HHsearch results for GI: 254780770 and protein with PDBid: 1s9c_A

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S
Probab=96.91  E-value=0.0075  Score=36.12  Aligned_cols=79  Identities=24%  Similarity=0.328  Sum_probs=46.6

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEE
Q ss_conf             34799950225669999863463454432997763026775236413600221288899999999720777999999999
Q gi|254780770|r   56 GHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV  135 (161)
Q Consensus        56 gHFp~~PvmPGvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v  135 (161)
                      ..||+ |++.|.+..=.+   +..+.......+...   +.+ -++||.+||+|||+|++++..   .++...+++.+..
T Consensus       207 ~gf~~-~i~hG~~t~~~~---~~~~~~~~~~~~~~~---~~~-~~~rf~~PV~~gdtl~~~~~~---~~~~~~~~~~~~~  275 (298)
T 1s9c_A          207 AGFDK-PILHGLCTFGFS---ARRVLQQFADNDVSR---FKA-VKARFAKPVYPGQTLQTEMWK---EGNRIHFQTKVQE  275 (298)
T ss_dssp             TTCSS-CCCCHHHHHHHH---HHHHHHHHSTTCGGG---EEE-EEEEECSCCCTTCEEEEEEEE---ETTEEEEEEEETT
T ss_pred             CCCCC-CEECHHHHHHHH---HHHHHHHHCCCCCEE---EEE-EEEEECCCCCCCCEEEEEEEE---ECCEEEEEEEECC
T ss_conf             78998-223307899999---888887616888236---899-999971465999999999999---8999999999935


Q ss_pred             CCEEEEEEEE
Q ss_conf             9999998999
Q gi|254780770|r  136 ENTVVAEAEI  145 (161)
Q Consensus       136 ~~~~va~a~l  145 (161)
                      +|++|.+...
T Consensus       276 ~g~~vl~~~~  285 (298)
T 1s9c_A          276 TGDIVISNAY  285 (298)
T ss_dssp             TTEEEEEEEE
T ss_pred             CCEEEEECCE
T ss_conf             9949985957