HHSEARCH alignment of GI: 254780770 and SCOP domain: d2hlja1

Alignment
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}
Probab=96.47  E-value=0.026  Score=31.42  Aligned_cols=68  Identities=7%  Similarity=-0.020  Sum_probs=54.6

Q ss_pred             EEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEE--CCEEEEEEEEEEEEECCCCCCCCC
Q ss_conf             26775236413600221288899999999720777999999999--999999899999984452002344
Q gi|254780770|r   92 PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV--ENTVVAEAEICAMVMHEKKEKNES  159 (161)
Q Consensus        92 ~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v--~~~~va~a~l~~~i~~~~~e~~~~  159 (161)
                      ...+..-.+++|++++..||.+.+++.+....+....+..++..  +++++|+++...+-++.++-|.-+
T Consensus        54 ~~~vv~~~~i~y~~~l~~gd~i~V~~~i~~~~~~~~~~~~~i~~~~~~~l~a~~~~~~v~vD~~trk~~~  123 (156)
T d2hlja1          54 NSLFTLEAHINYLHEVKLGTEVWVQTQILGFDRKRLHVYHSLHRAGFDEVLAASEQMLLHVDLAGPQSAP  123 (156)
T ss_dssp             TTEEEEEEEEEECSCCBTTCEEEEEEEEEEECSSEEEEEEEEEETTEEEEEEEEEEEEEEBCC---CBCC
T ss_pred             CCHHHHHHEEEECCCCCCCCCEEEEEEECCCCCCEEEEEEEECCCCHHHHEEEEEEEEEEEECCCCCCCC
T ss_conf             2102201001212234435442899852046774178776520232024001546999999889997778


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: 4HBT-like
domain: Hypothetical protein PP0301
species: Pseudomonas putida [TaxId: 303]