BLAST/PSIBLAST alignment of GI: 254780767 and GI: 86357546 at iteration 1
>gi|86357546|ref|YP_469438.1| lipid-A-disaccharide synthase [Rhizobium etli CFN 42] Length = 389
>gi|86281648|gb|ABC90711.1| lipid A-disaccharide synthase protein [Rhizobium etli CFN 42] Length = 389
 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 274/379 (72%), Gaps = 3/379 (0%)

Query: 4   LKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGI 63
           LKIAVIAGE+SGDLL  DLI +LK + S P+ LVGVGG  LQ EGL SLFDFSELS++GI
Sbjct: 6   LKIAVIAGEVSGDLLGADLIAALKRIYSGPVELVGVGGEGLQAEGLKSLFDFSELSIMGI 65

Query: 64  MQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCP 123
            QV+  LP+    I +T   IV++KPD+L+I+D+PDFTHRVAKRVR  +P+LP++NYVCP
Sbjct: 66  TQVLSRLPRLFGLIRRTTAEIVAAKPDILVIIDSPDFTHRVAKRVRTALPDLPVVNYVCP 125

Query: 124 SVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRN 183
           SVWAW+E RA +M  Y++ V+++LPFE   MQRL GP TT+VGH L + P++LE  ++R 
Sbjct: 126 SVWAWKEYRATRMLGYVDHVLAVLPFEPAAMQRLNGPATTYVGHRLVADPALLE--TRRL 183

Query: 184 KQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRC 243
           +    P     ILLLPGSR+ EI K+LP+FE A   LV RN   RF L TV+ ++ LVR 
Sbjct: 184 RLGRQPGN-GPILLLPGSRSSEIRKLLPYFEVATNELVARNGSMRFILPTVTHRQALVRE 242

Query: 244 IVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFI 303
           + + W + PEI++  + K + F   +AAMAASGTVILELAL  +PVVS YK +WI+    
Sbjct: 243 MTAGWAVKPEIVVGTQAKWKAFAEADAAMAASGTVILELALADVPVVSAYKVDWIMRMLT 302

Query: 304 FYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDR 363
             IKTWT ALPNLI DYP+VPEY N ++R  +L RW+ERLS DT Q +AM  G+E +W R
Sbjct: 303 SGIKTWTGALPNLIADYPVVPEYLNDVVRGASLARWMERLSADTYQLKAMKEGYELIWQR 362

Query: 364 MNTKKPAGHMAAEIVLQVL 382
           M T+KP G  AAEI+L VL
Sbjct: 363 MQTEKPPGEHAAEILLDVL 381