=......++..++.+++.+.|++|+            .+|||-.--||+.....   -++
T Consensus        80 ~~~~~~~~~v~~G~~s-~~~g~~~~~~i~~Av~~~~~g~~~alVT~PInK~~i~~aG~~f~GHTE~La~~~~~~---~~~  155 (334)
T PRK00232         80 DVDLLDPADVPFGQLS-AANGHYVLETLARALDLALAGEFDAICTAPVNKGAINAAGIPFSGHTEFFAELSGTT---GVV  155 (334)
T ss_pred             ECCCCCCCCCCCCCCC-HHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCCCCCCHHHHHHHHHCCC---CCE
T ss_conf             5676753457889868-899999999999999999759977898777578999857999898799999986899---806


Q ss_pred             EEEECCCCCC
Q ss_conf             1110022110
Q gi|254780767|r  118 INYVCPSVWA  127 (383)
Q Consensus       118 i~yv~PqvWA  127 (383)
                      .-+.+..+|.
T Consensus       156 Mml~~~~L~V  165 (334)
T PRK00232        156 MMLATEELRV  165 (334)
T ss_pred             EEEECCCEEE
T ss_conf             8897387069


No 382
>TIGR00603 rad25 DNA repair helicase rad25; InterPro: IPR001161   Xeroderma pigmentosum (XP)  is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. People's skin cells with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-G is one of the most rare and phenotypically heterogeneous of XP, showing anything from slight to extreme dysfunction in DNA excision repair , . XP-G can be corrected by a 133 Kd nuclear protein, XPGC . XPGC is an acidic protein that confers normal UV resistance in expressing cells . It is a magnesium-dependent, single-strand DNA endonuclease that makes structure-specific endonucleolytic incisions in a DNA substrate containing a duplex region and single-stranded arms , . XPGC cleaves one strand of the duplex at the border with the single-stranded region .   XPG belongs to a family of proteins that includes RAD2 from Saccharomyces cerevisiae (Baker's yeast) and rad13 from Schizosaccharomyces pombe (Fission yeast), which are single-stranded DNA endonucleases , ; mouse and human FEN-1, a structure-specific endonuclease; RAD2 from fission yeast and RAD27 from budding yeast; fission yeast exo1, a 5'-3' double-stranded DNA exonuclease that may act in a pathway that corrects mismatched base pairs; yeast DHS1, and yeast DIN7. Sequence alignment of this family of proteins reveals that similarities are largely confined to two regions. The first is located at the N-terminal extremity (N-region) and corresponds to the first 95 to 105 amino acids. The second region is internal (I-region) and found towards the C-terminus; it spans about 140 residues and contains a highly conserved core of 27 amino acids that includes a conserved pentapeptide (E-A-[DE]-A-[QS]). It is possible that the conserved acidic residues are involved in the catalytic mechanism of DNA excision repair in XPG. The amino acids linking the N- and I-regions are not conserved.   This entry represents XP group B (XP-B) give rise to both XP and Cockayne syndrome . The DNA/RNA helicase domain IPR001650 from INTERPRO is also present in this group of proteins.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding, 0006289 nucleotide-excision repair, 0005634 nucleus.
Probab=34.05  E-value=13  Score=17.45  Aligned_cols=99  Identities=17%  Similarity=0.155  Sum_probs=54.7

Q ss_pred             HHHHHHCCCCCCCEEE-EECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHC
Q ss_conf             9998610012888689-851177657999986630134631111002211003663557999998640156774223200
Q gi|254780767|r   78 NQTVELIVSSKPDVLL-IVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQR  156 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi-~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k  156 (383)
                      .-+++.=...+=|-+| +=|.-   +-|-+|+.|.  |-|.||=-.||-     -|.+-        |--|-     | +
T Consensus       502 qFLI~fHE~~RgDKIIVFsDNV---fAL~~YA~kl--~KpfIYGpTsq~-----ER~~I--------L~nF~-----~-n  557 (756)
T TIGR00603       502 QFLIRFHERQRGDKIIVFSDNV---FALKEYAIKL--GKPFIYGPTSQQ-----ERMQI--------LQNFK-----H-N  557 (756)
T ss_pred             HHHHHHHHHCCCCEEEEECCHH---HHHHHHHHHC--CCCEEECCCCHH-----HHHHH--------HHHCC-----C-C
T ss_conf             8988885414888589942447---8999999873--896540798713-----79999--------86215-----5-8


Q ss_pred             CCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCE--EEEEECCCCCCHHHHCCCHH
Q ss_conf             25531476388211221001355888976187655650--59985387430123051118
Q gi|254780767|r  157 LGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKK--ILLLPGSRAQEIYKILPFFE  214 (383)
Q Consensus       157 ~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~--I~llPGSR~~EI~~~lP~~l  214 (383)
                       ..|+|.|+-= ..|. +           .++++..-+  |.-=.|||+||-.|+-.++-
T Consensus       558 -~~vnTIF~SK-VGDt-S-----------iDlPEAnvlIQiSSH~GSRRQEAQRLGRILR  603 (756)
T TIGR00603       558 -PKVNTIFLSK-VGDT-S-----------IDLPEANVLIQISSHYGSRRQEAQRLGRILR  603 (756)
T ss_pred             -CCCCEEEEEE-ECCC-C-----------CCCCCCCEEEEEEECCCCHHHHHHHCCCCCC
T ss_conf             -8645689843-0277-5-----------1422142677653267740368764132016


No 383
>pfam02603 Hpr_kinase_N HPr Serine kinase N terminus. This family represents the N-terminal region of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phospho-relay system in control of carbon catabolic repression in bacteria. This kinase in unusual in that it recognizes the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller. The blades are formed by two N-terminal domains each, and the compact central hub assembles the C-terminal kinase domains.
Probab=34.01  E-value=33  Score=14.71  Aligned_cols=79  Identities=18%  Similarity=0.359  Sum_probs=46.8

Q ss_pred             EEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHH--HHHHHHHHHHHHHHHHCCCCCCCEEEEEC---HHHHHHHHHHHH
Q ss_conf             3999971789994788065044453110136746--64599999999998610012888689851---177657999986
Q gi|254780767|r   34 INLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVV--RHLPQFIFRINQTVELIVSSKPDVLLIVD---NPDFTHRVAKRV  108 (383)
Q Consensus        34 ~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl--~~~~~~~~~~~~~~~~i~~~~Pd~vi~iD---~pgFnl~lak~l  108 (383)
                      +.-..+--|.++=+|.-..++.+.+.++|-.|.-  .+++.  ....+..+.+.+.+|-++|+-+   -|..=+.+|++ 
T Consensus        27 I~~~~i~RPGL~LaG~~~~~~~~RIQi~G~~E~~yl~~l~~--e~r~~~l~~l~~~~~P~iIvt~~~~~p~~l~~~a~~-  103 (127)
T pfam02603        27 ITTSDINRPGLELAGYFDYFPPERVQILGKTELSYLDQLTE--EERKERLEKLFSYDTPCLIVTRGLEPPEELLEAAKK-  103 (127)
T ss_pred             ECCCCCCCHHHHHCCCCCCCCCCEEEEECHHHHHHHHHCCH--HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH-
T ss_conf             44656677569875876457987599985799999996999--999999999857599889997999999999999999-


Q ss_pred             HHHCCCCCCEE
Q ss_conf             63013463111
Q gi|254780767|r  109 RKKMPNLPIIN  119 (383)
Q Consensus       109 kk~~~~ipvi~  119 (383)
                          +++|++.
T Consensus       104 ----~~vPll~  110 (127)
T pfam02603       104 ----YGIPLLR  110 (127)
T ss_pred             ----HCCCEEE
T ss_conf             ----7995798


No 384
>KOG1602 consensus
Probab=33.94  E-value=33  Score=14.70  Aligned_cols=61  Identities=10%  Similarity=0.149  Sum_probs=32.1

Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCCCCCCCH--HHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCC
Q ss_conf             999866301346311110022110036635--5799999864015677422320025531476388
Q gi|254780767|r  104 VAKRVRKKMPNLPIINYVCPSVWAWREGRA--RKMCAYINQVISILPFEKEVMQRLGGPPTTFVGH  167 (383)
Q Consensus       104 lak~lkk~~~~ipvi~yv~PqvWAWr~~R~--k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGH  167 (383)
                      +.+.+++  .||+.+-..|=++=-|++.+.  ..+=..+.+=+.-+-+..+.++++ |+...++|+
T Consensus        72 ile~C~~--lGI~~vT~fAFSieNFkRs~eEVd~LM~L~~~k~~~~~~~~~~~~~~-gvririiGd  134 (271)
T KOG1602          72 ILELCKE--LGIKEVTVFAFSIENFKRSPEEVDGLMDLALEKIERLLEQGEKLDKY-GVRIRVIGD  134 (271)
T ss_pred             HHHHHHH--CCCCEEEEEEEEHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEECC
T ss_conf             9999997--19727998987566407988999999999999999888876667662-707999766


No 385
>COG0496 SurE Predicted acid phosphatase [General function prediction only]
Probab=33.93  E-value=23  Score=15.73  Aligned_cols=33  Identities=21%  Similarity=0.339  Sum_probs=15.6

Q ss_pred             CCCCCEEEEECHHHHH--------HHHHHHHHHHCCCCCCE
Q ss_conf             1288868985117765--------79999866301346311
Q gi|254780767|r   86 SSKPDVLLIVDNPDFT--------HRVAKRVRKKMPNLPII  118 (383)
Q Consensus        86 ~~~Pd~vi~iD~pgFn--------l~lak~lkk~~~~ipvi  118 (383)
                      +.+||+||-==.-|=|        =-+|..+-....|||-|
T Consensus        81 ~~~pDLVvSGIN~G~Nlg~dv~ySGTVaaA~Ea~~~GipsI  121 (252)
T COG0496          81 EPRPDLVVSGINAGANLGDDVIYSGTVAAAMEAALLGIPAI  121 (252)
T ss_pred             CCCCCEEEECCCCCCCCCCCEEEEEHHHHHHHHHHCCCCCE
T ss_conf             78999899676478865511342014999999987296423


No 386
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=33.59  E-value=34  Score=14.66  Aligned_cols=115  Identities=24%  Similarity=0.456  Sum_probs=61.1

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99768214789999999999738998399997178999478806504445311013674664599999999998610012
Q gi|254780767|r    8 VIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSS   87 (383)
Q Consensus         8 i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~   87 (383)
                      ++.|..-++-.|..|.+.+.+  .+++.+.-.+   ..+.|+..-         .+++          -..++.+.+.+.
T Consensus         3 lv~GDSl~~gl~~~l~~~l~~--~~~i~~~~~s---~~stGL~r~---------~~~d----------W~~~~~~~~~~~   58 (200)
T cd01829           3 LVIGDSLAQGLAPGLLRALAD--NPGIRVINRS---KGSSGLVRP---------DFFD----------WPEKLKELIAEE   58 (200)
T ss_pred             EEEECHHHHHHHHHHHHHHHC--CCCEEEEECC---CCCCCCCCC---------CCCC----------HHHHHHHHHHCC
T ss_conf             999131888789999998521--6982999877---457686679---------8578----------799999987457


Q ss_pred             CCCEEEEE----CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEE
Q ss_conf             88868985----11776579999866301346311110022110036635579999986401567742232002553147
Q gi|254780767|r   88 KPDVLLIV----DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTT  163 (383)
Q Consensus        88 ~Pd~vi~i----D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~  163 (383)
                      +||+||..    |..++--           +-..+++-+|.   |.+    ...+-++.++.+       ... +|.++.
T Consensus        59 ~pd~vVv~lG~ND~~~~~~-----------~~~~~~~~s~~---W~~----~Y~~rv~~~l~~-------~~~-~g~~Vi  112 (200)
T cd01829          59 KPDVVVVFLGANDRQDIRD-----------GDGYLKFGSPE---WEE----EYRQRIDELLNV-------ARA-KGVPVI  112 (200)
T ss_pred             CCCEEEEEECCCCCCCCCC-----------CCCEEECCCHH---HHH----HHHHHHHHHHHH-------HHH-CCCEEE
T ss_conf             9998999954777744207-----------99504349847---999----999999999999-------974-598299


Q ss_pred             ECCCCCCCC
Q ss_conf             638821122
Q gi|254780767|r  164 FVGHPLSSS  172 (383)
Q Consensus       164 fVGHPl~d~  172 (383)
                      |+|=|.+..
T Consensus       113 WvglP~~r~  121 (200)
T cd01829         113 WVGLPAMRS  121 (200)
T ss_pred             EEECCCCCC
T ss_conf             983897586


No 387
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]
Probab=33.42  E-value=34  Score=14.65  Aligned_cols=44  Identities=23%  Similarity=0.249  Sum_probs=18.1

Q ss_pred             HHHHCCCCCCCEEEEECHHHH-HHHHHHHHHHHCCCCCCEEEECCCC
Q ss_conf             986100128886898511776-5799998663013463111100221
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDF-THRVAKRVRKKMPNLPIINYVCPSV  125 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgF-nl~lak~lkk~~~~ipvi~yv~Pqv  125 (383)
                      ..+.+++..-|.++..|-|=- .-.+.+.+++.  |+..|..|+|+-
T Consensus       114 F~~~~~~~GvdGlivpDLP~ee~~~~~~~~~~~--gi~~I~lvaPtt  158 (265)
T COG0159         114 FLRRAKEAGVDGLLVPDLPPEESDELLKAAEKH--GIDPIFLVAPTT  158 (265)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC--CCCEEEEECCCC
T ss_conf             999999759987985789866777899999976--986798869999


No 388
>smart00732 YqgFc Likely ribonuclease with RNase H fold. YqgF proteins are likely to function as an alternative to RuvC in most bacteria, and could be the principal holliday junction resolvases in low-GC Gram-positive bacteria. In Spt6p orthologues, the catalytic residues are substituted indicating that they lack enzymatic functions.
Probab=33.18  E-value=34  Score=14.62  Aligned_cols=44  Identities=20%  Similarity=0.350  Sum_probs=21.0

Q ss_pred             HHHHHHHHHCCCCCCCEEEEE--------CHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             999999861001288868985--------117765799998663013463111
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIV--------DNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~i--------D~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      ...+.+.+.+.+++|+.+|.=        .++...-.+++.+++. +++|+++
T Consensus        38 ~~~~~l~~~i~~~~~~~iviG~P~~~~g~~~~~~~~~f~~~l~~~-~~i~v~~   89 (99)
T smart00732       38 ADAARLKKLIKKYQPDLIVIGLPLNMNGTASRETEEAFAELLKER-FNLPVVL   89 (99)
T ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHC-CCCCEEE
T ss_conf             999999999998499889974752489981999999999998517-8998899


No 389
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]
Probab=33.07  E-value=34  Score=14.61  Aligned_cols=36  Identities=14%  Similarity=0.143  Sum_probs=19.5

Q ss_pred             HHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             61001288868985117765799998663013463111
Q gi|254780767|r   82 ELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        82 ~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      ...++.+-=.|+-+|.++=-+++++.|=+-  |++.|-
T Consensus         8 ~~l~~~~vI~Vlr~~~~e~a~~~a~Ali~g--Gi~~IE   43 (211)
T COG0800           8 SKLKAQPVVPVIRGDDVEEALPLAKALIEG--GIPAIE   43 (211)
T ss_pred             HHHHHCCEEEEEEECCHHHHHHHHHHHHHC--CCCEEE
T ss_conf             999878844899708999999999999976--987699


No 390
>cd07365 MhpB_like Subunit B of the Class III Extradiol ring-cleavage dioxygenase, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), which catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate. 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB) catalyzes the oxidization and subsequent ring-opening of 2,3-dihydroxyphenylpropionate, yielding the product 2-hydroxy-6-oxo-nona-2,4-diene 1,9-dicarboxylate.  It is an essential enzyme in the beta-phenylpropionic degradation pathway, in which beta-phenylpropionic is first hydrolyzed to produce 2,3-dihydroxyphenylpropionate. The enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the ca
Probab=32.93  E-value=34  Score=14.59  Aligned_cols=47  Identities=6%  Similarity=0.223  Sum_probs=31.1

Q ss_pred             HHCCEEEHHHHHHH-HHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHH
Q ss_conf             45311013674664-599999999998610012888689851177657
Q gi|254780767|r   56 SELSVIGIMQVVRH-LPQFIFRINQTVELIVSSKPDVLLIVDNPDFTH  102 (383)
Q Consensus        56 ~~l~v~G~~evl~~-~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl  102 (383)
                      ++-..+|+.++=.. .-.+...+.++.+.+.+.+||++|.+-.=.||-
T Consensus         9 SHsPl~g~~dp~~~~~~~v~~a~~~~r~~l~~~~PDvvVv~~~DH~~~   56 (310)
T cd07365           9 SHSPLLGFNDPAPEVVAEVDAAFAAARAFVAAFDPELVVLFAPDHYNG   56 (310)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
T ss_conf             677635899988899999999999999999984999999986238877


No 391
>COG0417 PolB DNA polymerase elongation subunit (family B) [DNA replication, recombination, and repair]
Probab=32.78  E-value=35  Score=14.58  Aligned_cols=43  Identities=26%  Similarity=0.423  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHHHHH-HHHHHHHHCCCCCCE
Q ss_conf             999999986100128886898511776579-999866301346311
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDFTHR-VAKRVRKKMPNLPII  118 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~-lak~lkk~~~~ipvi  118 (383)
                      ...+....+.++...||++++=+..+|-++ |++++++.  |+|..
T Consensus       212 ~e~l~~~~~~i~~~dPdVIvgyn~~~fd~pyl~~Ra~~l--gi~~~  255 (792)
T COG0417         212 AELLERFVELIREYDPDVIVGYNGDNFDWPYLAERAERL--GIPLR  255 (792)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHH--CCCCC
T ss_conf             999999999985029899998367777738999999981--99851


No 392
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=32.43  E-value=35  Score=14.54  Aligned_cols=39  Identities=18%  Similarity=0.474  Sum_probs=25.4

Q ss_pred             HHHHHHCCCCCCCEEEE--ECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             99986100128886898--5117765799998663013463111
Q gi|254780767|r   78 NQTVELIVSSKPDVLLI--VDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~--iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      ...++.....+||.+|+  +|.....=.+... ++.  |||++-
T Consensus        46 ~~~i~~ai~~k~D~Iii~~~D~~~~~~~l~~A-~~a--gIPvv~   86 (280)
T cd06315          46 AAALNQAIALKPDGIVLGGVDAAELQAELELA-QKA--GIPVVG   86 (280)
T ss_pred             HHHHHHHHHCCCCEEEECCCCHHHHHHHHHHH-HHC--CCCEEE
T ss_conf             99999999639999999982978878999999-987--997896


No 393
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion]
Probab=32.41  E-value=35  Score=14.54  Aligned_cols=93  Identities=19%  Similarity=0.268  Sum_probs=49.1

Q ss_pred             HHHHHHHHHHHHH-HCCCCEEEEEECCHHHHH-------CCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7899999999997-389983999971789994-------78806504445311013674664599999999998610012
Q gi|254780767|r   16 DLLAGDLIKSLKE-MVSYPINLVGVGGPSLQK-------EGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSS   87 (383)
Q Consensus        16 D~~~a~li~~Lk~-~~~~~~~~~giGG~~m~~-------~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~i~~~   87 (383)
                      |.+|-...-.||. .....+....+|+++-++       -|.+.-+.+++-+.-|. +++       -..+-+...+++.
T Consensus        39 D~~AvEeAlrLke~~~~~eV~vlt~Gp~~a~~~lr~aLAmGaDraili~d~~~~~~-d~~-------~ta~~Laa~~~~~  110 (260)
T COG2086          39 DLNAVEEALRLKEKGYGGEVTVLTMGPPQAEEALREALAMGADRAILITDRAFAGA-DPL-------ATAKALAAAVKKI  110 (260)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCCCC-CHH-------HHHHHHHHHHHHC
T ss_conf             07999999986146888669999946453399999998548875999703223675-589-------9999999999874


Q ss_pred             CCCEEEE----ECHH--HHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             8886898----5117--76579999866301346311110
Q gi|254780767|r   88 KPDVLLI----VDNP--DFTHRVAKRVRKKMPNLPIINYV  121 (383)
Q Consensus        88 ~Pd~vi~----iD~p--gFnl~lak~lkk~~~~ipvi~yv  121 (383)
                      +||+|++    +|+-  ---..+|..|     |.|.+.|+
T Consensus       111 ~~~LVl~G~qa~D~~t~qvg~~lAe~L-----g~P~~t~v  145 (260)
T COG2086         111 GPDLVLTGKQAIDGDTGQVGPLLAELL-----GWPQVTYV  145 (260)
T ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHH-----CCCEEEEE
T ss_conf             998899813443576466589999986-----98505337


No 394
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=32.40  E-value=35  Score=14.54  Aligned_cols=43  Identities=16%  Similarity=0.125  Sum_probs=30.3

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC
Q ss_conf             999861001288868985117765799998663013463111100
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC  122 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~  122 (383)
                      ....+.+.+.+.+++++--+.+-.+.++..+.+.  ++|++...+
T Consensus        57 ~~a~~Lv~~d~V~aviG~~~S~~~~a~~~~~~~~--~vp~is~~a   99 (334)
T cd06347          57 NAATRLIDQDKVVAIIGPVTSGATLAAGPIAEDA--KVPMITPSA   99 (334)
T ss_pred             HHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHH--CCEEEECCC
T ss_conf             9999999757977997678568789889999971--964871377


No 395
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]
Probab=32.08  E-value=36  Score=14.50  Aligned_cols=125  Identities=15%  Similarity=0.127  Sum_probs=64.0

Q ss_pred             HHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             99999986100128886898511776579999866301346311110022110036635579999986401567742232
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVM  154 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f  154 (383)
                      ....++.+.+...+||+++.|-.|     .|..+.++.-+||++|-..|--=+|+=                 +   +=+
T Consensus        75 ~~a~~iarql~~~~~dviv~i~tp-----~Aq~~~s~~~~iPVV~aavtd~v~a~L-----------------v---~~~  129 (322)
T COG2984          75 GTAAQIARQLVGDKPDVIVAIATP-----AAQALVSATKTIPVVFAAVTDPVGAKL-----------------V---KSL  129 (322)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCH-----HHHHHHHHCCCCCEEEECCCCHHHCCC-----------------C---CCC
T ss_conf             789999999614799679961778-----999999846798879972576332358-----------------7---644


Q ss_pred             HCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             00255314763882112210013558889761876556505998538743012305111899987640273512620166
Q gi|254780767|r  155 QRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       155 ~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
                      ++ .|-+++=|-.+.     +....-+..+  .+-++-+.|+++=.|-..--..    .++-.++..++. ++..+-..+
T Consensus       130 ~~-pg~NvTGvsD~~-----~v~q~i~lik--~~~Pnak~Igv~Y~p~E~ns~~----l~eelk~~A~~~-Gl~vve~~v  196 (322)
T COG2984         130 EQ-PGGNVTGVSDLL-----PVAQQIELIK--ALLPNAKSIGVLYNPGEANSVS----LVEELKKEARKA-GLEVVEAAV  196 (322)
T ss_pred             CC-CCCCEEECCCCC-----HHHHHHHHHH--HHCCCCEEEEEEECCCCCCCHH----HHHHHHHHHHHC-CCEEEEEEC
T ss_conf             47-888436237751-----6999999999--8678870699995798866089----999999999877-988999834


Q ss_pred             CCH
Q ss_conf             336
Q gi|254780767|r  235 SSQ  237 (383)
Q Consensus       235 ~~~  237 (383)
                      ++.
T Consensus       197 ~~~  199 (322)
T COG2984         197 TSV  199 (322)
T ss_pred             CCC
T ss_conf             763


No 396
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional
Probab=31.91  E-value=36  Score=14.49  Aligned_cols=96  Identities=15%  Similarity=0.181  Sum_probs=48.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45999976821478999999999973899839999717899947880650444531101367466459999999999861
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVEL   83 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~~~~~   83 (383)
                      |+|+|..+..     +..++++||+. ..+.++.|.-=+. .+.|.. +.|  +.-++      +.... -...+.+.+.
T Consensus         2 ~nILvt~~G~-----~~~ii~~lk~~-~~~~~Vi~~D~~~-~a~~~~-~aD--~~y~~------P~~~d-~~y~~~ll~i   64 (325)
T PRK12767          2 MNILVTSAGR-----RVQLVKALKKS-LLGGKVIGADISP-LAPALY-FAD--KFYVV------PKVTD-PNYIDALLDI   64 (325)
T ss_pred             CEEEEECCCC-----HHHHHHHHHHC-CCCCEEEEECCCC-CCCCHH-HCC--EEEEC------CCCCC-HHHHHHHHHH
T ss_conf             4899986786-----89999999976-9985999968998-995344-548--89987------88898-7899999999


Q ss_pred             CCCCCCCEEEEE-CHHHHHH-HHHHHHHHHCCCCCCE
Q ss_conf             001288868985-1177657-9999866301346311
Q gi|254780767|r   84 IVSSKPDVLLIV-DNPDFTH-RVAKRVRKKMPNLPII  118 (383)
Q Consensus        84 i~~~~Pd~vi~i-D~pgFnl-~lak~lkk~~~~ipvi  118 (383)
                      ++++++|++|-. |-.-.-+ +.+..+.+.  |++++
T Consensus        65 ~~~~~id~iiP~~d~El~~la~~~~~l~~~--gi~v~   99 (325)
T PRK12767         65 CKKENIDALIPLIDPELPLLAQHRDEFKEI--GVKVL   99 (325)
T ss_pred             HHHHCCCEEEECCCHHHHHHHHHHHHHHHC--CCEEE
T ss_conf             998799999977850266899999999967--99895


No 397
>COG3911 Predicted ATPase [General function prediction only]
Probab=31.85  E-value=29  Score=15.11  Aligned_cols=27  Identities=19%  Similarity=0.250  Sum_probs=21.5

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             98745999976821478999999999973
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIKSLKEM   29 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~~Lk~~   29 (383)
                      ||.||+||++|.+.+-.  ..|+++|.+.
T Consensus         6 ~nR~~~fIltGgpGaGK--TtLL~aLa~~   32 (183)
T COG3911           6 FNRHKRFILTGGPGAGK--TTLLAALARA   32 (183)
T ss_pred             CCCCEEEEEECCCCCCH--HHHHHHHHHC
T ss_conf             56533899837999768--9999999975


No 398
>pfam04414 tRNA_deacylase D-aminoacyl-tRNA deacylase. Several aminoacyl-tRNA synthetases have the ability to transfer the D-isomer of their amino acid onto their cognate tRNA. D-aminoacyl-tRNA deacylases hydrolyse the ester bond between the polynucleotide and the D-amino acid, thereby preventing the accumulation of such mis-acylated and metabolically inactive tRNA molecules.
Probab=31.75  E-value=36  Score=14.47  Aligned_cols=23  Identities=17%  Similarity=0.174  Sum_probs=8.4

Q ss_pred             CCCCHHHHCCCHHH-HHHHHHHCC
Q ss_conf             74301230511189-998764027
Q gi|254780767|r  202 RAQEIYKILPFFES-AVASLVKRN  224 (383)
Q Consensus       202 R~~EI~~~lP~~l~-~~~~l~~~~  224 (383)
                      +..++..--|.+.. ..+.|.+..
T Consensus        47 ~~~~~~~~~P~~~~~~l~~l~~~~   70 (214)
T pfam04414        47 KPGELAIANPRLMTALLRALAKIA   70 (214)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             888578899799999999999857


No 399
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=31.69  E-value=36  Score=14.46  Aligned_cols=96  Identities=8%  Similarity=0.137  Sum_probs=50.5

Q ss_pred             CEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEECCCCC
Q ss_conf             86898511776579999866301346311110022110036635579999986401567742232002553147638821
Q gi|254780767|r   90 DVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPL  169 (383)
Q Consensus        90 d~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~~~~~~fVGHPl  169 (383)
                      +-||.+-|.-|--.+++.+++.  |+|++-.         +.....+               +.-.++ |.++.| |.. 
T Consensus       400 ~~VII~G~GRvGq~var~L~~~--gi~~vvi---------D~d~~~V---------------~~~r~~-G~~v~y-GDa-  450 (615)
T PRK03562        400 PRVIIAGFGRFGQIVGRLLLSS--GVKMVVL---------DHDPDHI---------------ETLRKF-GMKVFY-GDA-  450 (615)
T ss_pred             CCEEEEECCCCHHHHHHHHHHC--CCCEEEE---------ECCHHHH---------------HHHHHC-CCEEEE-ECC-
T ss_conf             9989990280469999999978--9987999---------7999999---------------999967-990897-689-


Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             12210013558889761876556505998538743012305111899987640273512620
Q gi|254780767|r  170 SSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSL  231 (383)
Q Consensus       170 ~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i  231 (383)
                              .+.+..+.-|..+.+-.|.-.+....+         .++++...+.+|++..+.
T Consensus       451 --------t~~~vL~~AGi~~Ar~vViaidd~~~~---------~~iv~~~r~~~P~l~Iia  495 (615)
T PRK03562        451 --------TRMDLLESAGAAKAEVLINAIDDPQTN---------LQLTELVKEHFPHLQIIA  495 (615)
T ss_pred             --------CCHHHHHHCCCCCCCEEEEEECCHHHH---------HHHHHHHHHHCCCCEEEE
T ss_conf             --------999999867914068899994989999---------999999997589986999


No 400
>cd01146 FhuD Fe3+-siderophore binding domain FhuD.  These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.
Probab=31.45  E-value=36  Score=14.44  Aligned_cols=38  Identities=18%  Similarity=0.275  Sum_probs=24.7

Q ss_pred             HHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             8610012888689851177657999986630134631111002
Q gi|254780767|r   81 VELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP  123 (383)
Q Consensus        81 ~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~P  123 (383)
                      .+.|..-+||+||..++  ++-.....|.+.   .|++.+-.+
T Consensus        58 ~E~i~~l~PDLIi~~~~--~~~~~~~~L~~i---ap~v~~~~~   95 (256)
T cd01146          58 LEAIAALKPDLILGSAS--RHDEIYDQLSQI---APTVLLDSS   95 (256)
T ss_pred             HHHHHCCCCCEEEECCC--CCHHHHHHHHHH---CCCCCCCCC
T ss_conf             99996089998996487--688899999734---874555688


No 401
>PRK08621 galactose-6-phosphate isomerase subunit LacA; Reviewed
Probab=31.37  E-value=37  Score=14.43  Aligned_cols=16  Identities=50%  Similarity=0.337  Sum_probs=8.7

Q ss_pred             ECHHHHHHHHHHHHHH
Q ss_conf             5117765799998663
Q gi|254780767|r   95 VDNPDFTHRVAKRVRK  110 (383)
Q Consensus        95 iD~pgFnl~lak~lkk  110 (383)
                      +|||+|-.++|+.+.+
T Consensus        38 ~DYpd~a~~va~~V~~   53 (142)
T PRK08621         38 EDFVDSTLAVAKEVNK   53 (142)
T ss_pred             CCCHHHHHHHHHHHHC
T ss_conf             8816899999999976


No 402
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional
Probab=31.12  E-value=13  Score=17.37  Aligned_cols=58  Identities=16%  Similarity=0.314  Sum_probs=36.5

Q ss_pred             CCCCCCEEEEECHHHHH--H-HHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             01288868985117765--7-99998663013463111100221100366355799999864015677
Q gi|254780767|r   85 VSSKPDVLLIVDNPDFT--H-RVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPF  149 (383)
Q Consensus        85 ~~~~Pd~vi~iD~pgFn--l-~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpF  149 (383)
                      ...+..++|.|++-|.-  + ++.+.++++  |+|+|.=.|...-+.-.+|  ..-. .+ + ++|-|
T Consensus       118 it~~tkaIi~Vh~~G~~~d~~~i~~i~~~~--~i~vIEDaA~a~Ga~~~g~--~~Gs-~g-~-a~fSF  178 (379)
T PRK11658        118 ITPRTKAIIPVHYAGAPADLDAIRAIGERY--GIPVIEDAAHAVGTYYKGR--HIGA-RG-T-AIFSF  178 (379)
T ss_pred             CCCCCEEEEEECCCCCCCCHHHHHHHHHHC--CCEEEECCHHHHCCCCCCC--CCCC-CC-C-EEEEC
T ss_conf             482654999856889866377999999975--9818970835536654798--6676-24-4-57856


No 403
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional
Probab=30.89  E-value=37  Score=14.38  Aligned_cols=13  Identities=15%  Similarity=0.230  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             9999999983899
Q gi|254780767|r  355 HGFENLWDRMNTK  367 (383)
Q Consensus       355 ~~~~~~~~~Lg~~  367 (383)
                      .-.+++.++|+-.
T Consensus       171 ~h~~~i~~KL~v~  183 (196)
T PRK10360        171 VHRANLMEKLGVS  183 (196)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999981999


No 404
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; InterPro: IPR012733   4-hydroxybenzoate 3-monooxygenase is a flavoprotein that converts its substrate to 3,4-dihydroxybenzoate, which subsequently enters the beta-ketioadipate pathway of aromatic degradation, using molecular oxygen and NADPH as shown below . 4-hydroxybenzoate + NADPH + O(2) = 3,4-dihydroxybenzoate + NADP(+) + H(2)O 4-hydroxybenzoate is an intermediate in the degradation of lignin and other aromatic plant compounds, and this enzyme is found extensively in soil bacteria.   This enzyme is a homodimer where each subunit is composed of three distinct domains: an N-terminal flavin-binding domain with a beta-alpha-beta fold, a small substrate-binding domain composed of a single alpha helix and beta-sheet, and a C-terminal helical domain . The active site is found at the interface of all three domains. Catalysis occurs by a two-step reaction. In the first step, flavin is reduced by NADPH. Subsequently, the reduced flavin is oxygenated to a hydroperoxide which transfers the hydroxyl group to the substrate, forming 3,4-dihydroxybenzoate.; GO: 0018659 4-hydroxybenzoate 3-monooxygenase activity, 0050660 FAD binding, 0043639 benzoate catabolic process.
Probab=30.66  E-value=38  Score=14.35  Aligned_cols=23  Identities=39%  Similarity=0.459  Sum_probs=19.2

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             987459999768214789999999
Q gi|254780767|r    1 MNSLKIAVIAGEISGDLLAGDLIK   24 (383)
Q Consensus         1 m~~mki~i~aGE~SGD~~~a~li~   24 (383)
                      |+. +|.|++|.|||=++|-.|=+
T Consensus         1 MkT-qVaIiG~GPsGLLLGQLLh~   23 (393)
T TIGR02360         1 MKT-QVAIIGAGPSGLLLGQLLHK   23 (393)
T ss_pred             CCE-EEEEECCCHHHHHHHHHHHH
T ss_conf             951-79997577357899999986


No 405
>pfam03310 Cauli_DNA-bind Caulimovirus DNA-binding protein.
Probab=30.62  E-value=38  Score=14.35  Aligned_cols=27  Identities=19%  Similarity=0.212  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             674664599999999998610012888
Q gi|254780767|r   64 MQVVRHLPQFIFRINQTVELIVSSKPD   90 (383)
Q Consensus        64 ~evl~~~~~~~~~~~~~~~~i~~~~Pd   90 (383)
                      .|++.....+..-++.+.+.+-..+|+
T Consensus         9 ~~~~~~~k~~~~~i~aiL~~~gs~~p~   35 (121)
T pfam03310         9 RELIQSQKKTANEIKAILERNGSGKPE   35 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999999999999999994789975


No 406
>TIGR03446 mycothiol_Mca mycothiol conjugate amidase Mca. Mycobacterium tuberculosis, Corynebacterium glutamicum, and related species use the thiol mycothiol in place of glutathione. This enzyme, homologous to the (dispensible) MshB enzyme of mycothiol biosynthesis, is described as an amidase that acts on conjugates to mycothiol. It is a detoxification enzyme.
Probab=30.49  E-value=38  Score=14.33  Aligned_cols=27  Identities=19%  Similarity=0.124  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHH
Q ss_conf             999999986100128886898511776
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDF  100 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgF  100 (383)
                      -....++++.|++.+||+||+-|--|-
T Consensus       107 ~eaa~~L~~~ir~~rP~Vvvtyd~~Gg  133 (283)
T TIGR03446       107 EEAAEPLVRVIREFRPHVITTYDENGG  133 (283)
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             999999999999868998994389988


No 407
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Certain closely related transferase enzymes such as Sinorhizobium ExoY and Lactococcus EpsD lack the N-terminal domain and are not found by this model.
Probab=30.38  E-value=38  Score=14.32  Aligned_cols=34  Identities=15%  Similarity=0.196  Sum_probs=15.5

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             59999768214789999999999738998399997178
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGP   42 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~   42 (383)
                      ++.|+.....    |..+++++++....+.++.|+-.+
T Consensus       127 rvlIIG~g~~----~~~l~~~l~~~~~~g~~vvG~~dd  160 (445)
T TIGR03025       127 RVLIVGTGEL----AEELAAALSRNPDLGYRVVGFVDD  160 (445)
T ss_pred             EEEEEECCHH----HHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             3999908489----999999998284688489999778


No 408
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]
Probab=30.26  E-value=38  Score=14.31  Aligned_cols=93  Identities=16%  Similarity=0.295  Sum_probs=53.3

Q ss_pred             CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHCCCC-EEEEEECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             9874599997-68214789999999999738998-399997178999478806504445311013674664599999999
Q gi|254780767|r    1 MNSLKIAVIA-GEISGDLLAGDLIKSLKEMVSYP-INLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRIN   78 (383)
Q Consensus         1 m~~mki~i~a-GE~SGD~~~a~li~~Lk~~~~~~-~~~~giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~   78 (383)
                      |++||+.|+- |--.+..    .+..+++. + + ++..++.....+.+.  ..  -+++.+-             ..+.
T Consensus         1 ~~~irvgiiG~G~~~~~~----~~~~~~~~-~-~~~~~vav~d~~~~~a~--~~--a~~~~~~-------------~~~~   57 (342)
T COG0673           1 MKMIRVGIIGAGGIAGKA----HLPALAAL-G-GGLELVAVVDRDPERAE--AF--AEEFGIA-------------KAYT   57 (342)
T ss_pred             CCCCEEEEECCCHHHHHH----HHHHHHHC-C-CCEEEEEEECCCHHHHH--HH--HHHCCCC-------------CCCC
T ss_conf             993279998987678888----89999738-8-74699999649989999--99--9981997-------------4529


Q ss_pred             HHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             9986100128886898511776579999866301346311
Q gi|254780767|r   79 QTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPII  118 (383)
Q Consensus        79 ~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi  118 (383)
                      ..-+.+....+|+|+..--+.+|..++..+=+.  |.+|+
T Consensus        58 ~~~~ll~~~~iD~V~Iatp~~~H~~~a~~AL~a--GkhVl   95 (342)
T COG0673          58 DLEELLADPDIDAVYIATPNALHAELALAALEA--GKHVL   95 (342)
T ss_pred             CHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHC--CCEEE
T ss_conf             999994599998899969806779999999977--99699


No 409
>cd05785 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.
Probab=30.25  E-value=38  Score=14.31  Aligned_cols=42  Identities=21%  Similarity=0.339  Sum_probs=30.8

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECHHHHHHH-HHHHHHHHCCCCCC
Q ss_conf             999999986100128886898511776579-99986630134631
Q gi|254780767|r   74 IFRINQTVELIVSSKPDVLLIVDNPDFTHR-VAKRVRKKMPNLPI  117 (383)
Q Consensus        74 ~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~-lak~lkk~~~~ipv  117 (383)
                      ..++....+.+.+..||++++=-.-+|-++ |.+++++.  +++.
T Consensus        59 ~~lL~~F~~~i~~~dPDIItGyNi~~FD~pYL~~Ra~~~--~i~~  101 (207)
T cd05785          59 KELLEELVAIIRERDPDVIEGHNIFRFDLPYLRRRCRRH--GVPL  101 (207)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHH--CCCC
T ss_conf             999999999998739999986798775889999999995--9972


No 410
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=30.18  E-value=38  Score=14.30  Aligned_cols=40  Identities=5%  Similarity=0.024  Sum_probs=23.7

Q ss_pred             HHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             999861001288868985117765799998663013463111
Q gi|254780767|r   78 NQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        78 ~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      ....+.+.+.+.+++++--..+-.+.++..+.+.  ++|++.
T Consensus        57 ~~a~~Lv~~~~V~~v~G~~~s~~~~a~~~v~~~~--~v~~i~   96 (340)
T cd06349          57 TIAQKFVADPRIVAVLGDFSSGVSMAASPIYQRA--GLVQLS   96 (340)
T ss_pred             HHHHHHHHCCCCEEEECCCCCHHHHHCCHHHHHH--CEEEEC
T ss_conf             9999998659925862686526553101465542--433203


No 411
>COG4378 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.15  E-value=38  Score=14.29  Aligned_cols=32  Identities=16%  Similarity=0.376  Sum_probs=21.4

Q ss_pred             CCCCCEEEEECHHHHHHH--HHHHHHHHCCCCCCEE
Q ss_conf             128886898511776579--9998663013463111
Q gi|254780767|r   86 SSKPDVLLIVDNPDFTHR--VAKRVRKKMPNLPIIN  119 (383)
Q Consensus        86 ~~~Pd~vi~iD~pgFnl~--lak~lkk~~~~ipvi~  119 (383)
                      ..---+++++||-+.|+-  +-+.++++  +||+.|
T Consensus        43 s~~dlilvLtdf~nHNl~~~iK~eakk~--~ip~~~   76 (103)
T COG4378          43 SDTDLILVLTDFLNHNLMKKIKNEAKKR--KIPLVC   76 (103)
T ss_pred             CCCCEEEEEHHHHCCHHHHHHHHHHHHC--CCCEEE
T ss_conf             9862899885552531899998777624--987698


No 412
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=30.08  E-value=38  Score=14.29  Aligned_cols=21  Identities=29%  Similarity=0.529  Sum_probs=9.7

Q ss_pred             HHHHHHHHHCCCCCCCEEEEE
Q ss_conf             999999861001288868985
Q gi|254780767|r   75 FRINQTVELIVSSKPDVLLIV   95 (383)
Q Consensus        75 ~~~~~~~~~i~~~~Pd~vi~i   95 (383)
                      ..++.+++.+++..|++.|.+
T Consensus        64 ~~~~~li~~ir~~~P~~~iiv   84 (157)
T cd01833          64 DRLRALIDQMRAANPDVKIIV   84 (157)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE
T ss_conf             999999999999789987999


No 413
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides. This group includes the type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides, which are subsequently converted by amidases to yield free carboxylic acids and ammonia. NHases from bacteria and fungi have been purified and characterized. In Rhodococcus sp., the nitrile hydratase operon consists of six genes encoding NHase regulator 2, NHase regulator 1, amidase, NHase alpha subunit, NHase beta subunit, and NHase activator. The operon produces a constitutive hydratase that has a broad substrate spectrum: aliphatic and aromatic nitriles, mononitriles and dinitriles, hydroxynitriles and amino-nitriles, and a constitutive amidase of equally low substrate specificity. NHases are metalloenzymes containing either cobalt or iron, and therefore can be classified int
Probab=30.02  E-value=38  Score=14.28  Aligned_cols=155  Identities=11%  Similarity=0.020  Sum_probs=67.5

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC-------CCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             9999861001288868985117765799998663013463111100-------221100366355799999864015677
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC-------PSVWAWREGRARKMCAYINQVISILPF  149 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~-------PqvWAWr~~R~k~~~~~~d~~~~ifpF  149 (383)
                      .....+.+...+.+++++--+.+..+-++....+   ++|.++-.+       |-+|-++..-.......++        
T Consensus        56 ~~~a~kLi~~~~V~aviG~~~S~~~~A~~~~~~~---~vp~i~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~--------  124 (333)
T cd06358          56 AAAAARLVDEGGVDAIIGWHTSAVRNAVAPVVAG---RVPYVYTSLYEGGECNPGVFLTGETPEQQLAPAIP--------  124 (333)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHC---CCCEEEECCCCCCCCCCCEEEEECCCHHHHHHHHH--------
T ss_conf             9999999975990899877440778988999976---99389704557888889989971780899999999--------


Q ss_pred             CHHHHHCCCCCCEEECCCCCCCC-CCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCE
Q ss_conf             42232002553147638821122-10013558889761876556505998538743012305111899987640273512
Q gi|254780767|r  150 EKEVMQRLGGPPTTFVGHPLSSS-PSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFR  228 (383)
Q Consensus       150 E~~~f~k~~~~~~~fVGHPl~d~-~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~  228 (383)
                         |+.+..|.+..++=++=-+. ......-.+..++.|.    .++.--.      ....-.-|-..+.++....|+..
T Consensus       125 ---~~~~~~g~k~vavi~~d~~~G~~~~~~~~~~~~~~G~----~vv~~~~------~~~~~~Dfs~~l~~i~~~~pD~v  191 (333)
T cd06358         125 ---WLAEEKGARRWYLIGNDYVWPRGSLAAAKRYIAELGG----EVVGEEY------VPLGTTDFTSVLERIAASGADAV  191 (333)
T ss_pred             ---HHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHHCCC----EEEEEEE------CCCCCCCHHHHHHHHHHCCCCEE
T ss_conf             ---9998379978999926834658899999999997498----5999982------79999789999999997498999


Q ss_pred             EEECCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             6201663368899999960488850552
Q gi|254780767|r  229 FSLVTVSSQENLVRCIVSKWDISPEIII  256 (383)
Q Consensus       229 ~~i~~~~~~~~~~~~~~~~~~~~~~i~~  256 (383)
                      +.....+..-.+++ ...+.+....+..
T Consensus       192 ~~~~~~~~~~~~~~-q~~~~G~~~~~~~  218 (333)
T cd06358         192 LSTLVGQDAVAFNR-QFAAAGLRDRILR  218 (333)
T ss_pred             EECCCCCHHHHHHH-HHHHCCCCCCEEE
T ss_conf             99377723999999-9997699987466


No 414
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF). This group includes the type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF), found in bacteria and Archaea. AmiC controls expression of the amidase operon by a ligand-triggered conformational switch. In the absence of ligand or presence of butyramide (repressor), AmiC (the ligand sensor and negative regulator) adopts an open conformation and inhibits the transcription antitermination function of AmiR by direct protein-protein interaction.  In the presence of inducing ligands such as acetamide, AmiC adopts a closed conformation which disrupts a silencing AmiC-AmiR complex and the expression of amidase and other genes of the operon is induced. FmdDEF is predicted to be an ATP-dependent transporter and closely resembles the periplasmic binding protein and the two t
Probab=29.90  E-value=39  Score=14.27  Aligned_cols=41  Identities=15%  Similarity=0.060  Sum_probs=29.1

Q ss_pred             HHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9999861001288868985117765799998663013463111
Q gi|254780767|r   77 INQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIIN  119 (383)
Q Consensus        77 ~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~  119 (383)
                      .....+.+.+.+.+++|+--+.+-.+.++..+.+.  ++|+++
T Consensus        56 ~~~a~~Li~~d~V~~iiG~~~S~~~~A~~~~~~~~--~vp~i~   96 (333)
T cd06331          56 AKAARRLIRDDKVDAVFGCYTSASRKAVLPVVERG--RGLLFY   96 (333)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCHHHHHHCHHHHHC--CCCEEE
T ss_conf             99999999728964996687607777643078875--997780


No 415
>PRK13372 pcmA protocatechuate 4,5-dioxygenase; Provisional
Probab=29.75  E-value=26  Score=15.42  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             9999999999861001288868985
Q gi|254780767|r   71 PQFIFRINQTVELIVSSKPDVLLIV   95 (383)
Q Consensus        71 ~~~~~~~~~~~~~i~~~~Pd~vi~i   95 (383)
                      ..++.-+.-..+++++.+||++|+|
T Consensus       178 kP~FdGy~p~r~Wl~e~kPDV~ilv  202 (444)
T PRK13372        178 KKLFAGYDLSREWAKEHLPDVIILV  202 (444)
T ss_pred             HHHHCCCCHHHHHHHHCCCCEEEEE
T ss_conf             6665278288999986599989999


No 416
>PRK05872 short chain dehydrogenase; Provisional
Probab=29.67  E-value=39  Score=14.24  Aligned_cols=39  Identities=21%  Similarity=0.416  Sum_probs=27.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH
Q ss_conf             599997682147899999999997389983999971789994
Q gi|254780767|r    5 KIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQK   46 (383)
Q Consensus         5 ki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~giGG~~m~~   46 (383)
                      |+.+++|-.||  .|..+.+.|-++ +..+-+.+.-.+.+++
T Consensus        10 KvalITGassG--IG~aiA~~la~~-Ga~Vvl~dr~~~~l~~   48 (296)
T PRK05872         10 KVVFVTGAARG--VGAELARRLHAR-GAKVALVDLEEAELAA   48 (296)
T ss_pred             CEEEEECCCCH--HHHHHHHHHHHC-CCEEEEEECCHHHHHH
T ss_conf             87999271058--999999999987-9989999899999999


No 417
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppA is found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. This subfamily contains members with either a single domain (sometimes referred to as 36K type), such as sohB peptidase, protein C and archaeal signal peptide peptidase, or an amino-terminal domain in addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members (sometimes referred to as 67K type), similar to E. coli and Arabidopsis thaliana SppA peptidases. Site-directed mutagenesis and sequence analysis have shown these SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad 
Probab=29.59  E-value=39  Score=14.23  Aligned_cols=76  Identities=11%  Similarity=0.222  Sum_probs=35.1

Q ss_pred             CCCCCCEEE-EECHHHHHHH----HHHHHHHH-CCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHC-------------C
Q ss_conf             012888689-8511776579----99986630-134631111002211003663557999998640-------------1
Q gi|254780767|r   85 VSSKPDVLL-IVDNPDFTHR----VAKRVRKK-MPNLPIINYVCPSVWAWREGRARKMCAYINQVI-------------S  145 (383)
Q Consensus        85 ~~~~Pd~vi-~iD~pgFnl~----lak~lkk~-~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~-------------~  145 (383)
                      .+.+-+.|| -||+||=..-    ++..+++- ..+.||+=|+.-.-    ..-...+.-..|.++             .
T Consensus        31 ~d~~vk~ivL~idSpGG~~~~s~ei~~~i~~~k~~~KpV~a~~~~~a----aSg~Y~lAs~ad~I~a~p~s~vGSIGv~~  106 (208)
T cd07023          31 EDDSVKAVVLRINSPGGSVVASEEIYREIRRLRKAKKPVVASMGDVA----ASGGYYIAAAADKIVANPTTITGSIGVIG  106 (208)
T ss_pred             HCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH----HCHHHHHHHCCCEEEECCCCEECCCCEEE
T ss_conf             08997489999748996299999999999987514985999977711----13345655128779977876333200366


Q ss_pred             CCCCCHHHHHCCCCCCEEEC
Q ss_conf             56774223200255314763
Q gi|254780767|r  146 ILPFEKEVMQRLGGPPTTFV  165 (383)
Q Consensus       146 ifpFE~~~f~k~~~~~~~fV  165 (383)
                      .++|-.+++++. |++.+.+
T Consensus       107 ~~~~~~~~l~k~-Gi~~~~~  125 (208)
T cd07023         107 QGPNLEELLDKL-GIERDTI  125 (208)
T ss_pred             ECCCHH