HHsearch results for GI: 254780767 and protein with PDBid: 2x6q_A

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xmp_A*
Probab=99.47  E-value=4.4e-11  Score=91.66  Aligned_cols=339  Identities=14%  Similarity=0.119  Sum_probs=179.1

Q ss_pred             CCCCEEEEEEC-CCCH--HHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEEECHHH-----CC---EEEHHHHHHH
Q ss_conf             98745999976-8214--789999999999738998399997178999478806504445-----31---1013674664
Q gi|254780767|r    1 MNSLKIAVIAG-EISG--DLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSE-----LS---VIGIMQVVRH   69 (383)
Q Consensus         1 m~~mki~i~aG-E~SG--D~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~~~~~~-----l~---v~G~~evl~~   69 (383)
                      |+.|||..+.. ...|  -.....|++.+++. +.++++.-+-|+.=       .|+.+.     +.   ...+.+-.+.
T Consensus        38 l~~mkVlhvn~t~~gGGva~~~~~lv~~~~~~-G~~~~~~V~~~~~~-------~f~vtk~~hn~lqg~~~~~~~~~~~~  109 (416)
T 2x6q_A           38 LKGRSFVHVNSTSFGGGVAEILHSLVPLLRSI-GIEARWFVIEGPTE-------FFNVTKTFHNALQGNESLKLTEEMKE  109 (416)
T ss_dssp             TTTCEEEEEESCSSSSTHHHHHHHHHHHHHHT-TCEEEEEECCCCHH-------HHHHHHHHHHHHTTCCSCCCCHHHHH
T ss_pred             HCCCEEEEEECCCCCCHHHHHHHHHHHHHHHC-CCCEEEEEECCCCC-------HHHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             53998999967987775999999999999976-99569997079932-------77999988787528987677989999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEE-----CCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             5999999999986100128886898511776579999866301346311110-----02211003663557999998640
Q gi|254780767|r   70 LPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYV-----CPSVWAWREGRARKMCAYINQVI  144 (383)
Q Consensus        70 ~~~~~~~~~~~~~~i~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv-----~PqvWAWr~~R~k~~~~~~d~~~  144 (383)
                        .+........+.+...++|+|+.=|...  +.+...+++   +.|++|..     .|+-..|+-  .+.+-+.+|.++
T Consensus       110 --~~~~~~~~~~~~~~~~~~DiVhiHd~~~--~~l~~~~~~---~~p~i~~~Hi~~~~~~~~~~~~--l~~~i~~~d~~I  180 (416)
T 2x6q_A          110 --LYLNVNRENSKFIDLSSFDYVLVHDPQP--AALIEFYEK---KSPWLWRCHIDLSSPNREFWEF--LRRFVEKYDRYI  180 (416)
T ss_dssp             --HHHHHHHHHHHSSCGGGSSEEEEESSTT--GGGGGGSCC---CSCEEEECCSCCSSCCHHHHHH--HHHHHTTSSEEE
T ss_pred             --HHHHHHHHHHHHHHCCCCCEEEEECCCH--HHHHHHHHC---CCCEEEEECCCCCCCHHHHHHH--HHHHHHHCCEEE
T ss_conf             --9999999999871136999899978755--899999843---8969999747888743999999--999998589999


Q ss_pred             CCCCCCHHHHHC-CCCCCEEECCCCC---CCCCC--CCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHH
Q ss_conf             156774223200-2553147638821---12210--01355888976187655650599853874301230511189998
Q gi|254780767|r  145 SILPFEKEVMQR-LGGPPTTFVGHPL---SSSPS--ILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVA  218 (383)
Q Consensus       145 ~ifpFE~~~f~k-~~~~~~~fVGHPl---~d~~~--~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~  218 (383)
                      +..   .+|.++ ...-++.++-|.+   .+...  ........++++++++++++|+ +.| |-.+ .+....+++++.
T Consensus       181 ~~~---~~~~~~~l~~~k~~vIpngID~~~~~n~~~~~~~~~~~~~~~~i~~~~~iil-~vG-r~~~-~Kg~~~li~a~~  254 (416)
T 2x6q_A          181 FHL---PEYVQPELDRNKAVIMPPSIDPLSEKNVELKQTEILRILERFDVDPEKPIIT-QVS-RFDP-WKGIFDVIEIYR  254 (416)
T ss_dssp             ESS---GGGSCTTSCTTTEEECCCCBCTTSTTTSCCCHHHHHHHHHHTTCCTTSCEEE-EEC-CCCT-TSCHHHHHHHHH
T ss_pred             EEC---HHHHHHHCCCCCEEEEECCCCCHHHCCCCCCHHHHHHHHHHCCCCCCCEEEE-EEE-CCCH-HCCCHHHHHHHH
T ss_conf             965---9999721880358999389584011256899999999999809498991899-980-4703-118738999999


Q ss_pred             HHHHCCCCCEEEECCCCCH-----HHHHHHHHHHCCCCCE----EEE---ECCCCHHHHHHHHHHHCCC-----HHHHHH
Q ss_conf             7640273512620166336-----8899999960488850----552---0552035788763552331-----156688
Q gi|254780767|r  219 SLVKRNPFFRFSLVTVSSQ-----ENLVRCIVSKWDISPE----III---DKEQKKQVFMTCNAAMAAS-----GTVILE  281 (383)
Q Consensus       219 ~l~~~~~~~~~~i~~~~~~-----~~~~~~~~~~~~~~~~----i~~---~~~~~~~~l~~sd~ai~~S-----GTaTLE  281 (383)
                      .+.+++|++++++......     ....+..+.+......    +..   ..++...+++.||+.+..|     |.+.+|
T Consensus       255 ~l~~~~p~~~l~ivG~~~~~~~~~~~~~~~~l~~l~~~~~i~~~v~~~~~~~~~~~~~~~~adi~v~pS~~E~~~~~~lE  334 (416)
T 2x6q_A          255 KVKEKIPGVQLLLVGVMAHDDPEGWIYFEKTLRKIGEDYDVKVLTNLIGVHAREVNAFQRASDVILQMSIREGFGLTVTE  334 (416)
T ss_dssp             HHHHHCTTCEEEEEECCCTTCHHHHHHHHHHHHHHTTCTTEEEEEGGGTCCHHHHHHHHHHCSEEEECCSSCSSCHHHHH
T ss_pred             HHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHH
T ss_conf             99986899679999527877806579999999999986698249998999989999999965223455555555427999


Q ss_pred             HHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHH-HH
Q ss_conf             87627530254057741000010246761023024407842612420548989999999998449899999999999-99
Q gi|254780767|r  282 LALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFE-NL  360 (383)
Q Consensus       282 ~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~-~~  360 (383)
                      ++.+|+|.| +...+.+...+.    -...|+        ++     +  +++.+++.+..+++|++.++++.++.. .+
T Consensus       335 Ama~G~PvI-~s~~gg~~e~i~----~~~~G~--------l~-----~--d~~~la~~I~~ll~d~~~~~~~~~~ar~~v  394 (416)
T 2x6q_A          335 AMWKGKPVI-GRAVGGIKFQIV----DGETGF--------LV-----R--DANEAVEVVLYLLKHPEVSKEMGAKAKERV  394 (416)
T ss_dssp             HHHTTCCEE-EESCHHHHHHCC----BTTTEE--------EE-----S--SHHHHHHHHHHHHHCHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCEE-EECCCCHHHHHC----CCCEEE--------EC-----C--CHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             998699899-926997188850----797489--------81-----9--999999999999779999999999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCC
Q ss_conf             99838999989999999998619
Q gi|254780767|r  361 WDRMNTKKPAGHMAAEIVLQVLG  383 (383)
Q Consensus       361 ~~~Lg~~~~a~~~AA~~I~~~Lg  383 (383)
                      .+....+..+ +.-.+++.++.|
T Consensus       395 ~~~fs~~~~~-~~~~~ly~~L~G  416 (416)
T 2x6q_A          395 RKNFIITKHM-ERYLDILNSLGG  416 (416)
T ss_dssp             HHHTBHHHHH-HHHHHHHHTC--
T ss_pred             HHHCCHHHHH-HHHHHHHHHCCC
T ss_conf             9868999999-999999987769