HHsearch results for GI: 254780770 and protein with PDBid: 1s9c_A

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S
Probab=94.62  E-value=0.16  Score=28.10  Aligned_cols=59  Identities=8%  Similarity=0.067  Sum_probs=43.9

Q ss_pred             EEEEECCCCEEEEEEEECCEEEEEEEEEEEE----CCEEEEEEEEEECCEEEEEEEEEEEEEC
Q ss_conf             6775236413600221288899999999720----7779999999999999998999999844
Q gi|254780770|r   93 PYLMSIDKARFRKPVFPGDRLEYHVNKVRNR----VDLWKFQCCAKVENTVVAEAEICAMVMH  151 (161)
Q Consensus        93 ~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~----~~~~~~~~~~~v~~~~va~a~l~~~i~~  151 (161)
                      ..+-+-..+++++|+.+|++|+..+++....    +.......+...+++.+|+.+.++.+..
T Consensus        86 ~lvH~eq~i~~hrPlp~g~~l~~~~rv~~v~dk~~G~~v~~~~~~~~~g~~v~t~~st~~~rg  148 (298)
T 1s9c_A           86 KVLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVG  148 (298)
T ss_dssp             -CEEEEEEEEESSCCCSSEEEEEEEEEEEEC-----CEEEEEEEEESSSSEEEEEEEEEEC--
T ss_pred             HCEECCCEEEEECCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEECCCCEEEEEEEEEEEEE
T ss_conf             712110279997345889838999999324316786499999999458937999988799982