RPSBLAST alignment for GI: 254780767 and conserved domain: TIGR03492

>gnl|CDD|163290 TIGR03492, TIGR03492, conserved hypothetical protein. This protein family is restricted to the Cyanobacteria, in one or two copies, save for instances in the genus Deinococcus. This protein shows some sequence similarity, especially toward the C-terminus, to lipid-A-disaccharide synthase (TIGR00215 or pfam02684). The function is unknown. Length = 396
 Score = 38.4 bits (90), Expect = 0.003
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 156 RLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFES 215
           R  G   +++G+P      +++      ++    +   +I LLPGSR  E Y+ L     
Sbjct: 176 RRQGVRASYLGNP------MMDGLEPPERKPL-LTGRFRIALLPGSRPPEAYRNLKLLLR 228

Query: 216 AVASLVKRNPF-FRFSLV 232
           A+ +L    PF F  ++V
Sbjct: 229 ALEALPDSQPFVFLAAIV 246