HHSEARCH alignment of GI: 254780770 and SCOP domain: d1z54a1

Alignment
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
Probab=97.01  E-value=0.0027  Score=37.33  Aligned_cols=61  Identities=15%  Similarity=0.077  Sum_probs=51.3

Q ss_pred             EEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEEEECC
Q ss_conf             2677523641360022128889999999972077799999999999999989999998445
Q gi|254780770|r   92 PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHE  152 (161)
Q Consensus        92 ~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l~~~i~~~  152 (161)
                      ......-..++|++++.+||.+++++.+.+.++....+.-+++.+|+++|+|+.+.+-.+.
T Consensus        52 ~~~~v~~~~~~y~~~~~~~d~i~v~~~v~~i~~~s~~~~~~i~~~g~~~a~~~~~~v~~~~  112 (132)
T d1z54a1          52 VFFPVVELGLTFRAPARFGEVVEVRTRLAELSSRALLFRYRVEREGVLLAEGFTRHLCQVG  112 (132)
T ss_dssp             EECCEEEEEEEECSCCCTTCEEEEEEEEEEECSSEEEEEEEEEETTEEEEEEEEEEECEES
T ss_pred             CEEEEEEEEEEEHHHCCCCCEEEEEEEEEECCCEEEEEEEEEEECCEEEEEEEEEEEECCC
T ss_conf             5069998876422127988689998899874978999999999899999999999999159


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: 4HBT-like
domain: Probable thioesterase TTHA0908
species: Thermus thermophilus [TaxId: 274]