HHsearch alignment for GI: 254780767 and conserved domain: pfam04007

>pfam04007 DUF354 Protein of unknown function (DUF354). Members of this family are around 350 amino acids in length. They are found in archaebacteria and have no known function.
Probab=99.34  E-value=9.8e-11  Score=90.81  Aligned_cols=300  Identities=17%  Similarity=0.165  Sum_probs=173.7

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE----EECCHHHHHCCCEEEECHHHCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             4599997682147899999999997389983999----971789994788065044453110136746645999999999
Q gi|254780767|r    4 LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLV----GVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQ   79 (383)
Q Consensus         4 mki~i~aGE~SGD~~~a~li~~Lk~~~~~~~~~~----giGG~~m~~~G~~~~~~~~~l~v~G~~evl~~~~~~~~~~~~   79 (383)
T Consensus         1 MkIwiDI~~p~hvhfFk~iI~eL~k~-GheV~iTaR~~~~~~~LL~~y~i~~~----~iG~~g~-s~~~Kl~~~~~R~~~   74 (335)
T pfam04007         1 LKVWIDITNAPHVHFFKPIISELEKE-GYEVLLTCRKFGELPELLRSLGFQVK----SIGKHGA-TLIKKLLSSAERVYL   74 (335)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHCCCCEE----EECCCCC-CHHHHHHHHHHHHHH
T ss_conf             93999789950888899999999868-98899999613519999997699769----9758888-889999999999999


Q ss_pred             HHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHCCC
Q ss_conf             986100128886898511776579999866301346311110-0221100366355799999864015677422320025
Q gi|254780767|r   80 TVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-CPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLG  158 (383)
Q Consensus        80 ~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~~~f~k~~  158 (383)
T Consensus        75 L~~~~~~~~PDv~is~~S~~a~-~va~-----~LgipsI~f~Dteh--a~~~~~--Lt~Pf~~~i~~P~~~~~~~~~~~-  143 (335)
T pfam04007        75 LTKLIPEKKPDVAIMKNSMELP-RVAF-----GLRIPSIIVLDNEH--ALAANK--LTFPLADYILVPEIIDDEFLRFF-  143 (335)
T ss_pred             HHHHHHHHCCCEEEECCCHHHH-HHHH-----HCCCCEEEEECCHH--HCCCCE--EEEECCCEEECCCCCCHHHHHHH-
T ss_conf             9999886299789944880199-9998-----82998799947755--412330--23123868881244677899860-


Q ss_pred             CCC---EEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCC-CHHHHCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             531---4763882112210013558889761876556505998538743-012305111899987640273512620166
Q gi|254780767|r  159 GPP---TTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQ-EIYKILPFFESAVASLVKRNPFFRFSLVTV  234 (383)
Q Consensus       159 ~~~---~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~-EI~~~lP~~l~~~~~l~~~~~~~~~~i~~~  234 (383)
T Consensus       144 G~~~~i~~y~g~~E~a~l~~F~Pd~~vl~~lgl~~-~~yIvvR~~~~~A~y~~g~~~i~~~ii~~l~~~-~~~iv~~pr~  221 (335)
T pfam04007       144 GADNRIRTYPGIKEIANISDYVPDPEILKKLGLEF-EEYIVMRPEPLASSYVNGHESILPEIIEMLTKE-GVNIIYFPRN  221 (335)
T ss_pred             CCCCCEEEECCCCEEEECCCCCCCHHHHHHCCCCC-CCEEEEEECCCCCEECCCCCCHHHHHHHHHHHC-CCCEEEECCC
T ss_conf             87785676668441432166689865787649987-988999616455600114421599999999875-9819997587


Q ss_pred             CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEE
Q ss_conf             33688999999604888505520552035788763552331156688876275302540577410000102467610230
Q gi|254780767|r  235 SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALP  314 (383)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~Lp  314 (383)
T Consensus       222 ~~q~----~~~~~~~--v~i~~~~vd~~~Lly~adl~Ig~GgTMa~EAAlLGtPaIs~~p~~~~~-vd~~l~~~------  288 (335)
T pfam04007       222 KEQR----EIFRGFD--VIIPKKPVDTLSLLYYSDLVIGAGGTMNREAALLGTPAVSCYPGKLLA-VDKYLIEK------  288 (335)
T ss_pred             CHHH----HHHCCCC--EECCCCCCCHHHHHHHCCEEECCCHHHHHHHHHHCCCEEEECCCCCCH-HHHHHHHC------
T ss_conf             0366----7750477--036788877788886546897275689999998289879843885213-67999867------


Q ss_pred             HHHCCCCCCCHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             2440784261242054898999999999844
Q gi|254780767|r  315 NLIVDYPLVPEYFNSMIRSEALVRWIERLSQ  345 (383)
Q Consensus       315 Nii~~~~ivPEliQ~~~~~~~i~~~~~~ll~  345 (383)
T Consensus       289 ------g----l~~~~~d~~~i~~~v~~~~~  309 (335)
T pfam04007       289 ------G----EMYHSTDPREIVNYVISNLK  309 (335)
T ss_pred             ------C----CEEEECCHHHHHHHHHHHHH
T ss_conf             ------9----87961898999999999860