HHsearch results for GI: 254780770 and protein with PDBid: 3d6l_A

>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni}
Probab=97.58  E-value=0.002  Score=39.51  Aligned_cols=87  Identities=17%  Similarity=0.169  Sum_probs=64.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEE---C---C
Q ss_conf             225669999863463454432997763026775236413600221288899999999720777999999999---9---9
Q gi|254780770|r   64 MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV---E---N  137 (161)
Q Consensus        64 mPGvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v---~---~  137 (161)
                      +-|=.+.+-|-++++..+....    +...+..+++++.|++||..||.|++++++....+....+.++++.   +   .
T Consensus        24 l~GG~l~~~~D~~a~~~a~~~~----~~~~vt~~i~~i~F~~Pv~~Gd~v~~~a~v~~~GrsS~~V~vev~~~~~~~~~~   99 (137)
T 3d6l_A           24 IFGGWILSQIDLAGAIAARELS----PERVVTISMDKVVFKEPVFIGDIISCYSKVVNVGNTSISVEVEVTAQRVDSQGC   99 (137)
T ss_dssp             BCHHHHHHHHHHHHHHHHHTSS----SSEEEEEEEEEEECCSCCCTTCEEEEEEEEEEECSSEEEEEEEEEEEEECTTSC
T ss_pred             EEHHHHHHHHHHHHHHHHHHHC----CCCEEEEEECCEEECCCCCCCCEEEEEEEEEECCCCEEEEEEEEEEEECCCCCC
T ss_conf             9189999999999999999976----996699997448985766779799999999983574899999999995578874


Q ss_pred             -E--EEEEEEEEEEEECCCC
Q ss_conf             -9--9998999999844520
Q gi|254780770|r  138 -T--VVAEAEICAMVMHEKK  154 (161)
Q Consensus       138 -~--~va~a~l~~~i~~~~~  154 (161)
                       +  .++++.++++-++++-
T Consensus       100 ~~~~~v~~a~ftfVavd~~g  119 (137)
T 3d6l_A          100 TSCINVTSALVTYVSVTRDG  119 (137)
T ss_dssp             EEEEEEEEEEEEEEEECTTS
T ss_pred             EEEEEEEEEEEEEEEECCCC
T ss_conf             27999999999999989997