HHSEARCH alignment of GI: 254780770 and SCOP domain: d2gf6a1

Alignment
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=96.76  E-value=0.017  Score=32.62  Aligned_cols=66  Identities=18%  Similarity=0.219  Sum_probs=55.1

Q ss_pred             EEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEEEECCCCCCC
Q ss_conf             267752364136002212888999999997207779999999999999998999999844520023
Q gi|254780770|r   92 PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKN  157 (161)
Q Consensus        92 ~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l~~~i~~~~~e~~  157 (161)
                      ..+...-..++|++++.+||.+.+.+.+.+.++....+.-++..||+++|+|....+.++.++.+.
T Consensus        55 ~~~~v~~~~~~y~~~~~~~d~v~v~~~~~~~~~~s~~~~~~i~~~g~~~a~~~~~~v~~d~~~~~~  120 (134)
T d2gf6a1          55 LWFVIAESHAIYHRPVKLGDKLTVLLNPKILSNKTIKFEFKVLKDGELTTEGYVIQIAINPKIWKS  120 (134)
T ss_dssp             EEEEEEEEEEEECSCCCTTCEEEEEEEEEECSSSEEEEEEEEEETTEEEEEEEEEEEEEETTTTEE
T ss_pred             CCEEEEEEEEEEECCCCCCCCCEEEEEEEEECCEEEEEEEEEECCCEEEEEEEEEEEEEECCCCCC
T ss_conf             605899976676214423332014668862088799999999519889999999999999999938


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: 4HBT-like
domain: Hypothetical protein SSO2295
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]