HHsearch results for GI: 254780767 and protein with PDBid: 2jzc_A

>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae}
Probab=92.64  E-value=0.019  Score=34.64  Aligned_cols=36  Identities=8%  Similarity=0.164  Sum_probs=28.9

Q ss_pred             CCHHHH-HHHHHHHCCCHHHHH-HHHHHCCCEEEECCC
Q ss_conf             203578-876355233115668-887627530254057
Q gi|254780767|r  260 QKKQVF-MTCNAAMAASGTVIL-ELALCGIPVVSIYKS  295 (383)
Q Consensus       260 ~~~~~l-~~sd~ai~~SGTaTL-E~al~g~P~IV~Yk~  295 (383)
                      +..+.+ ..||++|+-+|+.|+ |++.+|+|.|++-+.
T Consensus       124 ~~~~~~~~~adlvIshaG~gti~e~l~~~kp~i~vP~~  161 (224)
T 2jzc_A          124 KMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVND  161 (224)
T ss_dssp             SHHHHHHHHCSCEEESSCHHHHHHHHHTTCCCCEECCS
T ss_pred             HHHHHHHHHCCEEEECCCHHHHHHHHHHCCCEEEEECC
T ss_conf             37899864236888568647999999968998998377