HHsearch results for GI: 254780770 and protein with PDBid: 2f3x_A

>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5
Probab=98.36  E-value=1.9e-05  Score=51.66  Aligned_cols=109  Identities=13%  Similarity=0.163  Sum_probs=72.6

Q ss_pred             EEEEEEEEECCCEEEEEEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEE
Q ss_conf             47899998469749999982688831313479995022566999986346345443299776302677523641360022
Q gi|254780770|r   28 LVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPV  107 (161)
Q Consensus        28 ~ID~i~~~~~g~~~~g~k~v~~~e~ff~gHFp~~PvmPGvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V  107 (161)
                      ++-+++++++|+++.....++.+....     ...+.-|-++ =++|-+++..+  ...     ...+...-+++|.+||
T Consensus        43 ~~gel~~~~~g~~a~s~~~v~~~m~~~-----~~givHGg~i-~alaDsaa~~a--~~~-----~~~vT~~~~I~Fl~pv  109 (157)
T 2f3x_A           43 VIGEIIDLELDDQAISILEIKQEHVFS-----RNQIARGHHL-FAQANSLAVAV--IDD-----ELALTASADIRFTRQV  109 (157)
T ss_dssp             SSSEEEEEETTTEEEEEEECCGGGBCT-----TTCBBCHHHH-HHHHHHHHHHT--SCS-----SCCEEEEEEEEECSCC
T ss_pred             HHHHHEEECCCCCEEEEEECCHHHHCC-----CCCEECHHHH-HHHHHHHHHHH--CCC-----CCEEEEEEEEEEECCC
T ss_conf             532213662898359998647888369-----9986838999-99999999987--699-----8589999988994677


Q ss_pred             EECCEEEEEEEEEEEECCE--EEEEEEEEECCEEEEEEEEEEEE
Q ss_conf             1288899999999720777--99999999999999989999998
Q gi|254780770|r  108 FPGDRLEYHVNKVRNRVDL--WKFQCCAKVENTVVAEAEICAMV  149 (161)
Q Consensus       108 ~PGd~L~i~~~i~~~~~~~--~~~~~~~~v~~~~va~a~l~~~i  149 (161)
                      .+||+|+.++++.+..+..  +.++++.++++++|++|++..+.
T Consensus       110 ~~Gd~l~a~a~v~~~~~~~~~~~v~v~~~~g~~iV~~G~f~v~r  153 (157)
T 2f3x_A          110 KQGERVVAKAKVTAVEKEKGRTVVEVNSYVGEEIVFSGRFDMYR  153 (157)
T ss_dssp             BTTCEEEEEEEEEEEETGGGEEEEEEEEEETTEEEEEEEEEEEC
T ss_pred             CCCCEEEEEEEEEEECCCEEEEEEEEEEEECCEEEEEEEEEEEE
T ss_conf             89989999999999889299999999985399999999999999