HHsearch results for GI: 254780770 and protein with PDBid: 2gf6_A

>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1
Probab=97.09  E-value=0.011  Score=35.21  Aligned_cols=65  Identities=18%  Similarity=0.218  Sum_probs=54.5

Q ss_pred             EEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEEEECCCCCC
Q ss_conf             26775236413600221288899999999720777999999999999999899999984452002
Q gi|254780770|r   92 PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEK  156 (161)
Q Consensus        92 ~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l~~~i~~~~~e~  156 (161)
                      ..+...-.+++|++++.+||++++.+.+.+.++....+.-+++.+|+++|+++...+..+.++.+
T Consensus        56 ~~~vv~~~~~~y~~~~~~~~~v~v~~~v~~~~~~s~~~~~~i~~~g~~~a~~~~~~v~~d~~~~k  120 (135)
T 2gf6_A           56 LWFVIAESHAIYHRPVKLGDKLTVLLNPKILSNKTIKFEFKVLKDGELTTEGYVIQIAINPKIWK  120 (135)
T ss_dssp             EEEEEEEEEEEECSCCCTTCEEEEEEEEEECSSSEEEEEEEEEETTEEEEEEEEEEEEEETTTTE
T ss_pred             CEEEEEEEECCCCCCCCCCEEEEEEEEEEEECCCEEEEEEEEEECCEEEEEEEEEEEEEECCCCC
T ss_conf             67999987000476211561799999999953559999999975998999999999999999994