HHsearch results for GI: 254780770 and protein with PDBid: 2own_A

>2own_A Putative oleoyl-[acyl-carrier protein] thioesterase; NP_784467.1, oleoyl thioesterase (putative), structural genomics; 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8
Probab=94.88  E-value=0.12  Score=28.93  Aligned_cols=48  Identities=21%  Similarity=0.232  Sum_probs=34.2

Q ss_pred             CCEEEEEEEECCEEEEEEEEEEEEC-CEEEEEEEEEECCEEEEEEEEEE
Q ss_conf             4136002212888999999997207-77999999999999999899999
Q gi|254780770|r  100 KARFRKPVFPGDRLEYHVNKVRNRV-DLWKFQCCAKVENTVVAEAEICA  147 (161)
Q Consensus       100 ~~kF~~~V~PGd~L~i~~~i~~~~~-~~~~~~~~~~v~~~~va~a~l~~  147 (161)
                      .+.|++++..||++.+.+.+.+... ...........+|+++|+|+++.
T Consensus       206 ~i~y~~e~~~gd~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~w  254 (262)
T 2own_A          206 DVRYENEVKYGQTVTAHANILPSEVADQVTTSHLIEVDDEKCCEVTIQW  254 (262)
T ss_dssp             EEEECSCCCTTCEEEEEEEEECCSSTTEEEEEEEEEETTEEEEEEEEEE
T ss_pred             EEEECCCCCCCCEEEEEEEEEECCCCCEEEEEEEEECCCEEEEEEEEEE
T ss_conf             9999046899998999999974588531799999958499999999996