HHsearch results for GI: 254780770 and protein with PDBid: 1tbu_A

>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3
Probab=96.04  E-value=0.077  Score=30.03  Aligned_cols=79  Identities=22%  Similarity=0.163  Sum_probs=57.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEE
Q ss_conf             56699998634634544329977630267752364136002212888999999997207779999999999999998999
Q gi|254780770|r   66 GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEI  145 (161)
Q Consensus        66 GvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l  145 (161)
                      |+..-..+||+..+  +...-. .+..+  - .=.+-|.++..|+..++++++..+..+++..-.+.++-+|++++++..
T Consensus        39 ~vfGG~~~AQal~A--A~~tv~-~~~~~--h-Slh~~Fl~~g~~~~pi~~~Ve~lrdGrsf~tr~V~a~Q~g~~i~~~~~  112 (118)
T 1tbu_A           39 GTFGGTLVSQSLLA--SLHTVP-LNFFP--T-SLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMI  112 (118)
T ss_dssp             -CCHHHHHHHHHHH--HHTTSC-TTCEE--E-EEEEEECSCCCTTSCCEEEEEEEEECSSEEEEEEEEEETTEEEEEEEE
T ss_pred             CEEHHHHHHHHHHH--HHHHCC-CCCCC--E-EEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEEEECCEEEEEEEE
T ss_conf             45689999999999--996679-87764--6-799996268899999999999985799789899999989998899999


Q ss_pred             EEEEE
Q ss_conf             99984
Q gi|254780770|r  146 CAMVM  150 (161)
Q Consensus       146 ~~~i~  150 (161)
                      +|.+.
T Consensus       113 sF~~~  117 (118)
T 1tbu_A          113 LFAVQ  117 (118)
T ss_dssp             EEEC-
T ss_pred             EEEEC
T ss_conf             97305