HHsearch results for GI: 254780770 and protein with PDBid: 2fs2_A

>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A
Probab=97.52  E-value=0.0031  Score=38.46  Aligned_cols=108  Identities=18%  Similarity=0.143  Sum_probs=67.4

Q ss_pred             EEEEEECCCEEEEEEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             99998469749999982688831313479995022566999986346345443299776302677523641360022128
Q gi|254780770|r   31 KVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPG  110 (161)
Q Consensus        31 ~i~~~~~g~~~~g~k~v~~~e~ff~gHFp~~PvmPGvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V~PG  110 (161)
                      +++++++| +++....+++  ++..   |..-+-=|++.  +++-.++.++......    .. ...--++.|.+|+..|
T Consensus        26 ~v~~~~~g-~~~~~~~v~~--~~~n---~~G~~HGG~l~--tl~D~a~~~a~~~~~~----~~-vT~~~~v~fl~p~~~G   92 (151)
T 2fs2_A           26 DIISMDEG-FAVVTMTVTA--QMLN---GHQSCHGGQLF--SLADTAFAYACNSQGL----AA-VASACTIDFLRPGFAG   92 (151)
T ss_dssp             EEEEEETT-EEEEEEECCG--GGBC---TTSBBCHHHHH--HHHHHHHHHHHHTTTC----CC-EEEEEEEEECSCCBTT
T ss_pred             EEEEEECC-EEEEEEECCH--HHCC---CCCCEEEEEEH--HHHHHHHHHHHHHCCC----CE-EEEEEEEEEEECCCCC
T ss_conf             99999699-9999999499--9919---99958888601--1278999999984699----47-9998778897146899


Q ss_pred             CEEEEEEEEEEEECCEEEEEEEEE-ECCEEEEEEEEEEEEEC
Q ss_conf             889999999972077799999999-99999998999999844
Q gi|254780770|r  111 DRLEYHVNKVRNRVDLWKFQCCAK-VENTVVAEAEICAMVMH  151 (161)
Q Consensus       111 d~L~i~~~i~~~~~~~~~~~~~~~-v~~~~va~a~l~~~i~~  151 (161)
                      +.|+.++++.+..+.++.++++++ .+|++||.+.-+...+.
T Consensus        93 ~~l~a~a~v~~~Gr~~~~~~~~i~d~~g~lvA~~~gt~~~i~  134 (151)
T 2fs2_A           93 DTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHRIG  134 (151)
T ss_dssp             CEEEEEEEEEEECSSEEEEEEEEECTTSCEEEEEEEEEEC--
T ss_pred             CEEEEEEEEEECCCCEEEEEEEEEECCCCEEEEEEEEEEEEC
T ss_conf             899999999991798999999999389979999998999979