HHsearch results for GI: 254780767 and protein with PDBid: 3fro_A

>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthase, two rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} PDB: 2bis_A*
Probab=99.30  E-value=1e-09  Score=82.64  Aligned_cols=335  Identities=13%  Similarity=0.052  Sum_probs=172.3

Q ss_pred             CCCEEEEEECC----CCHH--HHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCEEE-------------ECHHHCC---
Q ss_conf             87459999768----2147--899999999997389983999971789994788065-------------0444531---
Q gi|254780767|r    2 NSLKIAVIAGE----ISGD--LLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSL-------------FDFSELS---   59 (383)
Q Consensus         2 ~~mki~i~aGE----~SGD--~~~a~li~~Lk~~~~~~~~~~giGG~~m~~~G~~~~-------------~~~~~l~---   59 (383)
                      +.|||.+++=+    .||-  .+...|.++|.++ +.++++.--+.+..+.+....+             .......   
T Consensus         1 ~~MkIl~~~~~~~P~~~GG~~~~~~~La~~L~~~-Gh~V~vvtp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~   79 (439)
T 3fro_A            1 RHMKVLLLGFEFLPVKVGGLAEALTAISEALASL-GHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYR   79 (439)
T ss_dssp             CCCEEEEECSCCTTSCSSSHHHHHHHHHHHHHHT-TCEEEEEEECTTCSCCEEEEEEEETTEEEEEEEEEEEETTEEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHCCCCEECCCCCCEEEEEECCCCCEEEE
T ss_conf             9709999888679856787999999999999976-998999915898755444255012154431012344158807997


Q ss_pred             ------------EEEHHHHHHHHHHHHHHHHHHHHHC--CCCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEC---
Q ss_conf             ------------1013674664599999999998610--01288868985117765799998663013463111100---
Q gi|254780767|r   60 ------------VIGIMQVVRHLPQFIFRINQTVELI--VSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVC---  122 (383)
Q Consensus        60 ------------v~G~~evl~~~~~~~~~~~~~~~~i--~~~~Pd~vi~iD~pgFnl~lak~lkk~~~~ipvi~yv~---  122 (383)
                                  ..+....+.+...+.+........+  ....||++..-|.+.  .-++..+++. .++|+++.+-   
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pDiIh~~~~~~--~~~~~~~~~~-~~~~~v~~~h~~~  156 (439)
T 3fro_A           80 IGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHT--VFAGALIKKY-FKIPAVFTIHRLN  156 (439)
T ss_dssp             EESGGGGCSSTTCSHHHHHHHHHHHHHHHHHHHHHHHTTTSCCCSEEEEESGGG--HHHHHHHHHH-HCCCEEEEESCCC
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCHH--HHHHHHHHHH-CCCCEEEEECCCC
T ss_conf             275534542236765025899999889999999999997279984899888427--8999999850-4998799964664


Q ss_pred             CCCCCCC---C---------CC---HHHHHHHHHHHCCCCCCCH----HHHHCCCCCCEEECCCCCCCCC--------CC
Q ss_conf             2211003---6---------63---5579999986401567742----2320025531476388211221--------00
Q gi|254780767|r  123 PSVWAWR---E---------GR---ARKMCAYINQVISILPFEK----EVMQRLGGPPTTFVGHPLSSSP--------SI  175 (383)
Q Consensus       123 PqvWAWr---~---------~R---~k~~~~~~d~~~~ifpFE~----~~f~k~~~~~~~fVGHPl~d~~--------~~  175 (383)
                      ++-+.|.   .         .+   -+...+..|.+.+..+...    .+|.... -++..+-|++-...        ..
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~-~~i~vi~ng~d~~~~~~~~~~~~~  235 (439)
T 3fro_A          157 KSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFE-GKITYVFNGIDCSFWNESYLTGSR  235 (439)
T ss_dssp             CCCEEHHHHHHTTCGGGCCSSEECHHHHHHHHCSEEEESCHHHHHHTHHHHGGGT-TSEEECCCCCCTTTSCGGGSCSCH
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHCCCC-CCEEEECCCCCCHHHCCCCCCCCH
T ss_conf             4567520122124103456778899998886468899888899999987637871-148997488660120200023205


Q ss_pred             CCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHH--CCCCCEEEECCCCCH--HHHHHHHHHHCCCC
Q ss_conf             13558889761876556505998538743012305111899987640--273512620166336--88999999604888
Q gi|254780767|r  176 LEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVK--RNPFFRFSLVTVSSQ--ENLVRCIVSKWDIS  251 (383)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~--~~~~~~~~i~~~~~~--~~~~~~~~~~~~~~  251 (383)
                      .......+++++++++ . ..++-|+. .+.++.+..+++++..+..  ..+++++++......  +...+......+ +
T Consensus       236 ~~~~~~~~~~~~~~~~-~-~il~~g~l-~~~~Kg~~~li~a~~~~~~~~~~~~~~l~ivG~~~~~~~~~~~~~~~~~~-~  311 (439)
T 3fro_A          236 DERKKSLLSKFGMDEG-V-TFMFIGRF-DRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHG-N  311 (439)
T ss_dssp             HHHHHHHHHHHTCCSC-E-EEEEECCS-SCTTBCHHHHHHHHHHHHTSGGGGGEEEEEECCCCHHHHHHHHHHHHHCT-T
T ss_pred             HHHHHHHHHHHCCCCC-C-EEEEECCC-CCCCCCHHHEEECCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCC-C
T ss_conf             6779999998468878-6-69985232-34665533212000223222357773799953797301467877765045-3


Q ss_pred             CEEEE---ECCCCHHHHHHHHHHHCCC-----HHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCCCEEEEHHHCCCCCC
Q ss_conf             50552---0552035788763552331-----156688876275302540577410000102467610230244078426
Q gi|254780767|r  252 PEIII---DKEQKKQVFMTCNAAMAAS-----GTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLV  323 (383)
Q Consensus       252 ~~i~~---~~~~~~~~l~~sd~ai~~S-----GTaTLE~al~g~P~IV~Yk~~~lt~~i~~lik~~~i~LpNii~~~~iv  323 (383)
                      ..+..   ..++....++.||+.+.+|     |.+.+|++.+|+| ||+..++.+...               +-++.- 
T Consensus       312 ~~~~~~~~~~~~~~~~~~~adv~~~~s~~E~~~~~~~Eama~G~P-vI~~~~g~~~ei---------------i~~~~G-  374 (439)
T 3fro_A          312 VKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAI-PIASAVGGLRDI---------------ITNETG-  374 (439)
T ss_dssp             EEEECSCCCHHHHHHHHTTCSEEEECBSCCSSCHHHHHHHHTTCE-EEEESSTHHHHH---------------CCTTTC-
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCC-EEEECCCCCHHE---------------EECCCE-
T ss_conf             289973266788999876321355555232231799999987998-999379982650---------------888948-


Q ss_pred             CHHHCCCCCHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHH
Q ss_conf             1242054898999999999844-9899999999999999983
Q gi|254780767|r  324 PEYFNSMIRSEALVRWIERLSQ-DTLQRRAMLHGFENLWDRM  364 (383)
Q Consensus       324 PEliQ~~~~~~~i~~~~~~ll~-d~~~r~~~~~~~~~~~~~L  364 (383)
                       -++ +.-+++.+++.+.++++ |++.++++.++..+..++.
T Consensus       375 -~lv-~~~d~~~la~~i~~ll~~~~~~~~~~~~~~~~~~~~~  414 (439)
T 3fro_A          375 -ILV-KAGDPGELANAILKALELSRSDLSKFRENCKKRAMSF  414 (439)
T ss_dssp             -EEE-CTTCHHHHHHHHHHHHHHTTTTTHHHHHHHHHHHHTS
T ss_pred             -EEE-CCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHC
T ss_conf             -998-7999999999999998379999999999999999969