BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP
dehydratase [Candidatus Liberibacter asiaticus str. psy62]
         (161 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040447|gb|ACT57243.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 161

 Score =  337 bits (865), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG
Sbjct: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV
Sbjct: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161
           RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
Sbjct: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161


>gi|140063965|gb|ABO82469.1| 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier protein]
           dehydratase [Candidatus Liberibacter asiaticus]
          Length = 161

 Score =  336 bits (862), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           MISDLACLDAKDIVELM+FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG
Sbjct: 1   MISDLACLDAKDIVELMQFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV
Sbjct: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161
           RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
Sbjct: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161


>gi|315121987|ref|YP_004062476.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495389|gb|ADR51988.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 160

 Score =  266 bits (680), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (90%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M++  A L A DI+ELM+FLPHRYPFLLVD++++I+ DESAIGIKNVTFNEPHFMGHFPG
Sbjct: 1   MVNKFAQLGAIDIIELMKFLPHRYPFLLVDRIIDIKGDESAIGIKNVTFNEPHFMGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
            PVMPGVLILEGMAQTAGA+CAIHNGFD++ P YLMSIDKARFRKPV PGDRLE+HV+K+
Sbjct: 61  MPVMPGVLILEGMAQTAGAVCAIHNGFDKHEPAYLMSIDKARFRKPVVPGDRLEFHVHKL 120

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNES 159
           RNR D+WKF+C AKVEN VV+EA+ICA++M EKK KNES
Sbjct: 121 RNRSDIWKFRCQAKVENCVVSEADICAIIMREKKGKNES 159


>gi|307942152|ref|ZP_07657503.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Roseibium
           sp. TrichSKD4]
 gi|307774438|gb|EFO33648.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Roseibium
           sp. TrichSKD4]
          Length = 161

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 116/147 (78%), Gaps = 5/147 (3%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L++ DI+++M+ LPHRYPFLL+DK++ +  D+S IGIKNVT NEPHF GHFPG+PVMPG
Sbjct: 15  TLESADILKIMKLLPHRYPFLLIDKIIEMDGDQSGIGIKNVTINEPHFNGHFPGQPVMPG 74

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           VL++E MAQTAGA+C    G D  APP   Y M+IDKA+FRKPV PGD++ +HVNK++ R
Sbjct: 75  VLLIEAMAQTAGALCVNSRGVD--APPQLVYFMTIDKAKFRKPVGPGDQVHFHVNKIKQR 132

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVM 150
            ++WKF+  AKVE   VAEAEI AM++
Sbjct: 133 ANIWKFEAVAKVEGAKVAEAEISAMLV 159


>gi|222085866|ref|YP_002544397.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Agrobacterium radiobacter K84]
 gi|254783842|sp|B9JEX9|FABZ_AGRRK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|221723314|gb|ACM26470.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Agrobacterium radiobacter K84]
          Length = 157

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/151 (58%), Positives = 114/151 (75%), Gaps = 1/151 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VD+++ I  D SAIGIKNVT NEP F GHFPG P+MP
Sbjct: 7   TSLSSADIIEIMKLLPHRYPFLMVDRIIEIDSDNSAIGIKNVTANEPQFTGHFPGSPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA  +G       Y M+ID ARFRKPV PGDR+E+HV K + R  
Sbjct: 67  GVLLIEGMAQTAGAICARKDGIGGNL-VYFMTIDNARFRKPVVPGDRVEFHVVKQKQRGT 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKKEK 156
           +WKF C AKV+ +VVAEA+I AM++ +  ++
Sbjct: 126 IWKFHCDAKVDGSVVAEADIGAMIVRKDPDQ 156


>gi|328543721|ref|YP_004303830.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [polymorphum gilvum SL003B-26A1]
 gi|326413465|gb|ADZ70528.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Polymorphum gilvum SL003B-26A1]
          Length = 154

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 113/149 (75%), Gaps = 3/149 (2%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           D A L + DI+ LM  LPHRYPFLLVDK++ +  D+S IGIKNVT NEPHF GHFP RPV
Sbjct: 5   DKATLGSADIMRLMELLPHRYPFLLVDKIIEMDGDQSCIGIKNVTINEPHFQGHFPSRPV 64

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           MPGVL++E MAQTAGA+C    G D + P   Y M+IDKA+FRKPV PGDR+E+HVNK++
Sbjct: 65  MPGVLLIEAMAQTAGALCVNSLGAD-HTPQLVYFMTIDKAKFRKPVGPGDRVEFHVNKIK 123

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVM 150
            R ++WKF   AKV+   VAEAEI AM++
Sbjct: 124 QRSNIWKFDAIAKVDGVKVAEAEISAMLV 152


>gi|163760892|ref|ZP_02167971.1| (3R)-hydroxymyristoyl ACP dehydratase [Hoeflea phototrophica
           DFL-43]
 gi|162281936|gb|EDQ32228.1| (3R)-hydroxymyristoyl ACP dehydratase [Hoeflea phototrophica
           DFL-43]
          Length = 157

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/152 (59%), Positives = 113/152 (74%), Gaps = 3/152 (1%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           +  L + DI ++MR LPHRYPFLLVD++V I  D SAIG+KNVT +EPHF GHFPG P+M
Sbjct: 6   ITSLASADIRDIMRLLPHRYPFLLVDRIVEIDSDNSAIGLKNVTASEPHFTGHFPGNPIM 65

Query: 65  PGVLILEGMAQTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           PGVLI+EGMAQTAGAICA    G D     Y M+ID A+FRKPV PGDRLEYHV K++ R
Sbjct: 66  PGVLIIEGMAQTAGAICARAKGGGDNLV--YFMTIDNAKFRKPVVPGDRLEYHVTKIKQR 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
            ++W+F C A V+ + VAEA+I AM+   + E
Sbjct: 124 GNIWRFHCEAMVDGSKVAEADIGAMLAPSESE 155


>gi|114704866|ref|ZP_01437774.1| (3R)-hydroxymyristoyl ACP dehydratase [Fulvimarina pelagi HTCC2506]
 gi|114539651|gb|EAU42771.1| (3R)-hydroxymyristoyl ACP dehydratase [Fulvimarina pelagi HTCC2506]
          Length = 156

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 86/144 (59%), Positives = 112/144 (77%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L++ D++++M+ LPHRYPFL+VD++V I  D SA+GIKNVT NEPHF+GHFPG PVMPG
Sbjct: 7   VLESADVLKIMQVLPHRYPFLMVDRIVEIDGDRSAVGIKNVTANEPHFLGHFPGNPVMPG 66

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLI+EGMAQTAGAIC +  G    +  Y M+ID A+FRKPV PGD+LEYHV + + R ++
Sbjct: 67  VLIIEGMAQTAGAICTMSKGERSPSIVYFMTIDNAKFRKPVVPGDKLEYHVVQSKKRGNI 126

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           WKF C AKV+   VAEA + AM++
Sbjct: 127 WKFDCVAKVDGAKVAEATVSAMLV 150


>gi|90419601|ref|ZP_01227511.1| 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier protein]
           dehydratase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336538|gb|EAS50279.1| 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier protein]
           dehydratase [Aurantimonas manganoxydans SI85-9A1]
          Length = 150

 Score =  192 bits (489), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 107/142 (75%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI+E+M  LPHRYPFLLVD++++I  D SAIGIKNVT NEPHF GHFP  PVMPGV
Sbjct: 3   LESADILEIMELLPHRYPFLLVDRIIDIDGDRSAIGIKNVTANEPHFQGHFPTAPVMPGV 62

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILEGMAQTAGAIC    G       YLM+ID A+FRKPV PGDR+EYHV + + R  +W
Sbjct: 63  LILEGMAQTAGAICTRATGGGTPQLVYLMTIDGAKFRKPVVPGDRIEYHVTQSKKRGSIW 122

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF C A+V+   VAEA + AM+
Sbjct: 123 KFDCVAQVDGVKVAEAVVSAML 144


>gi|325292746|ref|YP_004278610.1| 3R-hydroxymyristoyl-ACP dehydratase [Agrobacterium sp. H13-3]
 gi|325060599|gb|ADY64290.1| 3R-hydroxymyristoyl-ACP dehydratase [Agrobacterium sp. H13-3]
          Length = 155

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 113/150 (75%), Gaps = 1/150 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L A DI+E+M+ LPHRYPFLL+DK++ I  + SAIGIKNVT NEPHF GHFP RP+MP
Sbjct: 7   TTLGAADILEVMKLLPHRYPFLLIDKIIEIDGNNSAIGIKNVTVNEPHFTGHFPDRPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVLI+E MAQTAGAICA   G   Y   Y M+ID ARFR+PV PGDRLE HV K R R +
Sbjct: 67  GVLIVEAMAQTAGAICARSQGEGGYL-VYFMTIDNARFRRPVVPGDRLEIHVVKQRQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           ++KF C AKVE  +VAEA++ AM++ E ++
Sbjct: 126 VFKFHCEAKVEGALVAEADVGAMMIPEDQQ 155


>gi|227821906|ref|YP_002825876.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sinorhizobium fredii NGR234]
 gi|254788934|sp|C3MBR1|FABZ_RHISN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|227340905|gb|ACP25123.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Sinorhizobium fredii NGR234]
          Length = 154

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 1/148 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L   D+ E++R LPHRYPFLLVD+++ I  D SAIGIKNVT NEPHF GHFP +P+MP
Sbjct: 6   TVLGTADLQEILRLLPHRYPFLLVDRIIEIDDDNSAIGIKNVTANEPHFTGHFPEKPIMP 65

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+ID ARFRKPV PGDR+E+HV K + R +
Sbjct: 66  GVLLIEGMAQTAGAICARKTGIGSNL-VYFMTIDNARFRKPVVPGDRVEFHVTKQKQRGN 124

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEK 153
           +WKF C AKV+  +VAEA+I AM++ ++
Sbjct: 125 IWKFHCDAKVDGQLVAEADIGAMIVSKE 152


>gi|159184740|ref|NP_354390.2| (3R)-hydroxymyristoyl-ACP dehydratase [Agrobacterium tumefaciens
           str. C58]
 gi|24211699|sp|Q8UFL4|FABZ_AGRT5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|159140028|gb|AAK87175.2| (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase
           [Agrobacterium tumefaciens str. C58]
          Length = 154

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 113/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L   DI+E+M+ LPHRYPFLL+DK++ I  D SAIGIKNVT NEPHF GHFP RP+MP
Sbjct: 7   ATLGTADILEVMKLLPHRYPFLLIDKIIEIDGDSSAIGIKNVTVNEPHFTGHFPDRPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVLI+E MAQTAGAICA + G   +   Y M+ID ARFR+PV PGDRLE HV K R R +
Sbjct: 67  GVLIVEAMAQTAGAICARNQGEGGHL-VYFMTIDNARFRRPVVPGDRLEIHVVKQRQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           ++KF C AKVE  +VAEA++ AM++ E +
Sbjct: 126 VFKFHCEAKVEGALVAEADVGAMMIPEGQ 154


>gi|15965257|ref|NP_385610.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sinorhizobium meliloti 1021]
 gi|307309280|ref|ZP_07588948.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sinorhizobium meliloti BL225C]
 gi|307317022|ref|ZP_07596463.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sinorhizobium meliloti AK83]
 gi|20138268|sp|Q92Q46|FABZ_RHIME RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|15074437|emb|CAC46083.1| Probable 3R-hydroxymyristoyl-acyl carrier protein dehydratase
           [Sinorhizobium meliloti 1021]
 gi|306897110|gb|EFN27855.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sinorhizobium meliloti AK83]
 gi|306900281|gb|EFN30898.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sinorhizobium meliloti BL225C]
          Length = 154

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 1/148 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L   DI E++R LPHRYPFLLVD+++ I  D SAIGIKNVT NEPHF GHFP +P+MP
Sbjct: 6   TVLGTADIQEILRLLPHRYPFLLVDRIIEIDDDNSAIGIKNVTANEPHFTGHFPEKPIMP 65

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+ID ARFRKPV PGDR+E+HV K + R +
Sbjct: 66  GVLLIEGMAQTAGAICARKTGIGSNL-VYFMTIDNARFRKPVVPGDRVEFHVVKQKQRGN 124

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEK 153
           +WKF C AKV+  +VAEA+I AM++ ++
Sbjct: 125 IWKFHCDAKVDGQLVAEADIGAMIVSKE 152


>gi|209549191|ref|YP_002281108.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226700253|sp|B5ZN92|FABZ_RHILW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|209534947|gb|ACI54882.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 155

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/149 (59%), Positives = 113/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VDK++ I  D SAIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADIIEIMKLLPHRYPFLMVDKIIEIDGDNSAIGIKNVTVNEPHFTGHFPEAPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIEGMAQTAGAICAKKEG-QPGNLVYFMTIENARFRKPVVPGDRVEFHVAKHKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKV+  VVAEA+I AM++ +++
Sbjct: 126 IWKFHCDAKVDGAVVAEADIGAMIVRKEQ 154


>gi|190891616|ref|YP_001978158.1| lipid A biosynthesis (3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Rhizobium etli CIAT 652]
 gi|226700252|sp|B3PYQ1|FABZ_RHIE6 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190696895|gb|ACE90980.1| lipid A biosynthesis (3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase protein [Rhizobium etli CIAT 652]
          Length = 155

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VDK++ I  D +AIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADIIEIMKLLPHRYPFLMVDKIIEIDGDNAAIGIKNVTVNEPHFTGHFPESPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIEGMAQTAGAICAKKEG-QPGNLVYFMTIENARFRKPVVPGDRVEFHVKKHKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKVE  +VAEA+I AM++ + +
Sbjct: 126 IWKFHCDAKVEGALVAEADIGAMIVRKDQ 154


>gi|116251986|ref|YP_767824.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|241204513|ref|YP_002975609.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|158564211|sp|Q1MH45|FABZ_RHIL3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|115256634|emb|CAK07722.1| putative lipid A biosynthesis (3R)-hydroxymyristoyl-[acyl carrier
           protein] dehydratase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240858403|gb|ACS56070.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 155

 Score =  190 bits (482), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VDK++ I  D +AIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADIIEIMKLLPHRYPFLMVDKIIEIDGDNTAIGIKNVTVNEPHFTGHFPESPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA  +G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIEGMAQTAGAICAKKDG-QPGNLVYFMTIENARFRKPVVPGDRVEFHVRKHKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKV+  +VAEA+I AM++ + +
Sbjct: 126 IWKFHCDAKVDGALVAEADIGAMIVRKDQ 154


>gi|86357543|ref|YP_469435.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium etli CFN 42]
 gi|109828947|sp|Q2K8X8|FABZ_RHIEC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|86281645|gb|ABC90708.1| (3R)-hydroxymyristoyl-(acyl carrier) dehydratase protein [Rhizobium
           etli CFN 42]
          Length = 155

 Score =  189 bits (481), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 111/149 (74%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI E+M+ LPHRYPFL+VDK++ I  D +AIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADITEIMKLLPHRYPFLMVDKIIEIDGDNTAIGIKNVTVNEPHFTGHFPEAPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIEGMAQTAGAICAKKEG-QTGNLVYFMTIENARFRKPVVPGDRVEFHVKKNKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKV+  +VAEA+I AM++ + +
Sbjct: 126 IWKFHCDAKVDGALVAEADIGAMIVRKDQ 154


>gi|150396359|ref|YP_001326826.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sinorhizobium medicae
           WSM419]
 gi|166233439|sp|A6U8L1|FABZ_SINMW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|150027874|gb|ABR59991.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sinorhizobium medicae WSM419]
          Length = 154

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 1/148 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L   DI E+++ LPHRYPFLLVD+++ I  D SAIGIKNVT NEPHF GHFP +P+MP
Sbjct: 6   TVLGTADIQEILKLLPHRYPFLLVDRIIEIDSDNSAIGIKNVTANEPHFTGHFPEKPIMP 65

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+ID ARFRKPV PGDR+E+HV K + R +
Sbjct: 66  GVLLIEGMAQTAGAICARKTGGGSNL-VYFMTIDNARFRKPVVPGDRVEFHVVKQKQRGN 124

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEK 153
           +WKF C AKV+  +VAEA+I AM++ ++
Sbjct: 125 IWKFHCDAKVDGQLVAEADIGAMIVSKE 152


>gi|327189231|gb|EGE56410.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium etli CNPAF512]
          Length = 155

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VDK++ I  D +AIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADIIEIMKLLPHRYPFLMVDKIIEIDGDNAAIGIKNVTVNEPHFTGHFPESPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL++EGMAQTAGAICA   G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIEGMAQTAGAICAKKEG-QPGNLVYFMTIENARFRKPVVPGDRVEFHVKKHKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKV+  +VAEA+I AM++ + +
Sbjct: 126 IWKFHCDAKVDGALVAEADIGAMIVRKDQ 154


>gi|163868109|ref|YP_001609313.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bartonella tribocorum CIP
           105476]
 gi|189038117|sp|A9ISM5|FABZ_BART1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|161017760|emb|CAK01318.1| acyl carrier protein [Bartonella tribocorum CIP 105476]
          Length = 155

 Score =  188 bits (477), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/146 (58%), Positives = 111/146 (76%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI +L+  LPHRYPFLL+D++VNI  ++ AIGIKN+T NEPHF GHFP +PVMPGV
Sbjct: 10  LEAVDIEKLLSILPHRYPFLLIDRIVNIDGEQEAIGIKNITINEPHFTGHFPTKPVMPGV 69

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILE MAQTAGAI  ++ G  +    YLM++D A+FRKPV PGD+L+ HV  ++ R  + 
Sbjct: 70  LILEAMAQTAGAIALLNLGNKRTNLVYLMTVDNAKFRKPVMPGDQLKIHVQLLKKRSGMR 129

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEK 153
           +F C AKVEN  VAEAEI AM++ E+
Sbjct: 130 RFSCVAKVENVRVAEAEIAAMIVEEE 155


>gi|218515876|ref|ZP_03512716.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium etli 8C-3]
          Length = 155

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/149 (57%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L + DI+E+M+ LPHRYPFL+VDK++ I  D +AIGIKNVT NEPHF GHFP  P+MP
Sbjct: 7   TTLSSADIIEIMKLLPHRYPFLMVDKIIEIDGDNAAIGIKNVTVNEPHFTGHFPESPIMP 66

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVL+++GMAQTAGAICA   G       Y M+I+ ARFRKPV PGDR+E+HV K + R +
Sbjct: 67  GVLLIDGMAQTAGAICAKKEG-QPGNLVYFMTIENARFRKPVVPGDRVEFHVKKHKQRGN 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +WKF C AKV+  +VAEA+I AM++ + +
Sbjct: 126 IWKFHCDAKVDGALVAEADIGAMIVRKDQ 154


>gi|222148853|ref|YP_002549810.1| (3R)-hydroxymyristoyl-ACP dehydratase [Agrobacterium vitis S4]
 gi|254783843|sp|B9JX24|FABZ_AGRVS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|221735839|gb|ACM36802.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase [Agrobacterium
           vitis S4]
          Length = 154

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 87/148 (58%), Positives = 114/148 (77%), Gaps = 1/148 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI+E+M+ LPHRYPFLLVD++++I  D +AIGIKNVT NEP F GHFP +P+MPGV
Sbjct: 8   LGRADILEIMKLLPHRYPFLLVDRIIDIDGDNAAIGIKNVTANEPQFTGHFPEQPIMPGV 67

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           L++EGMAQTAGAICA   G       Y M+ID ARFRKPV PGDR+E+HV K + R ++W
Sbjct: 68  LLIEGMAQTAGAICARKAG-TAGDLVYFMTIDNARFRKPVVPGDRVEFHVTKQKQRGNVW 126

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEKKE 155
           KF C AKV+  +VAEA+I AM+++++ +
Sbjct: 127 KFHCDAKVDGALVAEADIGAMIVNKEAQ 154


>gi|49474288|ref|YP_032330.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bartonella quintana str.
           Toulouse]
 gi|62286806|sp|Q6G1J5|FABZ_BARQU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|49239792|emb|CAF26182.1| Acyl carrier protein [Bartonella quintana str. Toulouse]
          Length = 155

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 107/145 (73%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L+A DI EL+  LPHRYPFLL+D++V I  ++ AIGIKN+T NEPHFMGHFP +PVMPG
Sbjct: 9   SLEAVDIEELLSILPHRYPFLLIDRIVEIDGEQQAIGIKNITINEPHFMGHFPAKPVMPG 68

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLILE MAQTAGAI  +  G  Q    YLM++D A+FRKPV PGD+L+ HV  ++ R  +
Sbjct: 69  VLILEAMAQTAGAISLLRLGNKQTNLVYLMTVDNAKFRKPVIPGDQLKIHVRLLKKRSGM 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMH 151
            +F C A+VE   VAEAEI AM++ 
Sbjct: 129 RRFSCVAEVEGVRVAEAEIAAMIIE 153


>gi|240850312|ref|YP_002971705.1| (3R)-hydroxymyristoyl-(acyl-carrier- protein) dehydratase FabZ
           [Bartonella grahamii as4aup]
 gi|240267435|gb|ACS51023.1| (3R)-hydroxymyristoyl-(acyl-carrier- protein) dehydratase FabZ
           [Bartonella grahamii as4aup]
          Length = 155

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 111/146 (76%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI +L+  LPHRYPFLL+D++V+I  ++ AIGIKN+T NEPHF GHFP +PVMPGV
Sbjct: 10  LEAVDIEKLLSILPHRYPFLLIDRIVDIDGEQEAIGIKNITINEPHFTGHFPAKPVMPGV 69

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILE MAQTAGAI  ++ G  Q    YLM++D A+FRKPV PGD+L+ HV  ++ R  + 
Sbjct: 70  LILEAMAQTAGAIALLNLGNKQTNLVYLMTVDNAKFRKPVMPGDQLKIHVQLLKKRSGMR 129

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEK 153
           +F C AKVE+  VAEAEI AM++ ++
Sbjct: 130 RFSCVAKVEDVRVAEAEIAAMIVEQE 155


>gi|110633743|ref|YP_673951.1| (3R)-hydroxymyristoyl-ACP dehydratase [Mesorhizobium sp. BNC1]
 gi|123162412|sp|Q11II9|FABZ_MESSB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|110284727|gb|ABG62786.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Chelativorans sp.
           BNC1]
          Length = 156

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 110/149 (73%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            +++ DI+ ++R LPHRYPFLLVD++V I  D SAIGIKNVT NEPHFMGHFP RPVMPG
Sbjct: 8   AMESLDILNVLRLLPHRYPFLLVDRIVEIDGDNSAIGIKNVTVNEPHFMGHFPERPVMPG 67

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLI+E MAQTAGAIC  H    + +  Y ++I+ A+FRKPV PGDR+E HV KV+ R  +
Sbjct: 68  VLIIEAMAQTAGAICIQHAKQIKPSVVYFLTIENAKFRKPVVPGDRMEIHVKKVKQRGMI 127

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           WKF C A V+   VAEA I A++  E+ E
Sbjct: 128 WKFACEAIVDGGKVAEAMISALLSAEEPE 156


>gi|304391655|ref|ZP_07373597.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ahrensia
           sp. R2A130]
 gi|303295884|gb|EFL90242.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ahrensia
           sp. R2A130]
          Length = 155

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (75%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI +LM+ LPHRYPFLLVDK+V+I  D+SA GIKNVTFNEPHF GHFP  P+MPGV
Sbjct: 8   LKTLDISDLMKLLPHRYPFLLVDKIVDIDGDQSARGIKNVTFNEPHFTGHFPHTPIMPGV 67

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           L++EGMAQTAGAIC+ H+        Y M+IDKA+FRK V PGD +EY + K+R + +++
Sbjct: 68  LLVEGMAQTAGAICSAHHYTGDPKTTYFMTIDKAKFRKTVGPGDVVEYVIEKIRQKRNIF 127

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
           KF C A+V    VAEAEI AM++
Sbjct: 128 KFACIAEVNGVKVAEAEISAMMV 150


>gi|319407367|emb|CBI81014.1| acyl carrier protein [Bartonella sp. 1-1C]
          Length = 155

 Score =  183 bits (464), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L++ DI +L+  LPHRYPFLL+D+++ I  D+ AIGIKNVT NEPHFMGHFP +PVMPG
Sbjct: 9   SLESMDIDKLLSILPHRYPFLLIDRIIEIDGDQEAIGIKNVTINEPHFMGHFPEKPVMPG 68

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLILE MAQTAGAI  +     +    YLM++D A+FRKPV PGD+L+ HV  ++ R ++
Sbjct: 69  VLILEAMAQTAGAISLLSLNNKELGLVYLMTVDNAKFRKPVTPGDQLKIHVRLLKKRSNI 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
            +F C AKVE+  VAEAE+ AM++  K
Sbjct: 129 RRFLCIAKVEDVRVAEAEVSAMIVESK 155


>gi|260459223|ref|ZP_05807478.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Mesorhizobium opportunistum WSM2075]
 gi|259034777|gb|EEW36033.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Mesorhizobium opportunistum WSM2075]
          Length = 155

 Score =  182 bits (463), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L+A DI+ LM+ LPHRYPFL++D++V I  D SAIGIKNVT NEPHF GHFP +PVMP
Sbjct: 8   TTLEAVDIMGLMKLLPHRYPFLMIDRIVEIDGDNSAIGIKNVTINEPHFQGHFPDQPVMP 67

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVLI+E MAQTAGAIC    G  + +  Y ++ID A+FRKPV PGD+L+ HV K++ R +
Sbjct: 68  GVLIVEAMAQTAGAICIRSLGASKPSLVYFLTIDNAKFRKPVVPGDQLKIHVKKIKKRGN 127

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           L KF C A V+ T  AEAEI AM++
Sbjct: 128 LLKFACEALVDGTKAAEAEISAMMV 152


>gi|300023419|ref|YP_003756030.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525240|gb|ADJ23709.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 167

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (73%), Gaps = 1/144 (0%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L   DI  +M+ LPHRYPFLLVD++ ++ RD+S +G+KNVT NEP F GHFP  PVMPG
Sbjct: 10  ALGTADIATVMKLLPHRYPFLLVDRIYDMDRDDSCVGVKNVTINEPFFQGHFPQFPVMPG 69

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           VLI+EG+AQTAGA+C  + G D  A   Y M ID A+FRKPV PGD+L YHV KVRNR  
Sbjct: 70  VLIIEGLAQTAGALCVSNVGEDYRAELVYFMGIDNAKFRKPVLPGDQLHYHVKKVRNRGR 129

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
           +W+F+  AKV   VVAEAEI AM+
Sbjct: 130 VWRFRGEAKVNGQVVAEAEISAML 153


>gi|319783662|ref|YP_004143138.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169550|gb|ADV13088.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 155

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 110/145 (75%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L+A DI+ LM+ LPHRYPFL++D++V+I  DESAIGIKNVT NEPHF GHFP +PVMP
Sbjct: 8   TTLEAVDIMGLMKLLPHRYPFLMIDRIVDIDGDESAIGIKNVTINEPHFQGHFPEQPVMP 67

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVLI+E MAQTAGAIC    G ++ +  Y ++ID A+FRKPV PGD+L+ +V K++ R +
Sbjct: 68  GVLIVEAMAQTAGAICIRSLGTEKPSLVYFLTIDNAKFRKPVVPGDQLKIYVKKIKKRGN 127

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           L KF C A V+    AEAEI AM++
Sbjct: 128 LLKFACEAMVDGAKAAEAEISAMMV 152


>gi|118590001|ref|ZP_01547405.1| (3R)-hydroxymyristoyl ACP dehydratase [Stappia aggregata IAM 12614]
 gi|118437498|gb|EAV44135.1| (3R)-hydroxymyristoyl ACP dehydratase [Stappia aggregata IAM 12614]
          Length = 154

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (74%), Gaps = 5/147 (3%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI+ +M+ LPHRYPFLL+DK++ +  D+S IGIKNVT NEPHF GHFP RPV PG
Sbjct: 8   TLGSADIMRIMKLLPHRYPFLLIDKIIEMDGDDSCIGIKNVTINEPHFTGHFPERPVFPG 67

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           VL++E MAQTAGA+C    G D  APP   Y M+IDKA+FR+PV PGD++ +HV K++ R
Sbjct: 68  VLLIEAMAQTAGALCVHARGDD--APPQLVYFMTIDKAKFRRPVEPGDQVHFHVKKIKQR 125

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVM 150
            ++WKF   AKV+   VAEAE+ AM++
Sbjct: 126 SNIWKFDAVAKVDGNKVAEAEVSAMLV 152


>gi|319404363|emb|CBI77963.1| acyl carrier protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 155

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/147 (55%), Positives = 108/147 (73%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L++ DI +L+  LPHRYPFLL+D+++ I  D+ AIGIKNVT NEPHF GHFP +PVMPG
Sbjct: 9   SLESMDIDKLLSILPHRYPFLLIDRIIEIDGDQEAIGIKNVTINEPHFTGHFPEKPVMPG 68

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLILE MAQTAGAI  +     +    YLM++D A+FRKPV PGD+L+ HV  ++ R ++
Sbjct: 69  VLILEAMAQTAGAISLLSLNSKELGLVYLMTVDNAKFRKPVTPGDQLKIHVRLLKKRSNI 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
            +F C AKVE+  VAEAE+ AM++  K
Sbjct: 129 RRFLCIAKVEDVRVAEAEVSAMIVESK 155


>gi|319899035|ref|YP_004159128.1| acyl carrier protein [Bartonella clarridgeiae 73]
 gi|319402999|emb|CBI76554.1| acyl carrier protein [Bartonella clarridgeiae 73]
          Length = 158

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           D   L+A DI +L+  LPHRYPFLL+D++V I  D+ AIGIKN+T NEPHF+GHFP +PV
Sbjct: 6   DTKSLEAIDIDKLLSILPHRYPFLLIDRIVEIDGDQRAIGIKNITINEPHFIGHFPEKPV 65

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           MPGVLILE MAQTAGAI  ++    +    YLM++D A+FRKPV PGD+L+ +V  ++ R
Sbjct: 66  MPGVLILEAMAQTAGAISLLNLNDQKLGLVYLMTVDNAKFRKPVIPGDQLKIYVQLLKKR 125

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVMHEKK 154
            ++ +F C AKVE+  VAEAE+ AM++  ++
Sbjct: 126 SNIRRFLCIAKVEDVRVAEAEVSAMIVESRQ 156


>gi|319405835|emb|CBI79467.1| acyl carrier protein [Bartonella sp. AR 15-3]
          Length = 155

 Score =  181 bits (459), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L A DI +L+  LPHRYPFLL+D+++ I  D  AIGIKNVT NEPHFMGHFP +PVMPG
Sbjct: 9   SLGAIDIDKLLSILPHRYPFLLIDRIIEIDGDHGAIGIKNVTINEPHFMGHFPEKPVMPG 68

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           V ILE MAQTAGAI  +     +    YLM++D A+FRKPV PGD+L+ HV  ++ R ++
Sbjct: 69  VFILEAMAQTAGAISLLSLNSTELGLVYLMTVDNAKFRKPVIPGDQLKIHVQLLKKRSNI 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
            +F C AKVE+  VAEAEI AM++  K
Sbjct: 129 RRFLCIAKVEDIRVAEAEISAMIVESK 155


>gi|49475418|ref|YP_033459.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bartonella henselae str.
           Houston-1]
 gi|48474554|sp|Q8VQ22|FABZ_BARHE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|18252651|gb|AAL66376.1|AF461795_4 FabZ [Bartonella henselae]
 gi|49238224|emb|CAF27434.1| Acyl carrier protein [Bartonella henselae str. Houston-1]
          Length = 155

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 108/147 (73%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L+  DI +L+  LPHRYPFLL+D++V I  ++ AIGIKN+T NEPHF+GHFP +PVMPG
Sbjct: 9   SLETLDIEKLLSILPHRYPFLLIDRIVEIDGEQEAIGIKNITINEPHFVGHFPAKPVMPG 68

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           VLILE MAQTAGAI  +  G  Q    YLM++D A+FRKPV PGD+L+ HV  ++ R  +
Sbjct: 69  VLILEAMAQTAGAISLLRLGNKQTNLVYLMTVDNAKFRKPVIPGDQLKIHVRLLKKRSGM 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
            +F C A+V+   VAEAEI AM++ ++
Sbjct: 129 RRFSCIAEVKGVRVAEAEIAAMILEKE 155


>gi|254469975|ref|ZP_05083380.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudovibrio sp. JE062]
 gi|211961810|gb|EEA97005.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudovibrio sp. JE062]
          Length = 158

 Score =  180 bits (456), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 108/146 (73%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L+A DI+ +M  LPHRYPFL++D++V++  D S +GIKNVT NEPHF GHFP +PVMPG
Sbjct: 8   TLEAADIMRVMELLPHRYPFLMIDRIVDMDGDNSGVGIKNVTINEPHFQGHFPSQPVMPG 67

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           VL++E MAQTAGA+C +H       P   Y M+IDK +FRKPV PGD++ +HV K+RNR 
Sbjct: 68  VLLIEAMAQTAGALC-VHAREKTDVPSLVYFMTIDKCKFRKPVVPGDQVRFHVKKIRNRA 126

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVM 150
            +WKF+  A V+   VAEAEI AM++
Sbjct: 127 TIWKFEGVAMVDGQKVAEAEISAMLV 152


>gi|170738982|ref|YP_001767637.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylobacterium sp. 4-46]
 gi|190359389|sp|B0UQ04|FABZ_METS4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|168193256|gb|ACA15203.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium sp. 4-46]
          Length = 165

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/147 (59%), Positives = 104/147 (70%), Gaps = 2/147 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI+ +M  LPHRYPFLLVD++V I  D S IGIKNVT NEP F GHFP  PV PGV
Sbjct: 19  LATADILRVMELLPHRYPFLLVDRIVEIDGDSSCIGIKNVTINEPQFTGHFPKVPVFPGV 78

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++EGMAQTAGAIC  H       P   YLM+IDK +FRKPV PGD +EYH+ K+ NR  
Sbjct: 79  LLVEGMAQTAGAICCAHTLTRDTRPSRVYLMTIDKVKFRKPVVPGDTVEYHMRKLTNRRT 138

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +W F+  AKV  T+VAEAEI AM++ E
Sbjct: 139 MWWFRGEAKVAGTLVAEAEIGAMLVTE 165


>gi|121602572|ref|YP_988899.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bartonella bacilliformis
           KC583]
 gi|158513079|sp|A1USE6|FABZ_BARBK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|120614749|gb|ABM45350.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Bartonella bacilliformis KC583]
          Length = 154

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (73%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
            ++  L+A DIV+L+  LPHRYPFLL+D+++ I  D  AIGIKNVT NEPHF+GHFP  P
Sbjct: 5   GEIKNLEAIDIVKLLSVLPHRYPFLLIDRIIEIDGDRKAIGIKNVTVNEPHFVGHFPENP 64

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           VMPGVLILE MAQTAGAI  +  G  +    YLM+ID A+FRKPV PGD++  HV  ++ 
Sbjct: 65  VMPGVLILEAMAQTAGAISLLALGRGKEDLVYLMTIDNAKFRKPVVPGDQMRIHVQLLKK 124

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVM 150
           R ++ +F C A+VE T V+EAEI AMV+
Sbjct: 125 RSEVRRFLCIAEVEGTRVSEAEISAMVV 152


>gi|153009368|ref|YP_001370583.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ochrobactrum anthropi ATCC
           49188]
 gi|166233428|sp|A6X0K0|FABZ_OCHA4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|151561256|gb|ABS14754.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Ochrobactrum anthropi ATCC 49188]
          Length = 157

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 105/142 (73%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI +L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP +P+MPGV
Sbjct: 9   LEAADIQDLLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPEKPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  HV K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVIPGDRLLLHVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECIAEVDGVKVAEAEVAAMI 150


>gi|217979936|ref|YP_002364083.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylocella silvestris BL2]
 gi|217505312|gb|ACK52721.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylocella silvestris BL2]
          Length = 157

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/145 (55%), Positives = 111/145 (76%), Gaps = 1/145 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A +++ DI++L++ LPHRYPFL+VD+++  + D S +G+KNVTFNEPHF GHFPGRPVMP
Sbjct: 6   ATIESFDILQLLKHLPHRYPFLMVDRIIEARSDGSGVGVKNVTFNEPHFQGHFPGRPVMP 65

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GVL++EGMAQTAGA+    +  D  AP  Y MSIDKA+FRKPV PGDR+E+H++   NR 
Sbjct: 66  GVLLVEGMAQTAGALVIRAHAGDGPAPLVYFMSIDKAKFRKPVTPGDRVEFHMSPTNNRR 125

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
           ++W +   A V+  +V EA+I AM+
Sbjct: 126 NMWWYSGRALVDGVLVCEADIAAMI 150


>gi|239832039|ref|ZP_04680368.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Ochrobactrum intermedium LMG 3301]
 gi|239824306|gb|EEQ95874.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Ochrobactrum intermedium LMG 3301]
          Length = 157

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 105/142 (73%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI +L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP +P+MPGV
Sbjct: 9   LEAADIQDLLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPEKPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  HV K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVIPGDRLLLHVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECIAEVDGVKVAEAEVAAMI 150


>gi|182680389|ref|YP_001834535.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182636272|gb|ACB97046.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 157

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 112/152 (73%), Gaps = 1/152 (0%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           ++ A L+  DI+ L++ LPHRYPFL+VD+++  + DES IGIKNV+ NEP F GHFP RP
Sbjct: 4   AETAILETFDILRLLQSLPHRYPFLMVDRIIEARGDESGIGIKNVSVNEPQFQGHFPERP 63

Query: 63  VMPGVLILEGMAQTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           VMPGVL++EGMAQTAGA+C   H G  +    Y M+IDKA+FRKPV PGDR+E+H+ K  
Sbjct: 64  VMPGVLLIEGMAQTAGALCVNAHAGGVKPPLVYFMTIDKAKFRKPVTPGDRVEFHMKKTN 123

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
            R D+W ++  A V+ T+V EAEI AM+  +K
Sbjct: 124 RRKDMWWYKGQAFVDGTLVCEAEIAAMLAPQK 155


>gi|220921523|ref|YP_002496824.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylobacterium nodulans
           ORS 2060]
 gi|254788933|sp|B8INJ5|FABZ_METNO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|219946129|gb|ACL56521.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium nodulans ORS 2060]
          Length = 159

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 104/147 (70%), Gaps = 2/147 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI+ +M  LPHRYPFLLVD++  I  D+S IGIKNVT NEP F GHFP  PV PGV
Sbjct: 13  LGTADIMRVMELLPHRYPFLLVDRITAINGDDSCIGIKNVTINEPQFTGHFPAMPVFPGV 72

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++EGMAQTAGAIC  H   +   P   YLM+IDK +FRKPV PGD +EYH+ KV NR  
Sbjct: 73  LLVEGMAQTAGAICCAHKLQNNTKPSRVYLMTIDKVKFRKPVVPGDTVEYHMKKVSNRRF 132

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +W F+  AKV   +VAEAEI AM++ E
Sbjct: 133 MWWFRGEAKVNGVLVAEAEIGAMLVTE 159


>gi|298291813|ref|YP_003693752.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Starkeya
           novella DSM 506]
 gi|296928324|gb|ADH89133.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Starkeya
           novella DSM 506]
          Length = 166

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/147 (57%), Positives = 107/147 (72%), Gaps = 5/147 (3%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L   DI  ++  LPHRYPFL+VDK+V I+ D+ A+GIKNV+ NEPHF GHFP  PVMP
Sbjct: 16  AALGTADIHRILEALPHRYPFLMVDKIVGIEGDKRAVGIKNVSANEPHFQGHFPNNPVMP 75

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           GVLILEGMAQTAG IC +  G     PP   Y M+IDKA+FR+PV PGD LEYH+ ++  
Sbjct: 76  GVLILEGMAQTAGTICLL--GRPDDGPPSIVYFMTIDKAKFRRPVVPGDVLEYHMTQISK 133

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMV 149
           R ++W F+  AKV+  +VAEAE+ AM+
Sbjct: 134 RRNMWWFRGEAKVDGQLVAEAEVGAMI 160


>gi|319408403|emb|CBI82058.1| acyl carrier protein [Bartonella schoenbuchensis R1]
          Length = 159

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 109/152 (71%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
            ++  L+  DI +L+  LPHRYPFLL+D+++ I  D+ AIGIKNVT NEP+FMGHFP +P
Sbjct: 5   GEIQSLETVDIDKLLSILPHRYPFLLIDRIIEIDGDQKAIGIKNVTINEPYFMGHFPEKP 64

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           VMPGVLILE MAQTAGAI  +     +    YLM++D A+FRKPV PGD+L+ HV  ++ 
Sbjct: 65  VMPGVLILEAMAQTAGAISLLKLDEKKTGLVYLMTVDNAKFRKPVVPGDQLKLHVQLLKK 124

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           R  + +F C A+VE   V+EAE+ AM++  ++
Sbjct: 125 RSGVRRFSCVAEVEGIRVSEAEVSAMIVESEQ 156


>gi|312114743|ref|YP_004012339.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219872|gb|ADP71240.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 170

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 105/151 (69%), Gaps = 4/151 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI  +++ LPHRYPFLLVD+++ +  D SAIGIKNVT NEP F GHFP  PVMPGV
Sbjct: 20  LGTADITRILKLLPHRYPFLLVDRIIEMDGDSSAIGIKNVTINEPFFQGHFPNFPVMPGV 79

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++EGMAQTAGA+C        + P   Y MSID+ARFR+PV PGD++ +H+ K RNR  
Sbjct: 80  LLIEGMAQTAGALCMA--SLSNFEPQLVYFMSIDRARFRRPVLPGDQVHFHMTKKRNRGR 137

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKKEK 156
           +W+F   A+V   +VAEAEI AM++     K
Sbjct: 138 VWRFDGKARVNGQLVAEAEISAMIVDANDNK 168


>gi|254502195|ref|ZP_05114346.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Labrenzia
           alexandrii DFL-11]
 gi|222438266|gb|EEE44945.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Labrenzia
           alexandrii DFL-11]
          Length = 154

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 109/151 (72%), Gaps = 5/151 (3%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           ++   L   DI+++M+ LPHRYPFLL+D+++ +  D S IGIKNVT NEP F GHFP RP
Sbjct: 4   TEKTTLATADIMKVMKLLPHRYPFLLIDRIIEMDGDNSCIGIKNVTINEPQFQGHFPERP 63

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNK 119
           + PGVL++E MAQTAGA+C    G D  APP   Y M+ID+A+FRKPV PGD++ +HV K
Sbjct: 64  IFPGVLLIEAMAQTAGALCVHARGAD--APPQLVYFMTIDRAKFRKPVEPGDQVHFHVKK 121

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMVM 150
           ++ R ++WKF   A V+   VAEAE+ AM++
Sbjct: 122 IKQRANIWKFDAVAMVDGAKVAEAEVSAMLV 152


>gi|23502030|ref|NP_698157.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella suis 1330]
 gi|148559023|ref|YP_001259071.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella ovis ATCC 25840]
 gi|161619104|ref|YP_001592991.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella canis ATCC 23365]
 gi|163843417|ref|YP_001627821.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella suis ATCC 23445]
 gi|254701893|ref|ZP_05163721.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella suis bv. 5 str.
           513]
 gi|254704439|ref|ZP_05166267.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella suis bv. 3 str.
           686]
 gi|254706665|ref|ZP_05168493.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella pinnipedialis
           M163/99/10]
 gi|254710227|ref|ZP_05172038.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella pinnipedialis
           B2/94]
 gi|254714223|ref|ZP_05176034.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella ceti M644/93/1]
 gi|254717659|ref|ZP_05179470.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella ceti M13/05/1]
 gi|254719215|ref|ZP_05181026.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella sp. 83/13]
 gi|256031721|ref|ZP_05445335.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella pinnipedialis
           M292/94/1]
 gi|256061234|ref|ZP_05451385.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella neotomae 5K33]
 gi|256369577|ref|YP_003107087.1| (3R)-hydroxymyristoyl ACP dehydratase [Brucella microti CCM 4915]
 gi|260168854|ref|ZP_05755665.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella sp. F5/99]
 gi|260566314|ref|ZP_05836784.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           suis bv. 4 str. 40]
 gi|261219500|ref|ZP_05933781.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261314125|ref|ZP_05953322.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317786|ref|ZP_05956983.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321995|ref|ZP_05961192.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325242|ref|ZP_05964439.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261752457|ref|ZP_05996166.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           suis bv. 5 str. 513]
 gi|261755117|ref|ZP_05998826.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758342|ref|ZP_06002051.1| thioesterase superfamily [Brucella sp. F5/99]
 gi|265984210|ref|ZP_06096945.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988817|ref|ZP_06101374.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294852492|ref|ZP_06793165.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           sp. NVSL 07-0026]
 gi|306837963|ref|ZP_07470821.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           sp. NF 2653]
 gi|306841876|ref|ZP_07474556.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ [Brucella
           sp. BO2]
 gi|306844016|ref|ZP_07476611.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ [Brucella
           sp. BO1]
 gi|33516899|sp|Q8G0E4|FABZ_BRUSU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233411|sp|A5VQS4|FABZ_BRUO2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189038253|sp|A9M5G5|FABZ_BRUC2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189038254|sp|B0CGV0|FABZ_BRUSI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|23347984|gb|AAN30072.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Brucella
           suis 1330]
 gi|148370280|gb|ABQ60259.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           ovis ATCC 25840]
 gi|161335915|gb|ABX62220.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           canis ATCC 23365]
 gi|163674140|gb|ABY38251.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           suis ATCC 23445]
 gi|255999739|gb|ACU48138.1| (3R)-hydroxymyristoyl ACP dehydratase [Brucella microti CCM 4915]
 gi|260155832|gb|EEW90912.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           suis bv. 4 str. 40]
 gi|260924589|gb|EEX91157.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294685|gb|EEX98181.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297009|gb|EEY00506.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301222|gb|EEY04719.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303151|gb|EEY06648.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738326|gb|EEY26322.1| thioesterase superfamily [Brucella sp. F5/99]
 gi|261742210|gb|EEY30136.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           suis bv. 5 str. 513]
 gi|261744870|gb|EEY32796.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|264661014|gb|EEZ31275.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662802|gb|EEZ33063.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821081|gb|EFG38080.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           sp. NVSL 07-0026]
 gi|306275771|gb|EFM57495.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ [Brucella
           sp. BO1]
 gi|306288006|gb|EFM59408.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ [Brucella
           sp. BO2]
 gi|306406887|gb|EFM63108.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           sp. NF 2653]
          Length = 157

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 9   LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  HV K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLHVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECVAEVDGVKVAEAEVAAMI 150


>gi|256159884|ref|ZP_05457608.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella ceti M490/95/1]
 gi|256255121|ref|ZP_05460657.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella ceti B1/94]
 gi|261222319|ref|ZP_05936600.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998282|ref|ZP_06110839.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920903|gb|EEX87556.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552750|gb|EEZ08740.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 157

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 9   LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  HV K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLHVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECVAEVDGVKVAEAEVAAMI 150


>gi|17987115|ref|NP_539749.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis bv. 1
           str. 16M]
 gi|17982777|gb|AAL52013.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Brucella
           melitensis bv. 1 str. 16M]
          Length = 173

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 25  LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 84

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  +V K++ R ++ 
Sbjct: 85  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDSAKFRRPVVPGDRLLLYVKKIKQRANIS 144

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 145 KYECVAEVDGVKVAEAEVAAMI 166


>gi|225852650|ref|YP_002732883.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis ATCC
           23457]
 gi|256044808|ref|ZP_05447712.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256113713|ref|ZP_05454517.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis bv. 3
           str. Ether]
 gi|256263856|ref|ZP_05466388.1| thioesterase superfamily protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565592|ref|ZP_05836076.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991232|ref|ZP_06103789.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995068|ref|ZP_06107625.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|24211701|sp|Q8YHG9|FABZ_BRUME RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788917|sp|C0RJC1|FABZ_BRUMB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|225641015|gb|ACO00929.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           melitensis ATCC 23457]
 gi|260151660|gb|EEW86754.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           melitensis bv. 1 str. 16M]
 gi|262766181|gb|EEZ11970.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002016|gb|EEZ14591.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093987|gb|EEZ17921.1| thioesterase superfamily protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409171|gb|ADZ66236.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis M28]
          Length = 157

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 9   LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  +V K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDSAKFRRPVVPGDRLLLYVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECVAEVDGVKVAEAEVAAMI 150


>gi|170749837|ref|YP_001756097.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylobacterium
           radiotolerans JCM 2831]
 gi|190359388|sp|B1LTP5|FABZ_METRJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|170656359|gb|ACB25414.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium radiotolerans JCM 2831]
          Length = 158

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 105/147 (71%), Gaps = 2/147 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI  L+  LPHRYPFL+VD++V I RDES +GIKNVT NEP FMGHFP  PV PGV
Sbjct: 12  LGTADIQTLLELLPHRYPFLMVDRIVEIDRDESCVGIKNVTANEPQFMGHFPDMPVFPGV 71

Query: 68  LILEGMAQTAGAICAIHNGFD--QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++EGMAQTAGAIC  H   D       + M+IDK +FRKPV PGD++ +H+ K+  R  
Sbjct: 72  LLIEGMAQTAGAICCRHIRADGRNTKQVFFMTIDKCKFRKPVTPGDQVRFHMTKLNQRRT 131

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +W F+  A+V+ T+VAEAEI AM++ E
Sbjct: 132 MWWFRGEARVDGTLVAEAEISAMLVTE 158


>gi|62290065|ref|YP_221858.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699991|ref|YP_414565.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024305|ref|YP_001935073.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus S19]
 gi|237815572|ref|ZP_04594569.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           abortus str. 2308 A]
 gi|254689376|ref|ZP_05152630.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 6 str.
           870]
 gi|254693860|ref|ZP_05155688.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697509|ref|ZP_05159337.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730406|ref|ZP_05188984.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 4 str.
           292]
 gi|256257622|ref|ZP_05463158.1| (3R)-hydroxymyristoyl-ACP dehydratase [Brucella abortus bv. 9 str.
           C68]
 gi|260546616|ref|ZP_05822355.1| thioesterase superfamily protein [Brucella abortus NCTC 8038]
 gi|260754894|ref|ZP_05867242.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 6 str. 870]
 gi|260758111|ref|ZP_05870459.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 4 str. 292]
 gi|260761935|ref|ZP_05874278.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883906|ref|ZP_05895520.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214146|ref|ZP_05928427.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 3 str. Tulya]
 gi|297248464|ref|ZP_06932182.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           abortus bv. 5 str. B3196]
 gi|88911309|sp|Q2YRQ4|FABZ_BRUA2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|90111823|sp|P0C104|FABZ_BRUAB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700446|sp|B2S602|FABZ_BRUA1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|62196197|gb|AAX74497.1| FabZ, (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616092|emb|CAJ11130.1| Thioesterase superfamily [Brucella melitensis biovar Abortus 2308]
 gi|189019877|gb|ACD72599.1| Thioesterase superfamily [Brucella abortus S19]
 gi|237788870|gb|EEP63081.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           abortus str. 2308 A]
 gi|260095666|gb|EEW79543.1| thioesterase superfamily protein [Brucella abortus NCTC 8038]
 gi|260668429|gb|EEX55369.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 4 str. 292]
 gi|260672367|gb|EEX59188.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675002|gb|EEX61823.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 6 str. 870]
 gi|260873434|gb|EEX80503.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915753|gb|EEX82614.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Brucella abortus bv. 3 str. Tulya]
 gi|297175633|gb|EFH34980.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           abortus bv. 5 str. B3196]
          Length = 157

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 9   LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  +V K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLYVKKIKQRANIS 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 129 KYECVAEVDGVKVAEAEVAAMI 150


>gi|323137314|ref|ZP_08072392.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylocystis sp. ATCC 49242]
 gi|322397301|gb|EFX99824.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylocystis sp. ATCC 49242]
          Length = 154

 Score =  173 bits (438), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L++ DI ++MR LPHRYPFLLVD++V+I+ DES +G+KN+T NEP FMGHFP RPVMP
Sbjct: 8   ATLESADISQIMRCLPHRYPFLLVDRIVDIRGDESCVGVKNITINEPQFMGHFPERPVMP 67

Query: 66  GVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GVL++E MAQTAG I     G  ++    Y M+ID A+FRKPV PGDR+E+H+ K   + 
Sbjct: 68  GVLLIEAMAQTAGVIVMRAQGEMEKPKLVYFMTIDNAKFRKPVTPGDRVEFHMTKTAQKR 127

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
           ++W +Q  A V+  +VAEA I AM+
Sbjct: 128 NIWWYQGRAMVDGALVAEATISAMM 152


>gi|326538881|gb|ADZ87096.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           melitensis M5-90]
          Length = 149

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 103/142 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 1   MEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  +V K++ R ++ 
Sbjct: 61  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDSAKFRRPVVPGDRLLLYVKKIKQRANIS 120

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K++C A+V+   VAEAE+ AM+
Sbjct: 121 KYECVAEVDGVKVAEAEVAAMI 142


>gi|188584401|ref|YP_001927846.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylobacterium populi
           BJ001]
 gi|179347899|gb|ACB83311.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium populi BJ001]
          Length = 153

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 110/153 (71%), Gaps = 2/153 (1%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +S+   L + DI +++  LPHRYPFL++D+++ I RDES IGIKNVT NEP F GHFPG 
Sbjct: 1   MSETRELGSADIQKVLELLPHRYPFLMIDRIIEIDRDESCIGIKNVTANEPQFTGHFPGL 60

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNK 119
           PV PGVL++EGMAQTAGAIC  H   D+      + M+IDK +FRKPV PGD++ +H+ K
Sbjct: 61  PVFPGVLLIEGMAQTAGAICCRHIMTDELKTKQVFFMTIDKCKFRKPVVPGDQVRFHMTK 120

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMVMHE 152
           +  R  +W F+  A+V+  +VA+AEI AM++ E
Sbjct: 121 INQRKTMWWFRGEARVDGALVAQAEIGAMLVTE 153


>gi|154248349|ref|YP_001419307.1| (3R)-hydroxymyristoyl-ACP dehydratase [Xanthobacter autotrophicus
           Py2]
 gi|154162434|gb|ABS69650.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Xanthobacter autotrophicus Py2]
          Length = 161

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/143 (53%), Positives = 107/143 (74%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI++++  LPHRYPFL+VD+V  I  D S +GIKNVT NEPHF GHFPG PVMPGV
Sbjct: 16  LASADILKVLTCLPHRYPFLMVDRVEQIDGDLSCVGIKNVTANEPHFQGHFPGNPVMPGV 75

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+EGMAQTAG +C +    ++ +  Y M+ID+A+FR+PV PGD LEYH+ ++  R ++W
Sbjct: 76  LIIEGMAQTAGVVCVLGKDKEKPSLVYFMTIDEAKFRRPVVPGDVLEYHMTRISRRRNMW 135

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            ++  AKV   +VA+A++ AM+M
Sbjct: 136 WYRGEAKVRGEIVAQAKVGAMIM 158


>gi|163854071|ref|YP_001642114.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium extorquens PA1]
 gi|218533016|ref|YP_002423832.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylobacterium
           chloromethanicum CM4]
 gi|240141525|ref|YP_002966005.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
           [Methylobacterium extorquens AM1]
 gi|254564042|ref|YP_003071137.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
           [Methylobacterium extorquens DM4]
 gi|163665676|gb|ABY33043.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium extorquens PA1]
 gi|218525319|gb|ACK85904.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacterium chloromethanicum CM4]
 gi|240011502|gb|ACS42728.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
           [Methylobacterium extorquens AM1]
 gi|254271320|emb|CAX27332.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
           [Methylobacterium extorquens DM4]
          Length = 153

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 110/153 (71%), Gaps = 2/153 (1%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +S+   L + DI +++  LPHRYPFL++D+++ I RDES IGIKNVT NEP F GHFPG 
Sbjct: 1   MSETRELGSADIQKVLELLPHRYPFLMIDRIIEIDRDESCIGIKNVTANEPQFTGHFPGL 60

Query: 62  PVMPGVLILEGMAQTAGAICAIH--NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           PV PGVL++EGMAQTAGAIC  H  N   +    + M+IDK +FRKPV PGD++ +H+ K
Sbjct: 61  PVFPGVLLIEGMAQTAGAICCRHIMNDDLKTKQVFFMTIDKCKFRKPVVPGDQVRFHMTK 120

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMVMHE 152
           +  R  +W F+  A+V+  +VA+AEI AM++ E
Sbjct: 121 MNQRKTMWWFRGEARVDGALVAQAEIGAMLVTE 153


>gi|1262293|gb|AAA96790.1| FabZ [Brucella abortus]
          Length = 155

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 100/138 (72%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGVLI+E
Sbjct: 11  DIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGVLIVE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  +V K++ R ++ K++C
Sbjct: 71  AMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLYVKKIKQRANISKYEC 130

Query: 132 CAKVENTVVAEAEICAMV 149
            A+V+   VAEAE+ AM+
Sbjct: 131 VAEVDGVKVAEAEVAAMI 148


>gi|330993384|ref|ZP_08317319.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Gluconacetobacter sp. SXCC-1]
 gi|329759414|gb|EGG75923.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Gluconacetobacter sp. SXCC-1]
          Length = 161

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 106/147 (72%), Gaps = 3/147 (2%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L++ DI+ +M  +PHRYPFLL+D++V+I   +SA+GIKNVT NEPHF GHFP RPVMP
Sbjct: 15  AVLESIDIMRIMEAIPHRYPFLLIDRMVDITLGQSAVGIKNVTVNEPHFQGHFPARPVMP 74

Query: 66  GVLILEGMAQTAGAICAIHNG--FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           GVLI+E MAQTA  +  +  G  F+     Y M+ID A+FR+PV PGD+L  HV K R+R
Sbjct: 75  GVLIIEAMAQTAACLVVLTLGPAFEGKL-VYFMTIDGAKFRRPVGPGDQLRIHVEKERSR 133

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVM 150
            ++WKF+  A+V+   VAEA   AM+M
Sbjct: 134 ANVWKFKGIARVDGVSVAEATFSAMIM 160


>gi|158423327|ref|YP_001524619.1| (3R)-hydroxymyristoyl-ACP dehydratase [Azorhizobium caulinodans ORS
           571]
 gi|190359371|sp|A8I489|FABZ_AZOC5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|158330216|dbj|BAF87701.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase [Azorhizobium
           caulinodans ORS 571]
          Length = 158

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/147 (53%), Positives = 105/147 (71%), Gaps = 1/147 (0%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            LD+ DI+ ++  LPHRYPFL+VD++  I  D S +G KNVT NEPHF GHFP  PVMPG
Sbjct: 12  VLDSIDILRILALLPHRYPFLMVDRIEAIDSDLSCVGYKNVTANEPHFQGHFPNNPVMPG 71

Query: 67  VLILEGMAQTAGAICAIHNGFDQY-APPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           VLI+EGMAQTAGAIC    G D+  +  Y M+ID+A+FR+PV PGD LEYH+ ++  R +
Sbjct: 72  VLIIEGMAQTAGAICIHAKGADRKPSLVYFMTIDEAKFRRPVRPGDVLEYHMTRLNKRRN 131

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +W ++  A+V   +VAEA + AM+  E
Sbjct: 132 MWWYRGEARVGGEIVAEARVGAMIAEE 158


>gi|154253624|ref|YP_001414448.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Parvibaculum lavamentivorans DS-1]
 gi|190359430|sp|A7HY08|FABZ_PARL1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|154157574|gb|ABS64791.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Parvibaculum lavamentivorans DS-1]
          Length = 158

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/145 (53%), Positives = 104/145 (71%), Gaps = 5/145 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           LD+ DI  ++  LPHRYP L++D+++ ++ DESAIGIKNVT NEP F GHFPG PVMPGV
Sbjct: 10  LDSADINRVLELLPHRYPMLMIDRIIEMKSDESAIGIKNVTNNEPFFQGHFPGHPVMPGV 69

Query: 68  LILEGMAQTAGAICAIH---NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LI+E MAQTAGA+   H   +G +Q    Y M++D+ARFRKPV PGD L  HV K+++R 
Sbjct: 70  LIVEAMAQTAGALVINHLGTSGSNQLV--YFMTVDRARFRKPVVPGDVLHVHVTKIQSRG 127

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WK+    KV   +VAE ++ AM+
Sbjct: 128 SVWKYHGEGKVNGQLVAECDLGAMI 152


>gi|90423946|ref|YP_532316.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           BisB18]
 gi|109828960|sp|Q215D9|FABZ_RHOPB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|90105960|gb|ABD87997.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodopseudomonas
           palustris BisB18]
          Length = 151

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 104/143 (72%), Gaps = 1/143 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI  +++ LPHRYPFLL+D+VVNI++D S IGIKNV+FNEP F+GHFP RPV PGV
Sbjct: 7   IETVDINTILKTLPHRYPFLLIDRVVNIRQDYSGIGIKNVSFNEPAFLGHFPERPVFPGV 66

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           L++EGMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +
Sbjct: 67  LMIEGMAQTAGVIGIMSVEGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMKSIGRRKSM 126

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
           W F   AKV   VVAEA++ AM+
Sbjct: 127 WWFHGDAKVNGVVVAEADVGAML 149


>gi|162147926|ref|YP_001602387.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542544|ref|YP_002274773.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|190359384|sp|A9HKU2|FABZ_GLUDA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|161786503|emb|CAP56085.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530221|gb|ACI50158.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 161

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 105/147 (71%), Gaps = 3/147 (2%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
            C++A D++ +M  +PHRYPFLL+D++V+I    SA+GIKNVT +EPHF GHFP RPVMP
Sbjct: 15  TCIEAIDVMRIMEAIPHRYPFLLIDRMVDIVLGSSAVGIKNVTASEPHFQGHFPARPVMP 74

Query: 66  GVLILEGMAQTAGAICAIHNG--FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           GVLI+E MAQTA  +  +  G  F+     Y M+ID A+FR+PV PGD+L  HV K R+R
Sbjct: 75  GVLIIEAMAQTAATLVVLTLGPAFEGKL-VYFMTIDGAKFRRPVGPGDQLRIHVEKERSR 133

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVM 150
            ++WKF+  A+V+   VAEA   AM+M
Sbjct: 134 ANVWKFKGIARVDGVSVAEATFSAMIM 160


>gi|83592931|ref|YP_426683.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodospirillum rubrum ATCC
           11170]
 gi|83575845|gb|ABC22396.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 164

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (69%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  +PHRYPFL+VDK++++ R ESAIGIKNVT NEP F GHFP RPVMPGVLI+E
Sbjct: 19  DIARIIDMIPHRYPFLMVDKLIDMVRGESAIGIKNVTINEPFFQGHFPNRPVMPGVLIVE 78

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G        Y M ++ ARFRKPV PGD+L  HV K R+R ++WKF+
Sbjct: 79  AMAQTAAVLVVETLGVRAEGKIVYFMIVENARFRKPVIPGDQLRLHVAKERHRGNVWKFR 138

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             AKV+  VVAEA   AM+M E+ +
Sbjct: 139 GVAKVDEVVVAEATFAAMIMDEEPQ 163


>gi|75676040|ref|YP_318461.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrobacter winogradskyi Nb-255]
 gi|91206637|sp|Q3SRI2|FABZ_NITWN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|74420910|gb|ABA05109.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Nitrobacter
           winogradskyi Nb-255]
          Length = 151

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (72%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLL+D+V+NI+ D S IG+KNVTFNEP F GHFP RPV PGVL++E
Sbjct: 11  DIATILKTLPHRYPFLLIDRVLNIRADHSGIGVKNVTFNEPAFQGHFPERPVYPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGIMSVEGTEKPRAVYFLTIDKCKFRKPVMPGDIVEYHMRSIGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV  T+VAEA++ AM+
Sbjct: 131 GDAKVNGTIVAEADVGAML 149


>gi|91206646|sp|Q2RTZ9|FABZ_RHORT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 160

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (69%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  +PHRYPFL+VDK++++ R ESAIGIKNVT NEP F GHFP RPVMPGVLI+E
Sbjct: 15  DIARIIDMIPHRYPFLMVDKLIDMVRGESAIGIKNVTINEPFFQGHFPNRPVMPGVLIVE 74

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G        Y M ++ ARFRKPV PGD+L  HV K R+R ++WKF+
Sbjct: 75  AMAQTAAVLVVETLGVRAEGKIVYFMIVENARFRKPVIPGDQLRLHVAKERHRGNVWKFR 134

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             AKV+  VVAEA   AM+M E+ +
Sbjct: 135 GVAKVDEVVVAEATFAAMIMDEEPQ 159


>gi|144898243|emb|CAM75107.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 157

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 99/145 (68%), Gaps = 11/145 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  +PHRYPFL+VDKVV I  + SAIGIKNVT NEP F GHFP RPVMPGVLI+E
Sbjct: 16  DINRIMEMIPHRYPFLMVDKVVGIVSNVSAIGIKNVTINEPFFQGHFPERPVMPGVLIIE 75

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQTA  +       D   P       Y MS+D ARFRKPV PGD+L  HV K R+R +
Sbjct: 76  AMAQTAAVLVV-----DTLGPSAEGKLVYFMSVDSARFRKPVGPGDQLAIHVFKERSRGN 130

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +WKF+  AKV +T++AEA   AM+M
Sbjct: 131 VWKFRAEAKVGDTLMAEATYAAMIM 155


>gi|13470833|ref|NP_102402.1| (3R)-hydroxymyristoyl-ACP dehydratase [Mesorhizobium loti
           MAFF303099]
 gi|20138307|sp|Q98MC5|FABZ_RHILO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|14021576|dbj|BAB48188.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Mesorhizobium loti MAFF303099]
          Length = 152

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 110/145 (75%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L+A DI+ LM+ LPHRYPFL++D++++I  D+SAIGIKNVT NEPHF GHFP +PVMP
Sbjct: 5   TTLEAVDIMGLMKLLPHRYPFLMIDRIIDIDGDDSAIGIKNVTINEPHFQGHFPEQPVMP 64

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GVLI+E MAQTAGAIC    G  + +  Y ++ID A+FRKPV PGD+L+ HV K++ R +
Sbjct: 65  GVLIVEAMAQTAGAICIRSLGASKPSLVYFLTIDNAKFRKPVVPGDQLKIHVKKIKKRGN 124

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           L KF C A V+ T  AEAEI AM++
Sbjct: 125 LLKFACEALVDGTKAAEAEISAMMV 149


>gi|58040252|ref|YP_192216.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gluconobacter oxydans 621H]
 gi|62286695|sp|Q5FPY6|FABZ_GLUOX RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|58002666|gb|AAW61560.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Gluconobacter oxydans 621H]
          Length = 169

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 103/141 (73%), Gaps = 3/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++M+ +PHRYPFLL+DK+V I   +SAIGIKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 29  DILKIMQSIPHRYPFLLIDKMVEIHAGQSAIGIKNVTVNEPFFQGHFPSHPVMPGVLIVE 88

Query: 72  GMAQTAGAICAIHNG--FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQTA  +  +  G  F+     Y M+I+ A+FR+PV PGD+L  HV+K R+R ++WKF
Sbjct: 89  AMAQTAATLVVMTLGKAFEGKL-VYFMTIENAKFRRPVGPGDQLRIHVDKERSRANVWKF 147

Query: 130 QCCAKVENTVVAEAEICAMVM 150
           +  A+V++  VAEA   AM+M
Sbjct: 148 KGVARVDDVAVAEATFSAMIM 168


>gi|218458175|ref|ZP_03498266.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhizobium etli Kim 5]
          Length = 132

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 1/132 (0%)

Query: 23  RYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICA 82
           RYPF++VDK++ I  D SA+GIKNVT NEPHF GHF   P+MPGVL++EGMAQTAGAICA
Sbjct: 1   RYPFVMVDKIIEIDGDNSAVGIKNVTVNEPHFTGHFRESPIMPGVLMIEGMAQTAGAICA 60

Query: 83  IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAE 142
              G       Y M I+ ARFRKPV PGDR+E+HV K + R ++WKF C AKV+  +VAE
Sbjct: 61  KKEG-QPGNLVYFMPIENARFRKPVVPGDRVEFHVKKHKQRGNIWKFHCDAKVDGALVAE 119

Query: 143 AEICAMVMHEKK 154
           A+I AM++ + +
Sbjct: 120 ADIGAMIVRKDQ 131


>gi|163795631|ref|ZP_02189597.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [alpha proteobacterium BAL199]
 gi|159179230|gb|EDP63763.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [alpha proteobacterium BAL199]
          Length = 158

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 100/140 (71%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++ +M  +PHRYPFL+VD+V +I  D S IG+KNV+ NEP FMGHFP RPVMPGVLI+E
Sbjct: 17  DVMRVMELIPHRYPFLMVDRVDSIIPDVSCIGVKNVSINEPFFMGHFPKRPVMPGVLIIE 76

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTAG +     G +      Y M++D ARFRKPV PGD+++ HV KVRNR  +WKF+
Sbjct: 77  SMAQTAGCLVVATLGPESEGKLVYFMTVDNARFRKPVVPGDQMKVHVRKVRNRGPVWKFE 136

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A+V   +VAEA   AM++
Sbjct: 137 GEARVNGVLVAEATYSAMIL 156


>gi|288958457|ref|YP_003448798.1| 3R-hydroxymyristoyl ACP dehydrase [Azospirillum sp. B510]
 gi|288910765|dbj|BAI72254.1| 3R-hydroxymyristoyl ACP dehydrase [Azospirillum sp. B510]
          Length = 160

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 99/147 (67%), Gaps = 1/147 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D  DI  +M+ +PHRYP L++D+V++I   E A G+KNVT NEP F GHFP RPVMPGV
Sbjct: 14  IDDLDIGRIMQMIPHRYPILMIDRVIDITLGEGATGVKNVTINEPFFQGHFPSRPVMPGV 73

Query: 68  LILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQT+  +     G D      Y M++D+ARFR+PV PGD +  HV K R R ++
Sbjct: 74  LIIEAMAQTSAVLVVATLGPDAEGKLVYFMTVDEARFRRPVTPGDTIHIHVTKQRQRANV 133

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
           WKF+  AKV   +VAEA   AM++ EK
Sbjct: 134 WKFKGEAKVNGVLVAEAVYSAMILDEK 160


>gi|115524570|ref|YP_781481.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           BisA53]
 gi|122296181|sp|Q07NI3|FABZ_RHOP5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|115518517|gb|ABJ06501.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodopseudomonas
           palustris BisA53]
          Length = 151

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 101/139 (72%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHR+PFLL+D+V+NI+ D S IG+KNV+FNEP F GHFP RPV PGVL++E
Sbjct: 11  DINQILKTLPHRFPFLLIDRVINIREDYSGIGVKNVSFNEPCFQGHFPDRPVFPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGIMSVTGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMKSIGRRKAMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV   VVAEA++ AM+
Sbjct: 131 GDAKVNGVVVAEADVGAML 149


>gi|225627620|ref|ZP_03785657.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           ceti str. Cudo]
 gi|225617625|gb|EEH14670.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Brucella
           ceti str. Cudo]
          Length = 144

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+A DI  L+  LPHRYPFLL+D++V+I  D SA GIKNVT NEPHF GHFP  P+MPGV
Sbjct: 9   LEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQTAGAI  +     +    Y M+ID A+FR+PV PGDRL  HV K++ R ++ 
Sbjct: 69  LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLHVKKIKQRANIS 128

Query: 128 KFQCCAKVEN 137
           K++C A+V+ 
Sbjct: 129 KYECVAEVDG 138


>gi|39935977|ref|NP_948253.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           CGA009]
 gi|192291630|ref|YP_001992235.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           TIE-1]
 gi|47605592|sp|P61454|FABZ_RHOPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700254|sp|B3Q7J4|FABZ_RHOPT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|39649831|emb|CAE28353.1| possible (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Rhodopseudomonas palustris CGA009]
 gi|192285379|gb|ACF01760.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodopseudomonas palustris TIE-1]
          Length = 151

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 100/139 (71%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHR+PFLL+D+V+NI+ D S IGIKNVT NEP F GHFP RPV PGVL++E
Sbjct: 11  DINTILKTLPHRFPFLLIDRVINIREDYSGIGIKNVTVNEPAFQGHFPERPVYPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+ +   R  +W F 
Sbjct: 71  GMAQTAGVIGILSVTGTEKPRAVYFLTIDKCKFRKPVMPGDTVEYHLTRTGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV+  +VAEA++ AM+
Sbjct: 131 GEAKVDGQIVAEADVGAML 149


>gi|316933931|ref|YP_004108913.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodopseudomonas palustris DX-1]
 gi|315601645|gb|ADU44180.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodopseudomonas palustris DX-1]
          Length = 151

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 100/139 (71%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHR+PFLL+D+V+NI+ D S IGIKNVT NEP F GHFP RPV PGVL++E
Sbjct: 11  DINTILKTLPHRFPFLLIDRVINIREDYSGIGIKNVTVNEPAFQGHFPERPVYPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+ +   R  +W F 
Sbjct: 71  GMAQTAGVIGILSVTGTEKPRAVYFLTIDKCKFRKPVMPGDTVEYHLTRTGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV+  +VAEA++ AM+
Sbjct: 131 GEAKVDGQIVAEADVGAML 149


>gi|85716986|ref|ZP_01047949.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrobacter sp. Nb-311A]
 gi|85696188|gb|EAQ34083.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrobacter sp. Nb-311A]
          Length = 151

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 100/139 (71%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLL+D+V+NI+ D S IG+KNVT NEP F GHFP RPV PGVL++E
Sbjct: 11  DIATILKTLPHRYPFLLIDRVLNIRADHSGIGVKNVTVNEPAFQGHFPERPVYPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGIMSVEGTEKPRAVYFLTIDKCKFRKPVVPGDIVEYHMRSIGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             A+V  T+VAEA++ AM+
Sbjct: 131 GDARVNGTIVAEADVGAML 149


>gi|46202583|ref|ZP_00052963.2| COG0764: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
           protein) dehydratases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 159

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 100/143 (69%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ +PHRYPFL+VD+VV +  +ESA+GIKNVT NEP F GHFP RPV PGVLI+E
Sbjct: 17  DISRIIQMIPHRYPFLMVDRVVQVVANESAVGIKNVTINEPFFQGHFPSRPVFPGVLIIE 76

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G        Y MS++ ARFRKPV PGD+L  HV K R+R ++WKF+
Sbjct: 77  SMAQTAAVLVVETLGESAEGKLVYFMSVENARFRKPVGPGDQLMIHVFKERSRGNVWKFR 136

Query: 131 CCAKVENTVVAEAEICAMVMHEK 153
             AKV+  +VAEA   AM++ EK
Sbjct: 137 GEAKVDGVLVAEATYAAMILDEK 159


>gi|329114459|ref|ZP_08243221.1| (3R)-hydroxymyristoyl-dehydratase [Acetobacter pomorum DM001]
 gi|326696535|gb|EGE48214.1| (3R)-hydroxymyristoyl-dehydratase [Acetobacter pomorum DM001]
          Length = 170

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 1/149 (0%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
            D   +D  D+  +M+ +PHRYPFLL+D++ +I   E A GIKNV+ NEP F GHFP RP
Sbjct: 21  QDAQTIDRIDVNRIMQAIPHRYPFLLIDRMEDIVLGEEATGIKNVSVNEPFFQGHFPARP 80

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           VMPGVL++E MAQTA  +  +  G D +    Y M+I+ A+FR+PV PGD++  HV K R
Sbjct: 81  VMPGVLLVEAMAQTAATLVVLTLGKDFEGKLVYFMTIEGAKFRRPVEPGDQVRIHVAKER 140

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVM 150
           +R ++WKF+  A+VE TVVAEA   AM+M
Sbjct: 141 HRSNVWKFRGEARVEGTVVAEATFSAMIM 169


>gi|92117251|ref|YP_576980.1| (3R)-hydroxymyristoyl-ACP dehydratase [Nitrobacter hamburgensis
           X14]
 gi|122418003|sp|Q1QMM7|FABZ_NITHX RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91800145|gb|ABE62520.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Nitrobacter
           hamburgensis X14]
          Length = 151

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLL+D+V+NI+ D S IG+KNVT NEP F GHFP RPV PGVL++E
Sbjct: 11  DIATILKTLPHRYPFLLIDRVINIRADHSGIGVKNVTINEPAFQGHFPERPVYPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I      G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGITSVEGTEKPRAVYFLTIDKCKFRKPVMPGDIVEYHMRSIGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV    VAEA++ AM+
Sbjct: 131 GDAKVNGATVAEADVGAML 149


>gi|296115051|ref|ZP_06833693.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978388|gb|EFG85124.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 139

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 100/139 (71%), Gaps = 3/139 (2%)

Query: 14  VELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGM 73
           + +M  +PHRYPFLL+D++V+I R +SA+GIKNV+ NEPHF GHFP RPVMPGVLI+E M
Sbjct: 1   MRIMEAIPHRYPFLLIDRMVDIVRGQSAVGIKNVSVNEPHFQGHFPARPVMPGVLIIEAM 60

Query: 74  AQTAGAICAIHNG--FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           AQTA  +  +  G  F+     Y M+ID A+FR+PV PGD+L   V K R+R ++WKF+ 
Sbjct: 61  AQTAATLVVLTLGEAFEGKL-VYFMTIDGAKFRRPVGPGDQLRISVEKERSRANVWKFKG 119

Query: 132 CAKVENTVVAEAEICAMVM 150
            A+V+   VAEA   AM+M
Sbjct: 120 IARVDGVSVAEATFSAMIM 138


>gi|148261432|ref|YP_001235559.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidiphilium cryptum JF-5]
 gi|326404912|ref|YP_004284994.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Acidiphilium multivorum AIU301]
 gi|190359368|sp|A5G1A8|FABZ_ACICJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|146403113|gb|ABQ31640.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Acidiphilium
           cryptum JF-5]
 gi|325051774|dbj|BAJ82112.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Acidiphilium multivorum AIU301]
          Length = 165

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 98/143 (68%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +MR +PHRYPFLL+D+VV +  + SAIG+KNV+ NE  F GHFPG PVMPGVLI+E
Sbjct: 19  DIAGIMRAIPHRYPFLLIDRVVELVPNVSAIGVKNVSVNESFFQGHFPGHPVMPGVLIIE 78

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G ++     Y MS++ A+FR+PV PGD L  HV K RNR ++WKF 
Sbjct: 79  SMAQTAAVLVVETLGPEEAGKVVYFMSVEGAKFRRPVVPGDVLRIHVAKERNRGNVWKFN 138

Query: 131 CCAKVENTVVAEAEICAMVMHEK 153
             A+V+   VAEA   AM+M +K
Sbjct: 139 AVARVDGVAVAEATYAAMIMDKK 161


>gi|86749935|ref|YP_486431.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           HaA2]
 gi|109828955|sp|Q2IW90|FABZ_RHOP2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|86572963|gb|ABD07520.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodopseudomonas
           palustris HaA2]
          Length = 151

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHR+PFLL+D+V NI+ D S IG+KNVTFNEP F GHFP RPV PGVL++E
Sbjct: 11  DINTILKTLPHRFPFLLIDRVKNIREDHSGIGVKNVTFNEPAFQGHFPERPVFPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +   G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGIMSVTGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMKSIGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V+   VAEA++ AM+
Sbjct: 131 GDAIVDGQTVAEADVGAML 149


>gi|91977317|ref|YP_569976.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodopseudomonas palustris
           BisB5]
 gi|123721793|sp|Q136B4|FABZ_RHOPS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91683773|gb|ABE40075.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodopseudomonas
           palustris BisB5]
          Length = 151

 Score =  158 bits (399), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHR+PFLL+D+V NI+ D S IG+KNVTFNEP F GHFP RPV PGVL++E
Sbjct: 11  DINTILKTLPHRFPFLLIDRVRNIREDYSGIGVKNVTFNEPAFQGHFPDRPVFPGVLMIE 70

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I  +  +G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 71  GMAQTAGVIGIMSVSGTEKPRAVYFLTIDKCKFRKPVLPGDTVEYHMKSIGRRKTMWWFH 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V+   VAEA++ AM+
Sbjct: 131 GDAVVDGKTVAEADVGAML 149


>gi|83311586|ref|YP_421850.1| (3R)-hydroxymyristoyl-ACP dehydratase [Magnetospirillum magneticum
           AMB-1]
 gi|109828936|sp|Q2W4D4|FABZ_MAGMM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|82946427|dbj|BAE51291.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Magnetospirillum magneticum AMB-1]
          Length = 161

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/143 (53%), Positives = 99/143 (69%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ +PHRYPFL+VD+VV +  +ESA+GIKNVT NEP F GHFP RPV PGVLI+E
Sbjct: 19  DISRIIQMIPHRYPFLMVDRVVQVVANESAVGIKNVTINEPFFQGHFPSRPVFPGVLIIE 78

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G        Y MS++  RFRKPV PGD+L  HV K R+R ++WKF+
Sbjct: 79  SMAQTAAVLVVETLGESAEGKLVYFMSVENCRFRKPVGPGDQLMIHVFKERSRGNVWKFR 138

Query: 131 CCAKVENTVVAEAEICAMVMHEK 153
             AKV+  +VAEA   AM++ EK
Sbjct: 139 GEAKVDGVLVAEATYAAMILDEK 161


>gi|73667478|ref|YP_303494.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ehrlichia canis str. Jake]
 gi|91206631|sp|Q3YQV9|FABZ_EHRCJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|72394619|gb|AAZ68896.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Ehrlichia canis
           str. Jake]
          Length = 148

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 98/141 (69%), Gaps = 4/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+++ +PH YPFLL+DKV+    +ES I +KNVTFNEP F+GHFPG P+MPGVLI+E
Sbjct: 4   NIQEIIKMIPHSYPFLLIDKVIACTPNESTIAVKNVTFNEPFFIGHFPGNPIMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYA---PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ A  IC I N   Q       Y MSI+ A+FRKPV PGD L   VN    R +  K
Sbjct: 64  AMAQ-ACMICVISNDQGQNTQDYSVYFMSIELAKFRKPVIPGDTLIIEVNVTHKRNNTCK 122

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           FQC A+VENT+VAEA+I AM+
Sbjct: 123 FQCHAQVENTLVAEAQILAMI 143


>gi|209885094|ref|YP_002288951.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oligotropha carboxidovorans OM5]
 gi|209873290|gb|ACI93086.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oligotropha carboxidovorans OM5]
          Length = 152

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 97/142 (68%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI  +M+ LPHRYPFLL+D+VV+I+ D S IG+KNVT NEP F GHFP RP+ PGV
Sbjct: 9   LETVDIATIMKTLPHRYPFLLIDRVVDIRTDFSGIGVKNVTVNEPCFQGHFPNRPIYPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           L++EGMAQTAG I  +    ++    Y ++ID  +FRKP  PGD +EYH+  +  +  +W
Sbjct: 69  LMIEGMAQTAGVIGMLSTETERPTAVYFLTIDNCKFRKPAGPGDVIEYHLRLINRKRAMW 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
            F   AKV    VAEA++ AM+
Sbjct: 129 WFHGDAKVNGVTVAEADVGAML 150


>gi|299134991|ref|ZP_07028182.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Afipia
           sp. 1NLS2]
 gi|298589968|gb|EFI50172.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Afipia
           sp. 1NLS2]
          Length = 152

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI  +M+ LPHRYPFLL+D+VV+I+ D S IGIKNVT NEP F GHFP RP+ PGV
Sbjct: 9   LESVDIGTIMKTLPHRYPFLLIDRVVDIRDDFSGIGIKNVTANEPCFQGHFPNRPIYPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           L++EGMAQTAG I  +    ++    Y ++IDK +FRKP  PGD + YH+  V  +  +W
Sbjct: 69  LMIEGMAQTAGVIGMLSTETERPTAVYFLTIDKCKFRKPAGPGDVISYHMRLVNRKRAMW 128

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
            F   AKV    VAEA++ AM+
Sbjct: 129 WFHGDAKVNGVTVAEADVGAML 150


>gi|296536116|ref|ZP_06898247.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Roseomonas cervicalis ATCC 49957]
 gi|296263561|gb|EFH10055.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Roseomonas cervicalis ATCC 49957]
          Length = 162

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (66%), Gaps = 1/144 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D+ DI  +MR +PHRYPFLLVD+VV++   ESA G+KNVT NE  F GHFP  PVMPGV
Sbjct: 17  MDSCDIARVMRAIPHRYPFLLVDRVVDMVLGESATGVKNVTINENFFQGHFPSHPVMPGV 76

Query: 68  LILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQTA  +     G   +    Y MSI+ A+FR+PV PGD+L  H+ K R R  +
Sbjct: 77  LIIEAMAQTAAVLVVETLGPSAHGKIVYFMSIENAKFRRPVGPGDQLRIHIVKERQRGAV 136

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           WKF   AKV+   VAEA   AM+M
Sbjct: 137 WKFNAVAKVDGVAVAEASYAAMIM 160


>gi|148255860|ref|YP_001240445.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bradyrhizobium sp. BTAi1]
 gi|190359372|sp|A5EK45|FABZ_BRASB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|146408033|gb|ABQ36539.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Bradyrhizobium
           sp. BTAi1]
          Length = 152

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++ LPHRYPFLL+D+V NI+ D S IG+KNV+  EP F GHFP RPV PGVL++E
Sbjct: 12  DINEILKTLPHRYPFLLIDRVKNIRADYSGIGVKNVSIGEPCFQGHFPERPVYPGVLMIE 71

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I      G ++    Y ++IDK +FRKPV PG  +EYH+  +  R  +W F 
Sbjct: 72  GMAQTAGVIGIKSVEGTEKPRAVYFLTIDKCKFRKPVLPGQTIEYHMRSIGRRKTMWWFH 131

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV+ T+VAEA++ AM+
Sbjct: 132 GDAKVDGTIVAEADVGAML 150


>gi|114768805|ref|ZP_01446431.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [alpha proteobacterium HTCC2255]
 gi|114549722|gb|EAU52603.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [alpha proteobacterium HTCC2255]
          Length = 156

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ R +PHRYPFLL+D V  I+ +ESAIGIKNVTFNEPHF GHFP RPVMPGV I+E
Sbjct: 12  DIQDIKRMIPHRYPFLLIDAVKEIKLNESAIGIKNVTFNEPHFQGHFPERPVMPGVTIVE 71

Query: 72  GMAQTAGA-ICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA   +    N  D     Y ++IDK +FR  V P D+LE HV  +R R  LWKF 
Sbjct: 72  AMAQTAAVLVVKTLNMIDNNMLVYFLTIDKCKFRHVVSPPDQLELHVKVLRGRGKLWKFY 131

Query: 131 CCAKVENTVVAEAEICAMVM 150
              KV + VVAEAE  AM++
Sbjct: 132 GEGKVGDVVVAEAEFTAMMV 151


>gi|146341059|ref|YP_001206107.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bradyrhizobium sp. ORS278]
 gi|190359373|sp|A4YVF6|FABZ_BRASO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|146193865|emb|CAL77882.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Bradyrhizobium sp. ORS278]
          Length = 152

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++ LPHR PFLL+D+V NI+ D S IG+KNV+FNEP F GHFP RPV PGVL++E
Sbjct: 12  DINEILKTLPHRNPFLLIDRVKNIRADYSGIGVKNVSFNEPCFQGHFPERPVYPGVLMIE 71

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           GMAQTAG I      G ++    Y ++IDK +FRKPV PG  +EYH+  +  R  +W F 
Sbjct: 72  GMAQTAGVIGIKSVEGTEKPRAVYFLTIDKCKFRKPVLPGQTIEYHMRSIGRRKTMWWFH 131

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV+  VVAEA++ AM+
Sbjct: 132 GDAKVDGVVVAEADVGAML 150


>gi|27379962|ref|NP_771491.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bradyrhizobium japonicum
           USDA 110]
 gi|33516892|sp|Q89KQ3|FABZ_BRAJA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|27353115|dbj|BAC50116.1| (3R)-hydroxymyristoyl ACP dehydrase [Bradyrhizobium japonicum USDA
           110]
          Length = 153

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHR+P LL+D+V+NI+ D S IGIKNVTFNEP F GHFP RPV PGV+++E
Sbjct: 13  DINAILQTLPHRFPMLLIDRVINIRADYSGIGIKNVTFNEPAFQGHFPERPVYPGVMMIE 72

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTAG I      G ++    Y ++IDK +FRKPV PGD +EYH+  +  R  +W F 
Sbjct: 73  AMAQTAGVIGIKSVEGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMRSLGRRKTMWWFH 132

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV   VVAEA++ AM+
Sbjct: 133 GDAKVNGQVVAEADVGAML 151


>gi|206889615|ref|YP_002247943.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741553|gb|ACI20610.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 140

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 96/138 (69%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  LPHRYPFLLVD+V+ +  +E A+G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DIKEIMDILPHRYPFLLVDRVLELIPNEKAVGVKNVTMNEPFFQGHFPGNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ AG + A  +G +     +L SI+K +FRKP+ PGDR+ + V+ +  R  +WKF  
Sbjct: 63  AMAQVAG-VLAFKSGMEGTGVLFL-SIEKVKFRKPIIPGDRIIFEVSVIHRRGGVWKFAG 120

Query: 132 CAKVENTVVAEAEICAMV 149
            AK++  V  EAE  AMV
Sbjct: 121 IAKIDEKVATEAEFTAMV 138


>gi|114327607|ref|YP_744764.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Granulibacter bethesdensis CGDNIH1]
 gi|122327422|sp|Q0BTL1|FABZ_GRABC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|114315781|gb|ABI61841.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 170

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M+ +PHRYPFLLVD+V++I R E  IGIKNVT +E HF GHFP  PVMPGVLI+E
Sbjct: 21  DIAGIMKMIPHRYPFLLVDRVIDIVRGERGIGIKNVTASESHFAGHFPNHPVMPGVLIIE 80

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +     G D      Y MSI+ A+FR+PV PGD+L     ++++R ++WKF+
Sbjct: 81  SMAQTAAVLVVDALGTDAEGRVVYFMSIEGAKFRRPVVPGDQLRIECERLQHRGNVWKFR 140

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A+V+  +VAEA   AM++
Sbjct: 141 GTARVDGQIVAEASFAAMIL 160


>gi|209964509|ref|YP_002297424.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodospirillum centenum SW]
 gi|209957975|gb|ACI98611.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodospirillum centenum SW]
          Length = 161

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 102/143 (71%), Gaps = 3/143 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+ +M+ +PHRYP LL+DKVV+I   ES  GIKNVT NEP F GHFP RPVMPGV+I+E
Sbjct: 19  DILRIMQMIPHRYPMLLIDKVVDIVTGESCTGIKNVTINEPFFTGHFPARPVMPGVMIVE 78

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQT+ A+  +H+  +       Y M+ID+ARFR+P+ PGDR+E  V K +NR ++W+F
Sbjct: 79  AMAQTS-AVLVMHSLGESAEGRLVYFMTIDEARFRRPIVPGDRIEIKVQKQQNRRNVWRF 137

Query: 130 QCCAKVENTVVAEAEICAMVMHE 152
           +  A V+ T+ AEA   AM++ +
Sbjct: 138 RGEAWVDGTLCAEAVYAAMIVMD 160


>gi|258541755|ref|YP_003187188.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632833|dbj|BAH98808.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256635890|dbj|BAI01859.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256638945|dbj|BAI04907.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256641999|dbj|BAI07954.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645054|dbj|BAI11002.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648109|dbj|BAI14050.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651162|dbj|BAI17096.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654153|dbj|BAI20080.1| 3R-hydroxymyristoyl-[acyl-carrier-protein (ACP)] dehydratase FabZ
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 136

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 1/135 (0%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M+ +PHRYPFLL+D++ +I   E A GIKNV+ NEP F GHFP RPVMPGVL++E MAQT
Sbjct: 1   MQAIPHRYPFLLIDRMEDIVLGEEATGIKNVSVNEPFFQGHFPARPVMPGVLLVEAMAQT 60

Query: 77  AGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV 135
           A  +  +  G D +    Y M+I+ A+FR+PV PGD++  HV K R+R ++WKF+  A+V
Sbjct: 61  AATLVVLTLGKDFEGKLVYFMTIEGAKFRRPVEPGDQVRIHVAKERHRSNVWKFRGEARV 120

Query: 136 ENTVVAEAEICAMVM 150
           E TVVAEA   AM+M
Sbjct: 121 EGTVVAEATFSAMIM 135


>gi|163731906|ref|ZP_02139353.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter litoralis Och 149]
 gi|161395360|gb|EDQ19682.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter litoralis Och 149]
          Length = 148

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 94/145 (64%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           + + DI  + R LPHRYPFLLVDKVV I    SA+GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 1   MASADIQLIQRILPHRYPFLLVDKVVEIDGTSSALGIKNVTMNEPHFQGHFPGMPIMPGV 60

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
            I+E MAQTA  +  +     D+    Y M+IDKA+FR+ V PGD LE  +N +R +   
Sbjct: 61  TIVEAMAQTAAVMVGVTLEMADKEMKVYFMAIDKAKFRRKVIPGDVLEMRLNTLRGKPGG 120

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +W+F   A VE  + AE E  AM+
Sbjct: 121 KVWRFGGVASVEGEMAAEVEFTAMM 145


>gi|110679825|ref|YP_682832.1| (3R)-hydroxymyristoyl-ACP dehydratase [Roseobacter denitrificans
           OCh 114]
 gi|122972726|sp|Q166E7|FABZ_ROSDO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|109455941|gb|ABG32146.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter denitrificans OCh 114]
          Length = 152

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 93/143 (65%), Gaps = 3/143 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + DI  + R LPHRYPFLLVDKVV I    SA+GIKNVT NEPHF GHFPG P+MPGV I
Sbjct: 7   SADIQLIQRILPHRYPFLLVDKVVEIDGTTSALGIKNVTMNEPHFQGHFPGMPIMPGVTI 66

Query: 70  LEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDL 126
           +E MAQTA  +  +     D+    Y M+IDKA+FR+ V PGD LE  +N +R +    +
Sbjct: 67  VEAMAQTAAVMVGVTLEMADKEMKVYFMAIDKAKFRRKVIPGDVLEMRLNTLRGKPGGKV 126

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
           W+F   A VE  + AE E  AM+
Sbjct: 127 WRFGGVASVEGEMAAEVEFTAMM 149


>gi|260433799|ref|ZP_05787770.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417627|gb|EEX10886.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 157

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 95/145 (65%), Gaps = 7/145 (4%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + DI  + R LPHRYPFLLVDKV  I   +SA+GIKNVT NEPHF GHFPG P+MPGV I
Sbjct: 7   SADIQLIQRILPHRYPFLLVDKVEEIDGYQSAVGIKNVTMNEPHFQGHFPGTPIMPGVTI 66

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
           +E MAQTAG +  +  GFD        Y MSIDK +FR+ V PGD ++ HV  +R +   
Sbjct: 67  VEAMAQTAGVMLGV--GFDVIDTELLIYFMSIDKCKFRRKVVPGDVMQMHVTTMRGKPGG 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            L+KF+  A VE  V AEAE  A V
Sbjct: 125 KLFKFKGVASVEGEVAAEAEFSAYV 149


>gi|117925147|ref|YP_865764.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Magnetococcus sp.
           MC-1]
 gi|190359387|sp|A0L8R5|FABZ_MAGSM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|117608903|gb|ABK44358.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Magnetococcus sp.
           MC-1]
          Length = 153

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 102/154 (66%), Gaps = 7/154 (4%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D   + E+M FLPHRYPFLL+D++V +++ +  + IKNV+FNEPHF GHFP  PVMPGVL
Sbjct: 4   DPISLQEIMSFLPHRYPFLLIDRIVEVEQGKRILAIKNVSFNEPHFQGHFPDHPVMPGVL 63

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           ILE MAQ AGA+ A +   D       Y M+IDKARFRKPV PG +L   +  ++ R ++
Sbjct: 64  ILEAMAQ-AGALLAGYTDPDSVRGQLVYFMAIDKARFRKPVLPGHQLNIEMTLLKRRREV 122

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEKKEKNESH 160
           W+F   A V+  V  EAE+ AM     +++ ESH
Sbjct: 123 WRFGGKAMVDGEVACEAEVMAMT----RKREESH 152


>gi|254511071|ref|ZP_05123138.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacteraceae bacterium KLH11]
 gi|221534782|gb|EEE37770.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacteraceae bacterium KLH11]
          Length = 157

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 95/143 (66%), Gaps = 3/143 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + DI  + R LPHRYPFLLVDKVV+I    SA+GIKNVT NEPHF GHFPG P+MPGV I
Sbjct: 7   SADIQLIQRILPHRYPFLLVDKVVDITGYHSAVGIKNVTMNEPHFQGHFPGTPIMPGVTI 66

Query: 70  LEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV--DL 126
           +E MAQTAG +  +  +  D     Y M+IDK +FR+ V PGD LE HV  VR +    +
Sbjct: 67  VEAMAQTAGVMLGVGMDVIDSELLIYFMNIDKCKFRRKVVPGDVLEMHVETVRGKKGGKI 126

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
           +KF   A V++ V AEAE  A V
Sbjct: 127 FKFSGRATVDDEVAAEAEFSAYV 149


>gi|302038340|ref|YP_003798662.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Candidatus Nitrospira defluvii]
 gi|300606404|emb|CBK42737.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Candidatus Nitrospira defluvii]
          Length = 151

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 91/146 (62%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +   D VE+   LPHRYPFLLVD++  +  D   +GIKNVT NEP F GHFPGRPVMPGV
Sbjct: 1   MSVMDNVEIQSILPHRYPFLLVDRIRELDPDRRIVGIKNVTINEPFFQGHFPGRPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILE +AQ  G +     G       YL  ID A+FRKPV PGD L   V+ ++ R   W
Sbjct: 61  LILEALAQVGGVLAFKSLGAVGRPVVYLTGIDGAKFRKPVVPGDILRLEVDVLKKRAPFW 120

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEK 153
           K Q  A VE+ +V EAE+ AMV  E+
Sbjct: 121 KMQGRAFVESELVCEAEVTAMVTDEQ 146


>gi|91206003|ref|YP_538358.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia bellii RML369-C]
 gi|109828970|sp|Q1RH95|FABZ_RICBR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91069547|gb|ABE05269.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia bellii RML369-C]
          Length = 145

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVDKVV I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDLIPHRYPFLLVDKVVEIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ ++FRK V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQLAAILVAKSLGSTKNKEVFLMAIENSKFRKVVQPGDTMHIHATIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
             KV+  + AE++  AM+
Sbjct: 124 TVKVDGEMAAESKFTAMI 141


>gi|83942318|ref|ZP_00954779.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfitobacter sp. EE-36]
 gi|83953537|ref|ZP_00962258.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfitobacter sp. NAS-14.1]
 gi|83841482|gb|EAP80651.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfitobacter sp. NAS-14.1]
 gi|83846411|gb|EAP84287.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfitobacter sp. EE-36]
          Length = 152

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/146 (50%), Positives = 95/146 (65%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI  + R +PHRYPFLLVDKVV+IQ  +SA+GIKNVT NEPHF GHFPG P+MPG
Sbjct: 4   TLPSADIQMIQRIIPHRYPFLLVDKVVDIQGTQSAVGIKNVTMNEPHFQGHFPGMPIMPG 63

Query: 67  VLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQTA  +  +     D+    Y M+IDK +FR+ V PGD +   +N +R +  
Sbjct: 64  VTIVEAMAQTAAVMVGVTLEMADKDMKVYFMAIDKCKFRRKVVPGDVVRMELNTLRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A VE  + AE E  AM+
Sbjct: 124 GKVWKFGGVASVEGEMAAEVEFTAMM 149


>gi|126737631|ref|ZP_01753361.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. SK209-2-6]
 gi|126721024|gb|EBA17728.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. SK209-2-6]
          Length = 154

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/151 (53%), Positives = 98/151 (64%), Gaps = 3/151 (1%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L + DI  + R LPHRYPFLLVDKVV+I    SA GIKNVT NEPHF GHFPG P+MP
Sbjct: 3   AELQSADIHLIQRILPHRYPFLLVDKVVDIDGFSSARGIKNVTMNEPHFQGHFPGAPIMP 62

Query: 66  GVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR- 123
           GV I+E MAQTAG +  +  +  D     Y M+IDK +FR+ V PGD LE  V  +R + 
Sbjct: 63  GVTIVEAMAQTAGVMLGVALDMVDTDLLIYFMNIDKCKFRRKVIPGDVLEMKVETLRGKP 122

Query: 124 -VDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
              ++KF+  A VE  V AEAE  AMV  +K
Sbjct: 123 GGKIFKFKGTATVEGEVAAEAEFTAMVDLQK 153


>gi|254465303|ref|ZP_05078714.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacterales bacterium Y4I]
 gi|206686211|gb|EDZ46693.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacterales bacterium Y4I]
          Length = 156

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 98/151 (64%), Gaps = 3/151 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  + R LPHRYPFLLVDKVV+I   +SA GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 5   LQSADIQLIQRILPHRYPFLLVDKVVDIDSYKSARGIKNVTMNEPHFQGHFPGTPIMPGV 64

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
            I+E MAQTAG +  +  +  D     Y M+IDK +FR+ V PGD LE HV  +R +   
Sbjct: 65  TIVEAMAQTAGVMLGVGMDMVDTDLLIYFMNIDKCKFRRKVVPGDVLEMHVETLRGKPGG 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
            ++KF   A V   V AEAE  AMV  + +E
Sbjct: 125 KIFKFLGRATVGGEVAAEAEFTAMVDRQAEE 155


>gi|157803196|ref|YP_001491745.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia canadensis str.
           McKiel]
 gi|157784459|gb|ABV72960.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Rickettsia canadensis str. McKiel]
          Length = 144

 Score =  150 bits (378), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 92/138 (66%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVD+V+ I  ++S +GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 3   DITEIMNLIPHRYPFLLVDRVLEIDLNKSILGIKNVTVNEPQFTGHFPARPVMPGVLMVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ ++FR+ V PGD +  H    + R ++WKF  
Sbjct: 63  AMAQLAAILVAKSLGSTKNKEVFLMTIENSKFRRIVQPGDTMHIHTVIDQQRANVWKFSS 122

Query: 132 CAKVENTVVAEAEICAMV 149
             K+E  + AE++  AM+
Sbjct: 123 TVKIEGEITAESKFTAMI 140


>gi|190359480|sp|A8EX77|FABZ_RICCK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 143

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 92/138 (66%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVD+V+ I  ++S +GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 2   DITEIMNLIPHRYPFLLVDRVLEIDLNKSILGIKNVTVNEPQFTGHFPARPVMPGVLMVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ ++FR+ V PGD +  H    + R ++WKF  
Sbjct: 62  AMAQLAAILVAKSLGSTKNKEVFLMTIENSKFRRIVQPGDTMHIHTVIDQQRANVWKFSS 121

Query: 132 CAKVENTVVAEAEICAMV 149
             K+E  + AE++  AM+
Sbjct: 122 TVKIEGEITAESKFTAMI 139


>gi|152990289|ref|YP_001356011.1| (3R)-hydroxymyristoyl-ACP dehydratase [Nitratiruptor sp. SB155-2]
 gi|166233427|sp|A6Q2E5|FABZ_NITSB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|151422150|dbj|BAF69654.1| 3R-hydroxymyristoyl ACP dehydrase [Nitratiruptor sp. SB155-2]
          Length = 148

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 98/144 (68%), Gaps = 5/144 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHRYPFLLVD+VV +++ +S    KNV+ +EP F GHFPG P+ PGV+I+E
Sbjct: 3   DVVEIQKILPHRYPFLLVDRVVELEKGKSVKAYKNVSISEPVFEGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ  G +  + +  ++         Y MSIDKA+FR PV PGD+LEYH+  +++R  +
Sbjct: 63  GMAQAGGVLAFLSSSEEEQEAAKDKVVYFMSIDKAKFRNPVRPGDKLEYHLEVIKHRGSI 122

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W     A V+  +VAEAE+ AM++
Sbjct: 123 WVLDGKAYVDGNLVAEAELKAMIV 146


>gi|296446136|ref|ZP_06888084.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylosinus trichosporium OB3b]
 gi|296256330|gb|EFH03409.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylosinus trichosporium OB3b]
          Length = 152

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 93/136 (68%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M+ LPHRYPFLL+D+V+++  D   +G+KNVT NEP F GHFP RP+ PGVL++E
Sbjct: 13  DIARIMQLLPHRYPFLLIDRVIDVDGDRFGVGVKNVTVNEPQFQGHFPERPIFPGVLLIE 72

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQTAGAI       ++    + ++IDKA+FR+PV PGDR+E H+ K   R D+  +  
Sbjct: 73  AMAQTAGAIALNARARERPGSVFFVTIDKAKFRRPVQPGDRVELHMTKTAQRRDIVWYSG 132

Query: 132 CAKVENTVVAEAEICA 147
            A V+  +V EAE+ A
Sbjct: 133 RALVDGALVCEAEVSA 148


>gi|68171452|ref|ZP_00544840.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658660|ref|YP_507858.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|109828913|sp|Q2GFC5|FABZ_EHRCR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|67999133|gb|EAM85795.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88600117|gb|ABD45586.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 143

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 96/137 (70%), Gaps = 3/137 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+++ +PH YPFLL+D+V     +ES   IKNVTFNEP F+GHFPG P+MPGVLI+E
Sbjct: 4   NIQEIIKMIPHSYPFLLIDRVTACTPNESVTAIKNVTFNEPFFIGHFPGNPIMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  IC + +    Y+  YLMSI+ A+FRKPV PGD L   VN V  R +  KF+C
Sbjct: 64  AMAQ-ACIICTM-SSMQNYS-VYLMSIELAKFRKPVIPGDTLILTVNVVHKRKNTCKFEC 120

Query: 132 CAKVENTVVAEAEICAM 148
            A VE T+VAEA+I AM
Sbjct: 121 HAHVEGTLVAEAQILAM 137


>gi|260427000|ref|ZP_05780979.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Citreicella sp. SE45]
 gi|260421492|gb|EEX14743.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Citreicella sp. SE45]
          Length = 153

 Score =  149 bits (375), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/146 (50%), Positives = 97/146 (66%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI  + R LPHRYPFLLVD+VV+I   +SA+GIKNVT NEPHF GHFPG+P+MPG
Sbjct: 4   TLLSADIHLIQRILPHRYPFLLVDRVVDIDGYQSAVGIKNVTMNEPHFQGHFPGQPIMPG 63

Query: 67  VLILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQT+  +     G  D+    Y M+IDK +FR+ V PGD+L   +  VR +  
Sbjct: 64  VTIVEAMAQTSAVMVGTALGLADKNLKVYFMAIDKCKFRRMVVPGDQLRMKLTTVRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A+V+  + AEAE  AM+
Sbjct: 124 GKVWKFAGVAEVDGEMAAEAEFTAMM 149


>gi|157826633|ref|YP_001495697.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia bellii OSU
           85-389]
 gi|166233434|sp|A8GUZ3|FABZ_RICB8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157801937|gb|ABV78660.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Rickettsia bellii OSU 85-389]
          Length = 145

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVDKVV I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDLIPHRYPFLLVDKVVEIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            M Q A  + A   G  +    +LM+I+ ++FRK V PGD +  H    + R ++WKF  
Sbjct: 64  AMTQLAAILVAKSLGSTKNKEVFLMAIENSKFRKVVQPGDTMHIHATIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
             KV+  + AE++  AM+
Sbjct: 124 TVKVDGEMAAESKFTAMI 141


>gi|284105032|ref|ZP_06386161.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Candidatus Poribacteria sp. WGA-A3]
 gi|283830155|gb|EFC34415.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Candidatus Poribacteria sp. WGA-A3]
          Length = 165

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 93/148 (62%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIVE+   LPHRYPFLLVD+VV  +    A+G+KNVT N+P+F GHFPGRP+ PGVLI+E
Sbjct: 9   DIVEVQSILPHRYPFLLVDRVVEFEPGRRAVGLKNVTINDPYFQGHFPGRPIFPGVLIVE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  G +    +  +     YL  IDKA+FRKPV PGD++   V  ++ R   WK Q 
Sbjct: 69  ALAQLGGVLVIRSSSVEGTPIVYLTGIDKAKFRKPVIPGDQIRLEVEVIKRRPPFWKMQG 128

Query: 132 CAKVENTVVAEAEICAMVMHEKKEKNES 159
            A V + +V EAE  AM+  E  +   +
Sbjct: 129 KAFVGSELVCEAESTAMMQAEDADSTNA 156


>gi|159044050|ref|YP_001532844.1| (3R)-hydroxymyristoyl-ACP dehydratase [Dinoroseobacter shibae DFL
           12]
 gi|190359383|sp|A8LK44|FABZ_DINSH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157911810|gb|ABV93243.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Dinoroseobacter shibae DFL 12]
          Length = 163

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 5/142 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  + R LPHRYPFLLVDKV+++ R +SA+GIKNVTFNEPHF GHFPG P+MPGV+I+E
Sbjct: 16  DLAMIQRILPHRYPFLLVDKVIDMVRFKSALGIKNVTFNEPHFQGHFPGEPIMPGVMIVE 75

Query: 72  GMAQTAGAICAIHN--GFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDLW 127
            +AQT+ A+   H+    D+    Y MSID  +FR+ V PGD +   V  +R +    +W
Sbjct: 76  ALAQTS-AVLVGHSMASADEDVSVYFMSIDNCKFRRKVVPGDVMSLRVETMRGKPGGKVW 134

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF   A VE+TV A+AE  AM+
Sbjct: 135 KFLGEAIVEDTVAAQAEFTAMI 156


>gi|99081246|ref|YP_613400.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ruegeria sp. TM1040]
 gi|259415690|ref|ZP_05739610.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Silicibacter sp. TrichCH4B]
 gi|122984287|sp|Q1GGS8|FABZ_SILST RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|99037526|gb|ABF64138.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Ruegeria sp.
           TM1040]
 gi|259347129|gb|EEW58906.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Silicibacter sp. TrichCH4B]
          Length = 160

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/153 (50%), Positives = 99/153 (64%), Gaps = 7/153 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  + + LPHRYPFLLVDKVV+I   +SA GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 9   LKSADIGLIQQILPHRYPFLLVDKVVDIDGYQSARGIKNVTMNEPHFQGHFPGTPIMPGV 68

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNR- 123
            I+E MAQT+G +  +  G D        Y M+IDK +FR+ V PGD LE HV  VR + 
Sbjct: 69  TIVEAMAQTSGVMLGV--GMDLIGTDMLIYFMNIDKCKFRRKVVPGDVLEMHVETVRGKP 126

Query: 124 -VDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
              ++KF   A V+  + AEAE  AM+  + K+
Sbjct: 127 GGKIFKFSGRATVDGELAAEAEFTAMIDRDGKD 159


>gi|163747140|ref|ZP_02154496.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanibulbus indolifex HEL-45]
 gi|161379701|gb|EDQ04114.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanibulbus indolifex HEL-45]
          Length = 156

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 90/141 (63%), Gaps = 3/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + R LPHRYPFLLVDKV  I   ESA+G KNVT NEPHF GHFPG P+MPGV I+E
Sbjct: 9   DIQLIQRILPHRYPFLLVDKVEEINGTESAVGYKNVTMNEPHFQGHFPGTPIMPGVTIVE 68

Query: 72  GMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDLWK 128
            MAQTAG +     G  D+    Y MSIDK +FR+ V PGD L   +  +R +    +WK
Sbjct: 69  AMAQTAGVMVGAALGMEDRNMLIYFMSIDKCKFRRKVGPGDVLRMDLKTLRGKPGAKIWK 128

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           F   A VE  + AEAE  AM+
Sbjct: 129 FSGVATVEGEMAAEAEFMAMM 149


>gi|255262526|ref|ZP_05341868.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thalassiobium sp. R2A62]
 gi|255104861|gb|EET47535.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thalassiobium sp. R2A62]
          Length = 151

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 92/141 (65%), Gaps = 3/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + R LPHRYPFLLVDKVV++   +SA+GIKNVT NEPHF GHFPG P+MPGV I+E
Sbjct: 9   DIDLIQRILPHRYPFLLVDKVVDMNGTQSAVGIKNVTMNEPHFQGHFPGAPIMPGVTIIE 68

Query: 72  GMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDLWK 128
            MAQTAG +     G  D+    Y M+ID  +FR+ V PGD L   +   R +    +WK
Sbjct: 69  AMAQTAGVMVGTALGLADKNMLIYFMAIDGCKFRRKVVPGDVLRMDIETTRGKEGAKVWK 128

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           F+  A V+  + A+AE  AM+
Sbjct: 129 FKGVATVDGELAAQAEFTAMM 149


>gi|85703180|ref|ZP_01034284.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius sp. 217]
 gi|85672108|gb|EAQ26965.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius sp. 217]
          Length = 154

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 95/145 (65%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  + R +PHRYPFLLVDKVV+I   +SA GIKNVT NEPHF GHFPG+P+MPGV
Sbjct: 5   LKSADIHLIQRLIPHRYPFLLVDKVVDIDGYQSARGIKNVTMNEPHFQGHFPGKPIMPGV 64

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV-- 124
            I+E MAQTA  +     N  D+    Y M+ID A+FR+ V PGD LE  +   R +   
Sbjct: 65  TIIEAMAQTAAVMVGTALNMQDRNMLVYFMAIDSAKFRRMVVPGDVLEMKLRTTRGKPGG 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WKF   A+VE  + AEAE  AM+
Sbjct: 125 KVWKFSGVAEVEGELAAEAEFTAMM 149


>gi|119386613|ref|YP_917668.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paracoccus denitrificans PD1222]
 gi|119377208|gb|ABL71972.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Paracoccus
           denitrificans PD1222]
          Length = 181

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (66%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  + R LPHRYPFLLVD+V +I   ES +G+KNVT NEPHF GHFP  PVMPGVLI+E
Sbjct: 37  DLAMIKRILPHRYPFLLVDRVRDIVPAESCVGVKNVTSNEPHFEGHFPQEPVMPGVLIIE 96

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ+A  +  +  N  D+    Y MSIDK RFR+ V PGD LE H+  +R    +WKF+
Sbjct: 97  AMAQSAAVLVGVSLNLADKGMGTYFMSIDKCRFRQKVVPGDVLELHMKTLRGGGKIWKFE 156

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V   + AEAE+ AM+
Sbjct: 157 GRAIVNGQLAAEAEVMAML 175


>gi|308272627|emb|CBX29231.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein]dehydratase [uncultured
           Desulfobacterium sp.]
          Length = 157

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+M+ LPHRYPF+L+D+VV     ES + +KNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 15  DVTEIMKLLPHRYPFILIDRVVEFVAGESLVALKNVTINEPFFSGHFPGTPIMPGVLIVE 74

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G + A+ N   +Y  P Y M +DK RFRKPV PGD++ + +  +  R  + K  
Sbjct: 75  AMAQAGGVLFAVSNPDRKYGDPIYFMGMDKVRFRKPVVPGDQIIFDIKVLNMRTKVVKIA 134

Query: 131 CCAKVENTVVAEAEICA 147
             AKV+   VAEAE+ A
Sbjct: 135 GIAKVDGKCVAEAELMA 151


>gi|254474502|ref|ZP_05087888.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ruegeria
           sp. R11]
 gi|214028745|gb|EEB69580.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ruegeria
           sp. R11]
          Length = 154

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 95/149 (63%), Gaps = 3/149 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  + R LPHRYPFLLVDKVV I    SA GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 5   LKSADIHLIQRILPHRYPFLLVDKVVEIDGYSSACGIKNVTMNEPHFQGHFPGTPIMPGV 64

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
            I+E MAQTAG +  +  +  D     Y M+IDK +FR+ V PGD LE  V   R +   
Sbjct: 65  TIVEAMAQTAGVMLGVGMDMIDTELLIYFMNIDKCKFRRKVIPGDVLEMRVETTRGKPGG 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEK 153
            ++KF+  A V+  V AEAE  AMV  +K
Sbjct: 125 KIFKFKGVATVDGEVAAEAEFSAMVDLQK 153


>gi|157964079|ref|YP_001498903.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia massiliae MTU5]
 gi|166971621|sp|A8F0C4|FABZ_RICM5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157843855|gb|ABV84356.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Rickettsia massiliae MTU5]
          Length = 145

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 92/138 (66%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M ++PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  HV   + R ++WKF  
Sbjct: 64  AMAQLAAILVAKSLGSTKNKEVFLMAIENAKFRRIVQPGDTMHIHVVIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  + AE++  AM+
Sbjct: 124 TVTVEGEIAAESKFTAMI 141


>gi|126729714|ref|ZP_01745527.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Sagittula
           stellata E-37]
 gi|126709833|gb|EBA08886.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Sagittula
           stellata E-37]
          Length = 152

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (65%), Gaps = 3/148 (2%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           ++ L + DI  + R +PHRYPFLLVD+VV+I   +SA GIKNVT NEPHF GHFPG P+M
Sbjct: 1   MSDLKSADIQLIQRIIPHRYPFLLVDRVVDIDGTQSATGIKNVTMNEPHFQGHFPGMPIM 60

Query: 65  PGVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           PGV I+E MAQTA  +        D+    Y MSIDK +FR+ V PGD+L  ++  +R +
Sbjct: 61  PGVTIVEAMAQTAAVMVGTTLEMADKEMKVYFMSIDKCKFRRKVVPGDQLRMNLTTLRGK 120

Query: 124 --VDLWKFQCCAKVENTVVAEAEICAMV 149
               +WKF   A+V+  + AEAE  AM+
Sbjct: 121 PGGKVWKFGGVAEVDGEMAAEAEFTAMM 148


>gi|254440230|ref|ZP_05053724.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Octadecabacter antarcticus 307]
 gi|198255676|gb|EDY79990.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Octadecabacter antarcticus 307]
          Length = 162

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 91/145 (62%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           + + DI  + R +PHRYPFLLVDKV++I    SAIGIKNVT NEPHF GHFPG P+MPGV
Sbjct: 14  ITSADIQLIQRIIPHRYPFLLVDKVIDIDGTSSAIGIKNVTMNEPHFQGHFPGTPIMPGV 73

Query: 68  LILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
            I+E MAQT+  +     G  D+    Y M ID  +FR+ V PGD L   V   R R   
Sbjct: 74  TIIEAMAQTSAVMVGATMGLMDKNMLIYFMGIDNCKFRRKVVPGDVLRMTVQTTRGRPGG 133

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WKF+  A V+  + AEAE  AM+
Sbjct: 134 KVWKFKGVATVDGELAAEAEFTAMM 158


>gi|56696554|ref|YP_166911.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ruegeria pomeroyi DSS-3]
 gi|62286714|sp|Q5LSU4|FABZ_SILPO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56678291|gb|AAV94957.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ruegeria
           pomeroyi DSS-3]
          Length = 157

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 94/143 (65%), Gaps = 3/143 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + DI  + R LPHRYPFLLVDKVV I    SA+GIKNVT NEPHF GHFPG P+MPGV I
Sbjct: 7   SADIQLIQRILPHRYPFLLVDKVVEIDGYSSAVGIKNVTMNEPHFQGHFPGTPIMPGVTI 66

Query: 70  LEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD--L 126
           +E MAQTAG +  +  +  D     Y M+ID  +FR+ V PGD ++ HV  +R ++   +
Sbjct: 67  VEAMAQTAGVMLGVGMDIIDSELLIYFMNIDNCKFRRKVVPGDVMKMHVETLRGKMGGKI 126

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
           +KF+  A VE  V A+AE  A V
Sbjct: 127 FKFRGTATVEGEVAAQAEFSAYV 149


>gi|78777659|ref|YP_393974.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sulfurimonas denitrificans
           DSM 1251]
 gi|91206659|sp|Q30QJ2|FABZ_SULDN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|78498199|gb|ABB44739.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Sulfurimonas
           denitrificans DSM 1251]
          Length = 149

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 100/144 (69%), Gaps = 5/144 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++E+ + +PHRYPFLL+D+V  I+ +ES IG KN+T  +  F GHFPG P+ PGV+ILE
Sbjct: 4   DVIEIQKIIPHRYPFLLLDRVTQIKENESLIGYKNITIGDNVFQGHFPGHPIYPGVMILE 63

Query: 72  GMAQTAG--AICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ  G  A  ++ N  ++ A     Y MSID+A+FR PV PGDRLEY ++ ++N+  +
Sbjct: 64  GMAQAGGILAFKSMGNMTEEEAASKVVYFMSIDRAKFRAPVKPGDRLEYRISVIKNKGQI 123

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W     A V++ +V+EAE+ AM++
Sbjct: 124 WVLDGKAYVDDVLVSEAELKAMIV 147


>gi|86138415|ref|ZP_01056989.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. MED193]
 gi|85824940|gb|EAQ45141.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. MED193]
          Length = 154

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 98/151 (64%), Gaps = 3/151 (1%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L + DI  + R LPHRYPFLLVDKVV+I    SA GIKNVT NEPHF GHFPG P+MP
Sbjct: 3   ADLQSADIHLIQRILPHRYPFLLVDKVVDIDGINSARGIKNVTMNEPHFQGHFPGTPIMP 62

Query: 66  GVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR- 123
           GV I+E MAQTAG +  +  +  D+    Y M+IDK +FR+ V PGD LE  V  +R + 
Sbjct: 63  GVTIVEAMAQTAGVMLGVALDMVDRDLLIYFMNIDKCKFRRKVIPGDVLEMKVEILRGKP 122

Query: 124 -VDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
              ++KF+  A VE    AEAE  AMV  +K
Sbjct: 123 GGKVFKFKGLATVEGETAAEAEFTAMVDVQK 153


>gi|149202643|ref|ZP_01879615.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius sp. TM1035]
 gi|149143925|gb|EDM31959.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius sp. TM1035]
          Length = 154

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI  + R +PHRYPFLLVDKVV+I   +SA GIKNVT NEPHF GHFPG+P+MPG
Sbjct: 4   SLKSADIHLIQRIIPHRYPFLLVDKVVDIDGYQSARGIKNVTMNEPHFQGHFPGKPIMPG 63

Query: 67  VLILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQTA  +        D+    Y M+ID A+FR+ V PGD LE  ++  R +  
Sbjct: 64  VTIIEAMAQTAAVMVGTALEMQDRNMLVYFMAIDSAKFRRMVVPGDVLEMKLHTTRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A+VE  + AEAE  AM+
Sbjct: 124 GKVWKFSGIAEVEGELAAEAEFTAMM 149


>gi|34581033|ref|ZP_00142513.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia sibirica 246]
 gi|157827870|ref|YP_001494112.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165932557|ref|YP_001649346.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia rickettsii str.
           Iowa]
 gi|238650221|ref|YP_002916071.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia peacockii str.
           Rustic]
 gi|418333|sp|P32204|FABZ_RICRI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233435|sp|A8GQC9|FABZ_RICRS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044394|sp|B0BVR4|FABZ_RICRO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|259646358|sp|C4K0C2|FABZ_RICPU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|349107|gb|AAA26385.1| putative [Rickettsia rickettsii]
 gi|28262418|gb|EAA25922.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia sibirica 246]
 gi|157800351|gb|ABV75604.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907644|gb|ABY71940.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia rickettsii str. Iowa]
 gi|238624319|gb|ACR47025.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia peacockii str.
           Rustic]
          Length = 145

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 91/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M ++PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQLAAILVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDTMHIHAVIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  + AE++  AM+
Sbjct: 124 TVTVEGEIAAESKFTAMI 141


>gi|229586239|ref|YP_002844740.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia africae ESF-5]
 gi|259646357|sp|C3PM37|FABZ_RICAE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|228021289|gb|ACP52997.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia africae ESF-5]
          Length = 145

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 91/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M ++PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQLAAVLVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDTMYIHAVIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  + AE++  AM+
Sbjct: 124 TVTVEGEIAAESKFTAMI 141


>gi|157825134|ref|YP_001492854.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia akari str.
           Hartford]
 gi|166233433|sp|A8GLS1|FABZ_RICAH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157799092|gb|ABV74346.1| (3R)-hydroxymyristoyl ACP dehydratase [Rickettsia akari str.
           Hartford]
          Length = 145

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 91/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVD+V+ I  ++S +GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDLIPHRYPFLLVDRVLEIDLNKSILGIKNVTVNEPQFTGHFPTRPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQIAAILVAKSLGSTKNKDVFLMAIENAKFRRIVQPGDTMHIHAVIDQQRTNVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  + AE++  AM+
Sbjct: 124 TVTVEGEMAAESKFTAMI 141


>gi|260575878|ref|ZP_05843873.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacter sp. SW2]
 gi|259021804|gb|EEW25105.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacter sp. SW2]
          Length = 155

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M      L   D+  +MR +PHRYPFLLVDKV +I+  +  +GIKNVTFNEP F GHFPG
Sbjct: 1   MTDQTTPLIQADLHLIMRIIPHRYPFLLVDKVRDIEPGKGGVGIKNVTFNEPQFQGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
            PV PGV I+E +AQTA  +  +  N  D+    Y M+ID A+FR+ V PGD LE HV+ 
Sbjct: 61  NPVFPGVQIIEALAQTAAVVAGVSMNLADRNMLVYFMAIDGAKFRRKVVPGDVLELHVSV 120

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMV 149
            R    +WKF   A VE  + AE E  AM+
Sbjct: 121 KRGGGKVWKFDARATVEGELAAECEFTAMM 150


>gi|126726880|ref|ZP_01742719.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacterales bacterium HTCC2150]
 gi|126703838|gb|EBA02932.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacterales bacterium HTCC2150]
          Length = 165

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + D+  + R +PHRYPFLLVDKV +I   +SA+GIKNVT NEPHF GHFP  P+MPGV+I
Sbjct: 20  SADLDLIKRIIPHRYPFLLVDKVRDIVPHKSAVGIKNVTANEPHFEGHFPKAPIMPGVMI 79

Query: 70  LEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           +E MAQ+A  +  I  +  D+    Y M++D  +FR+ V PGD LE HV   R R  +WK
Sbjct: 80  VEAMAQSAAVLVGITLDLVDKELLVYFMALDNVKFRRKVVPGDVLEMHVEVTRGRGKVWK 139

Query: 129 FQCCAKVENTVVAEAEICAM 148
           F   A V+  V AEA++ AM
Sbjct: 140 FHGVASVDGEVAAEADLTAM 159


>gi|67458399|ref|YP_246023.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia felis URRWXCal2]
 gi|75537128|sp|Q4UNK0|FABZ_RICFE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|67003932|gb|AAY60858.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia felis URRWXCal2]
          Length = 145

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 90/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDLIPHRYPFLLVDRVLEIDLNKSIKGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQLAAILVAKSLGSTKNKEVFLMAIENAKFRRIVQPGDTMYIHATIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  + AE++  AM+
Sbjct: 124 TVTVEGEMAAESKFTAMI 141


>gi|254492591|ref|ZP_05105762.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylophaga thiooxidans DMS010]
 gi|224462112|gb|EEF78390.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylophaga thiooxydans DMS010]
          Length = 149

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 92/140 (65%), Gaps = 2/140 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E+ R LPHRYPFLL+D+V+     E  +GIKNVTFNEPHF GHFP R +MPGV
Sbjct: 1   MNTIDIHEIQRLLPHRYPFLLIDRVIEFTPGEHLVGIKNVTFNEPHFTGHFPQRVIMPGV 60

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE +AQ  G  A   + +     A  YL  ID ARF+KPV PGD+L+  V  V+N+ +
Sbjct: 61  LILESLAQATGLLAFKTVASVRSDDALYYLAGIDNARFKKPVEPGDQLKLEVKLVKNKRN 120

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           LWKF   A V+  VV  A+I
Sbjct: 121 LWKFSGEASVDGEVVVSADI 140


>gi|78044325|ref|YP_361382.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|91206626|sp|Q3A902|FABZ_CARHZ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|77996440|gb|ABB15339.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 144

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/138 (52%), Positives = 93/138 (67%), Gaps = 5/138 (3%)

Query: 11  KDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           KDI E+M  LPHRYPFLLVDK++ +   E A+GIKNVT NEP F GHFPGRP+MPGVL+L
Sbjct: 6   KDITEIMNILPHRYPFLLVDKILEVVPGEKAVGIKNVTINEPFFQGHFPGRPIMPGVLLL 65

Query: 71  EGMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ  GA+  + +  ++YA   P    ID ARFRKPV PGD++ + V  ++ +  L K
Sbjct: 66  EAMAQV-GAVAILTD--ERYAGKLPMFAGIDGARFRKPVLPGDQVVFEVELLKIKGSLGK 122

Query: 129 FQCCAKVENTVVAEAEIC 146
            +   KV   +V EAEI 
Sbjct: 123 ARGSGKVNGELVVEAEIL 140


>gi|15891932|ref|NP_359646.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia conorii str.
           Malish 7]
 gi|20138267|sp|Q92JQ8|FABZ_RICCN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|15619041|gb|AAL02547.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia conorii str. Malish 7]
          Length = 145

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 90/138 (65%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M ++PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E
Sbjct: 4   DITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVLMVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A  + A   G  +    +LM+I+ A+FR+ V PGD +  H    + R ++WKF  
Sbjct: 64  AMAQLAAILVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDTMHIHAVIDQQRANVWKFSS 123

Query: 132 CAKVENTVVAEAEICAMV 149
              VE  +  E++  AM+
Sbjct: 124 TVTVEGEIATESKFTAMI 141


>gi|154149105|ref|YP_001406904.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter hominis ATCC BAA-381]
 gi|166233419|sp|A7I313|FABZ_CAMHC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|153805114|gb|ABS52121.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter hominis ATCC BAA-381]
          Length = 145

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (69%), Gaps = 4/142 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHR+PFLL+D+V+++Q   S    KNVTFNE  F GHFPG P+ PGV+I+E
Sbjct: 3   DINEILEILPHRFPFLLIDRVIDLQPGISIKAYKNVTFNEQIFQGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           GMAQ AG + A  +  D+       Y M+IDKA+FR+P+ PGDRLEY +N +++R  +W 
Sbjct: 63  GMAQ-AGGVLAFKSTTDEDLSNKVVYFMTIDKAKFRQPIRPGDRLEYRLNVLKHRGRIWV 121

Query: 129 FQCCAKVENTVVAEAEICAMVM 150
            +  A V++ V AEAE+ AM+M
Sbjct: 122 LKGEALVDDKVAAEAELQAMIM 143


>gi|254463079|ref|ZP_05076495.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacterales bacterium HTCC2083]
 gi|206679668|gb|EDZ44155.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 175

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 93/141 (65%), Gaps = 3/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + R LPHRYPFLLVDKV +I   ++A+GIKNVT NEPHF GHFPG P+MPGV I+E
Sbjct: 31  DIQLIQRILPHRYPFLLVDKVEDIDGTQTAVGIKNVTMNEPHFQGHFPGLPIMPGVTIVE 90

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDLWK 128
            MAQTA  +     +  D+    Y M+IDK +FR+ V PGD L+ ++  VR +    +WK
Sbjct: 91  AMAQTAAVMVGTALDMADKEMKVYFMAIDKCKFRRKVGPGDVLKMNLTTVRGKPGGKVWK 150

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           F   A VE  + AEAE  AM+
Sbjct: 151 FSGVATVEGEMAAEAEFTAMM 171


>gi|57239555|ref|YP_180691.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579541|ref|YP_197753.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|81352743|sp|Q5HA53|FABZ_EHRRW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|57161634|emb|CAH58563.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418167|emb|CAI27371.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 145

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 96/141 (68%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLL+DKV     +ESA  IKNVTFNEP F+GHFP  PVMPGVLI+E
Sbjct: 4   NIQDIIKMLPHSYPFLLLDKVTACVPNESATAIKNVTFNEPFFIGHFPNNPVMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ A  +C + +    F+ Y   Y MSI+ A+FRKPV PGD L   VN +  R D  +
Sbjct: 64  AMAQ-ACLVCVMSDSKCNFENYT-IYFMSIELAKFRKPVIPGDILTIEVNVIHKRKDTCR 121

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           FQC A+V+  + +EA+I AM+
Sbjct: 122 FQCFARVDQALASEAQILAMI 142


>gi|58617595|ref|YP_196794.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ehrlichia ruminantium str.
           Gardel]
 gi|75356847|sp|Q5FGI7|FABZ_EHRRG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|58417207|emb|CAI28320.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Ehrlichia
           ruminantium str. Gardel]
          Length = 145

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 96/141 (68%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLL+DKV     +ESA  IKNVTFNEP F+GHFP  PVMPGVLI+E
Sbjct: 4   NIQDIIKMLPHSYPFLLLDKVTACVPNESATAIKNVTFNEPFFIGHFPNNPVMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ A  +C + +    F+ Y   Y MSI+ A+FRKPV PGD L   VN +  R D  +
Sbjct: 64  AMAQ-ACLVCVMSDSKHNFENYT-IYFMSIELAKFRKPVIPGDILTIEVNVIHKRKDTCR 121

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           FQC A+V+  + +EA+I AM+
Sbjct: 122 FQCFARVDQALASEAQILAMI 142


>gi|163736304|ref|ZP_02143723.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Phaeobacter gallaeciensis BS107]
 gi|163741167|ref|ZP_02148559.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Phaeobacter gallaeciensis 2.10]
 gi|161385520|gb|EDQ09897.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Phaeobacter gallaeciensis 2.10]
 gi|161390174|gb|EDQ14524.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Phaeobacter gallaeciensis BS107]
          Length = 154

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 92/145 (63%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  + R LPHRYPFLLVDKVV I    SA GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 5   LKSADIHLIQRILPHRYPFLLVDKVVEIDGYSSACGIKNVTMNEPHFQGHFPGTPIMPGV 64

Query: 68  LILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--V 124
            I+E MAQTAG +  +  +  D     Y M+IDK +FR+ V PGD L+  V   R +   
Sbjct: 65  TIVEAMAQTAGVMLGVGMDMIDTELLIYFMNIDKCKFRRKVIPGDVLKMRVETTRGKPGG 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            ++KF+  A V+    AEAE  AMV
Sbjct: 125 KIFKFKGVATVDGETAAEAEFSAMV 149


>gi|254488374|ref|ZP_05101579.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. GAI101]
 gi|214045243|gb|EEB85881.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. GAI101]
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 93/146 (63%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI  + R +PHRYPFLLVDKVV+I   ++A+GIKNVT NEPHF GHFPG P+MPG
Sbjct: 4   TLPSADIQMIQRIIPHRYPFLLVDKVVDINGTQTAVGIKNVTMNEPHFQGHFPGMPIMPG 63

Query: 67  VLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQT+  +  +     D+    Y M+IDK +FR+ V PGD L   V  +R +  
Sbjct: 64  VTIIEAMAQTSAVMVGVTLEMADKDMKVYFMAIDKCKFRRKVVPGDVLRMEVTTLRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A V+  + AE E  AM+
Sbjct: 124 GKVWKFGGVASVDGEMAAEVEFTAMM 149


>gi|307824005|ref|ZP_07654232.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacter tundripaludum SV96]
 gi|307734789|gb|EFO05639.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylobacter tundripaludum SV96]
          Length = 147

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 101/143 (70%), Gaps = 4/143 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++  FLPHRYPFLLVDKVV  +     +G+KNVT+NEP F GHFP +P+MPGVLILE
Sbjct: 6   DILQIQEFLPHRYPFLLVDKVVECEPGVRLLGVKNVTYNEPFFQGHFPQKPIMPGVLILE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ+ G + +   G D+ A    YL+ IDKA+F++PV PGD+L      ++++ ++W F
Sbjct: 66  ALAQSTGLLASETAG-DELAGMIYYLVGIDKAKFKRPVVPGDQLMLEARFLKSKRNIWAF 124

Query: 130 QCCAKVENTVVAEAEI-CAMVMH 151
           +C A+V+   VA AEI CA V++
Sbjct: 125 ECRAEVDGEFVASAEIRCAAVVN 147


>gi|307721393|ref|YP_003892533.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979486|gb|ADN09521.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Sulfurimonas
           autotrophica DSM 16294]
          Length = 149

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 97/144 (67%), Gaps = 5/144 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+ + LPHRYPFLLVD+V ++ + ES    KNV+ +EP F GHFPG P+ PGV+ILE
Sbjct: 4   DVTEIQKILPHRYPFLLVDRVTDMTKGESITAYKNVSISEPVFQGHFPGHPIYPGVMILE 63

Query: 72  GMAQTAGAICAIHNG---FDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ  G +  +  G    ++ A    Y MSIDKA+FR PV PGDRLEY ++ ++ +  +
Sbjct: 64  GMAQAGGILSFLSMGDLTEEEIAGKVVYFMSIDKAKFRSPVKPGDRLEYKISVIKQKGTI 123

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W  +  A V++ + +EAE+ AM++
Sbjct: 124 WMLKGEAYVDDKLASEAELKAMIV 147


>gi|57237329|ref|YP_178342.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni RM1221]
 gi|86153798|ref|ZP_01072001.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88597270|ref|ZP_01100505.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613704|ref|YP_999988.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148926978|ref|ZP_01810654.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|157414570|ref|YP_001481826.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|205356072|ref|ZP_03222840.1| (3R)-hydroxymyristoyl acyl carrier protein dehydratase
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|218561936|ref|YP_002343715.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|14423711|sp|Q9PIM2|FABZ_CAMJE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|62286708|sp|Q5HWJ3|FABZ_CAMJR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|158513875|sp|A1VXZ7|FABZ_CAMJJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|172047028|sp|A8FK62|FABZ_CAMJ8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|57166133|gb|AAW34912.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni RM1221]
 gi|85842759|gb|EAQ59971.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|87250137|gb|EAQ73095.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190331|gb|EAQ94305.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359642|emb|CAL34427.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|145844386|gb|EDK21495.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|157385534|gb|ABV51849.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|205346196|gb|EDZ32831.1| (3R)-hydroxymyristoyl acyl carrier protein dehydratase
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|284925549|gb|ADC27901.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315057698|gb|ADT72027.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni S3]
 gi|315927195|gb|EFV06545.1| Beta-hydroxyacyl/acyl-carrier-protein dehydratase, FabZ
           [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315930338|gb|EFV09425.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 146

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (68%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++++   LPHRYPFLLVDK+  ++  E  +G KN++ ++  FMGHFPG P+ PGVLILE
Sbjct: 3   DVMQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQT G + A  +  D+  P     Y   ID A+FR PV PGDRL+Y ++ V+NR ++W
Sbjct: 63  GMAQT-GGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNMW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            F+  A V+  +VAEAE+ AM++
Sbjct: 122 IFKGQAFVDGNLVAEAELKAMIV 144


>gi|126736313|ref|ZP_01752055.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. CCS2]
 gi|126714134|gb|EBA11003.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseobacter sp. CCS2]
          Length = 180

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 90/145 (62%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +   DI  + + LPHRYPFLLVDKV +I    SA+GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 32  VTTADIQLIQKILPHRYPFLLVDKVHSINGTTSAVGIKNVTMNEPHFQGHFPGNPIMPGV 91

Query: 68  LILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD- 125
            I+E MAQT   +     G  D     Y M+ID  +FR+ V PGD LE HV   R +   
Sbjct: 92  TIVEAMAQTTAVMVGASLGLTDGNLLVYFMAIDGCKFRRKVVPGDVLEMHVETTRGKPGG 151

Query: 126 -LWKFQCCAKVENTVVAEAEICAMV 149
            +W+F+  A V+  + AEAE  AM+
Sbjct: 152 KVWRFKGVATVDGEMAAEAEFTAMM 176


>gi|84686909|ref|ZP_01014793.1| probable 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrierprotein)
           dehydratase [Maritimibacter alkaliphilus HTCC2654]
 gi|84665106|gb|EAQ11586.1| probable 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrierprotein)
           dehydratase [Rhodobacterales bacterium HTCC2654]
          Length = 144

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 1/135 (0%)

Query: 16  LMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQ 75
           + R +PHRYPFLL+D+V +I  +ESA+G+KNVT+NEPHF GHFP  P+MPGV I+E MAQ
Sbjct: 2   IQRCIPHRYPFLLIDRVEDIVTNESAVGVKNVTYNEPHFQGHFPQTPIMPGVTIVEAMAQ 61

Query: 76  TAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           T+  + ++  +  D+    Y M IDK +FR+ V PGD L+ H+  +R    +WKF+  A 
Sbjct: 62  TSAVMVSMSLDLVDKEPLVYFMGIDKVKFRRKVVPGDVLKMHIKTIRGGSKIWKFEGRAT 121

Query: 135 VENTVVAEAEICAMV 149
           V+  V   AE  AM+
Sbjct: 122 VDGEVACSAEFSAMI 136


>gi|218961665|ref|YP_001741440.1| LpxC/fabZ bifunctional enzyme [Includes:
           UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase (UDP-3-O-acyl-GlcNAc deacetylase);
           (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase)] [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730322|emb|CAO81234.1| LpxC/fabZ bifunctional enzyme [Includes:
           UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase (UDP-3-O-acyl-GlcNAc deacetylase);
           (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase)] [Candidatus
           Cloacamonas acidaminovorans]
          Length = 464

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 86/143 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++R LPHRYPFLLVDK++     ES +GIKNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 322 DINAILRILPHRYPFLLVDKIIEFIPGESLVGIKNVTINEPFFQGHFPGHPIMPGVLIIE 381

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           GMAQ  G +        Q    Y  SID  +FRKPV PGD L Y +  +  +  L K   
Sbjct: 382 GMAQAGGIMLLNQMDNPQNYVAYFASIDNVKFRKPVLPGDTLRYELKVISLKRSLAKMHG 441

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
              VE   VAE +  AM+M  +K
Sbjct: 442 ETFVEGEKVAEGDFLAMIMEREK 464


>gi|254458233|ref|ZP_05071659.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacterales bacterium GD 1]
 gi|207085069|gb|EDZ62355.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacterales bacterium GD 1]
          Length = 149

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 101/147 (68%), Gaps = 7/147 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++E+ + +PHRYPFLL+D+V ++ ++E+ +G KNVT  +  F GHFPG P+ PGV+ILE
Sbjct: 4   DVMEIQKIIPHRYPFLLLDRVTDLVKNETLVGFKNVTIGDNIFQGHFPGHPIYPGVMILE 63

Query: 72  GMAQTAGAICAIH--NGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG I A    +G  +        Y MSIDKA+FR PV PGDRLEY ++ ++ +  
Sbjct: 64  GMAQ-AGGILAFKSMDGMTEEEVANKVVYFMSIDKAKFRAPVRPGDRLEYRISVIKQKGS 122

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +W     A V++T+V++AE+ AM++ +
Sbjct: 123 IWMLDGKAYVDDTLVSQAELKAMIVDK 149


>gi|116751166|ref|YP_847853.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Syntrophobacter fumaroxidans MPOB]
 gi|190359431|sp|A0LPR6|FABZ_SYNFM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|116700230|gb|ABK19418.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 147

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 94/146 (64%), Gaps = 1/146 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M +LPHRYPFLLVD+++ +  +E  +G+KNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 2   DIAKIMGYLPHRYPFLLVDRILELTSEE-IVGLKNVTINEPFFQGHFPGEPIMPGVLIIE 60

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT G +        +  P Y M +DK RFRKPV PGD+L   +  ++ R   +K   
Sbjct: 61  ALAQTGGVLAFTLVSDFRGKPIYFMGMDKVRFRKPVRPGDQLILKLKILKRRGPTFKMSA 120

Query: 132 CAKVENTVVAEAEICAMVMHEKKEKN 157
            A VE  +VAEAE+ A +   K E+ 
Sbjct: 121 EAFVEEQLVAEAELLATIGAAKSERE 146


>gi|313682962|ref|YP_004060700.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Sulfuricurvum
           kujiense DSM 16994]
 gi|313155822|gb|ADR34500.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Sulfuricurvum
           kujiense DSM 16994]
          Length = 147

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 99/145 (68%), Gaps = 8/145 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+V++ + LPHR+PFLLVD+V ++  +ES +G KNVT  E  F GHFPG P+ PGV+ILE
Sbjct: 3   DVVQIQKILPHRFPFLLVDRVTSLTPNESLVGFKNVTIGEQIFEGHFPGHPIYPGVMILE 62

Query: 72  GMAQTAGAICAIHNGFDQ------YAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG I A  +  D       +   Y MSID A+FR PV PGDRLEY +N V+++  
Sbjct: 63  GMAQ-AGGILAFQS-MDMTEEEAAHKVVYFMSIDGAKFRAPVRPGDRLEYRMNVVKHKGS 120

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W  +  A V++ +V+EAE+ AM++
Sbjct: 121 IWVLEGKAYVDDVLVSEAELKAMIV 145


>gi|222824393|ref|YP_002575967.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Campylobacter lari RM2100]
 gi|254788920|sp|B9KDS7|FABZ_CAMLR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|222539614|gb|ACM64715.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Campylobacter lari RM2100]
          Length = 146

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (68%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++++ + LPHRYPFLLVDK+V ++  +   G KN++ ++  FMGHFP  P+ PGVLILE
Sbjct: 3   DVMQIQKILPHRYPFLLVDKIVELKTKQIVKGYKNISISDHVFMGHFPDHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQT G + A  +  D+  P     Y   ID A+FR PV PGDRL+Y ++ V+NR +LW
Sbjct: 63  GMAQT-GGVLAFESMDDKVDPSSKVVYFTGIDNAKFRNPVRPGDRLDYEMSVVKNRGNLW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            F+  A V+  +VAEAE+ AM++
Sbjct: 122 IFEGKAFVDGQLVAEAELKAMIV 144


>gi|110597081|ref|ZP_01385370.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chlorobium ferrooxidans DSM 13031]
 gi|110341272|gb|EAT59737.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chlorobium ferrooxidans DSM 13031]
          Length = 467

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 87/143 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG P+MPGVLILE
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLILE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +    N   + +  Y M IDKARFRKPV PGD L         R ++ +F  
Sbjct: 385 AMAQTGGIMMLNGNDNIKESVVYFMGIDKARFRKPVLPGDTLVIEAIMTNKRRNVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V   +V EA + A V+ + K
Sbjct: 445 KAYVRGELVCEASLMATVVQKSK 467


>gi|77918858|ref|YP_356673.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pelobacter carbinolicus DSM 2380]
 gi|91206638|sp|Q3A554|FABZ_PELCD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|77544941|gb|ABA88503.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Pelobacter
           carbinolicus DSM 2380]
          Length = 147

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I+++M+ LPHRYPFLLVD++ +++  + A+GIKNVT NEP F GH+PG P+MPGVLI+E
Sbjct: 4   EILDIMKLLPHRYPFLLVDRIEDLEPGKRAVGIKNVTINEPFFQGHYPGHPIMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+ AI  G      PY   I+KARFR+PV PGD L+  +  + +R  L+ F  
Sbjct: 64  AMAQVGGAVAAITAGDKDDQVPYFTGINKARFRRPVGPGDVLQLQLELLSSRRGLFVFSG 123

Query: 132 CAKVENTVVAEAEICAM 148
            A V+  +VAEAE+ A+
Sbjct: 124 KAYVDGNLVAEAELKAV 140


>gi|86149614|ref|ZP_01067844.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151476|ref|ZP_01069691.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|153951640|ref|YP_001398678.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|283955696|ref|ZP_06373187.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|166233420|sp|A7H598|FABZ_CAMJD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|85839882|gb|EAQ57141.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841823|gb|EAQ59070.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|152939086|gb|ABS43827.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|283792651|gb|EFC31429.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|307747214|gb|ADN90484.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter jejuni subsp. jejuni M1]
 gi|315932557|gb|EFV11489.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 146

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 97/143 (67%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++++   LPHRYPFLLVDK+  ++  E   G KN++ ++  FMGHFPG P+ PGVLILE
Sbjct: 3   DVMQIQEILPHRYPFLLVDKITELKVKEVVRGYKNISISDHVFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQT G + A  +  D+  P     Y   ID A+FR PV PGDRL+Y ++ V+NR ++W
Sbjct: 63  GMAQT-GGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNMW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            F+  A V+  +VAEAE+ AM++
Sbjct: 122 IFKGQAFVDGNLVAEAELKAMIV 144


>gi|149915223|ref|ZP_01903751.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter sp.
           AzwK-3b]
 gi|149810944|gb|EDM70783.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter sp.
           AzwK-3b]
          Length = 154

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 93/145 (64%), Gaps = 3/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L + DI  +   +PHRYPFLL+DKVV+I    SA GIKNVT NEPHF GHFPG+P+MPGV
Sbjct: 5   LKSADIQLIQALIPHRYPFLLIDKVVDIDGCTSARGIKNVTINEPHFQGHFPGKPIMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD- 125
            I+E MAQTA  +     G + +    Y M+ID  +FR+ V PGD LE  +  +R +   
Sbjct: 65  TIVEAMAQTAAVMVGTAMGMEGRDLLVYFMAIDNCKFRRMVVPGDVLELKLTTLRGKPGG 124

Query: 126 -LWKFQCCAKVENTVVAEAEICAMV 149
            +WKF   A+VE  +V EAE  AM+
Sbjct: 125 KVWKFAGVAEVEGEIVTEAEFTAMM 149


>gi|222055194|ref|YP_002537556.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. FRC-32]
 gi|221564483|gb|ACM20455.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. FRC-32]
          Length = 146

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 91/137 (66%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHRYPFLLVD++V ++  +  +G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DINEIMKILPHRYPFLLVDRIVEMEPAKRIVGLKNVTINEPFFQGHFPGHPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  + +  +      Y MSID A+FRKPVFPGD+L   +  + +R  +W   
Sbjct: 63  AMAQVAGIMAYLASDEETRKKVSYFMSIDSAKFRKPVFPGDQLRIEIETIFHRRGIWSVA 122

Query: 131 CCAKVENTVVAEAEICA 147
             A V + +  EAE+ A
Sbjct: 123 GKAFVGDVLATEAELKA 139


>gi|118581425|ref|YP_902675.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pelobacter propionicus DSM
           2379]
 gi|118504135|gb|ABL00618.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Pelobacter
           propionicus DSM 2379]
          Length = 147

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 90/137 (65%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+M+ LPHR+PFL+VD+V+ ++  +  +G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 4   DVNEIMKILPHRFPFLMVDRVIELEPGKRCVGLKNVTINEPFFQGHFPGHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAI-HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  +  +   +    Y MSID A+FRKPVFPGD+L   V    NR  +W   
Sbjct: 64  AMAQVAGIMAYMASDDRTKKKVSYFMSIDSAKFRKPVFPGDQLRIEVETTMNRRGIWGVN 123

Query: 131 CCAKVENTVVAEAEICA 147
               V+ T+V EA + A
Sbjct: 124 GKVYVDGTLVTEAALKA 140


>gi|15612355|ref|NP_224008.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori J99]
 gi|254779915|ref|YP_003058021.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori B38]
 gi|14423718|sp|Q9ZJL6|FABZ_HELPJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|4155894|gb|AAD06864.1| HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN DEHYDRATASE [Helicobacter
           pylori J99]
 gi|254001827|emb|CAX30070.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) [Helicobacter
           pylori B38]
          Length = 159

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|114764263|ref|ZP_01443491.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pelagibaca bermudensis HTCC2601]
 gi|114543211|gb|EAU46228.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius sp. HTCC2601]
          Length = 153

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L   DI  + R LPHRYPFLLVD+VV I   +SA+GIKNVT NEPHF GHFPG+P+MPG
Sbjct: 4   TLLTADIQLIQRILPHRYPFLLVDRVVEIDGYKSAVGIKNVTMNEPHFQGHFPGQPIMPG 63

Query: 67  VLILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I E MAQTA  +        D+    Y M+IDK +FR+ V PGD+L  ++  +R +  
Sbjct: 64  VTIAEAMAQTAAVMVGTALDLADKDLKVYFMAIDKCKFRRMVVPGDQLRMNLTTLRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A+VE  +  E E  AM+
Sbjct: 124 GKVWKFGGVAEVEGEMACEVEFTAMM 149


>gi|296274529|ref|YP_003657160.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Arcobacter nitrofigilis DSM 7299]
 gi|296098703|gb|ADG94653.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Arcobacter nitrofigilis DSM 7299]
          Length = 147

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 95/144 (65%), Gaps = 6/144 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYPFLLVD++ +++  +S IG KN++ +EP FMGHFPG P+ PGVLILE
Sbjct: 3   DVTQIQEILPHRYPFLLVDRITSMEEGKSIIGFKNISISEPAFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ AG I A+ +    Y        Y MSID A+FR PV PGD+LEY +   + R +L
Sbjct: 63  GMAQ-AGGILALKSNDLSYEEMKSKVIYFMSIDGAKFRTPVKPGDKLEYRIEVKKLRGNL 121

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
                 A V+  +VAEAE+ AMV+
Sbjct: 122 IVLAGQAFVDEKLVAEAELKAMVV 145


>gi|108762744|ref|YP_632887.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Myxococcus xanthus DK 1622]
 gi|123374296|sp|Q1D386|FABZ_MYXXD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|108466624|gb|ABF91809.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Myxococcus xanthus DK 1622]
          Length = 153

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+VV I   +     KNVT NEP F GHFPG PVMPGVLILE
Sbjct: 2   DIGEILNLLPHRYPFLLVDRVVEIIPGQKLTAYKNVTINEPFFNGHFPGHPVMPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ    +       D      YLM +D ARFRKPV PGDRL+  +  VR++  +WK +
Sbjct: 62  ALAQATAILAYKSENMDPSRKLTYLMGVDGARFRKPVLPGDRLQLEIEVVRHKGAVWKTK 121

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A V+   VAE E  A V+
Sbjct: 122 GLATVDGARVAEGEFLATVV 141


>gi|78187494|ref|YP_375537.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium luteolum DSM 273]
 gi|78167396|gb|ABB24494.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Chlorobium
           luteolum DSM 273]
          Length = 487

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 87/145 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 342 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIE 401

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +        + +  Y M+IDKARFRKPV PGD L         R  + +F  
Sbjct: 402 AMAQTGGIMMLNGKNNTKESVVYFMAIDKARFRKPVLPGDTLVIEAVMTNMRRSVCQFDA 461

Query: 132 CAKVENTVVAEAEICAMVMHEKKEK 156
            A V   +V EA + A VM +  EK
Sbjct: 462 KAFVRGELVCEASLMATVMDKPAEK 486


>gi|283955253|ref|ZP_06372754.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283793290|gb|EFC32058.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 146

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++ +   LPHRYPFLLVDK+  ++  E   G KN++ ++  FMGHFPG P+ PGVLILE
Sbjct: 3   DVMRIQEILPHRYPFLLVDKITELKVKEVVRGYKNISISDHVFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQT G + A  +  D+  P     Y   ID A+FR PV PGDRL+Y ++ V+NR ++W
Sbjct: 63  GMAQT-GGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNMW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            F+  A V+  +VAEAE+ AM++
Sbjct: 122 IFKGQAFVDGNLVAEAELKAMIV 144


>gi|84516079|ref|ZP_01003439.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Loktanella vestfoldensis SKA53]
 gi|84509775|gb|EAQ06232.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Loktanella vestfoldensis SKA53]
          Length = 153

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 93/148 (62%), Gaps = 9/148 (6%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +   DI  + + LPHRYPFLLVDKV +I    SA+GIKNVT NEPHF GHFPG P+MPGV
Sbjct: 5   ITTADIQLIQKILPHRYPFLLVDKVHSIDGTSSAVGIKNVTMNEPHFQGHFPGNPIMPGV 64

Query: 68  LILEGMAQTA----GAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
            I+E MAQT+    GA   + NG D     Y M+ID  +FR+ V PGD LE  V   R +
Sbjct: 65  TIIEAMAQTSAVMVGASLGLING-DLLV--YFMAIDGCKFRRKVVPGDVLEMRVETTRGK 121

Query: 124 --VDLWKFQCCAKVENTVVAEAEICAMV 149
               +W+F+  A V+  + AEAE  AM+
Sbjct: 122 PGGKVWRFKGVATVDGELAAEAEFTAMM 149


>gi|95929401|ref|ZP_01312144.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfuromonas acetoxidans DSM 684]
 gi|95134517|gb|EAT16173.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfuromonas acetoxidans DSM 684]
          Length = 146

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (65%)

Query: 14  VELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGM 73
            E+M+ LPHRYPFLLVD + +   +ES +GIKNVT NEP F GHFPG P+MPGVLI+E M
Sbjct: 6   TEVMKRLPHRYPFLLVDGIESFTENESIVGIKNVTINEPFFQGHFPGHPIMPGVLIVEAM 65

Query: 74  AQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           AQ  G   ++++   +    Y   IDK +FRKPV PGD L   +N ++ R  +++F   A
Sbjct: 66  AQVGGLFASLNDEIGEDKVTYFTGIDKVKFRKPVVPGDVLRMELNLLKCRRGIYQFSGKA 125

Query: 134 KVENTVVAEAEICA 147
            V  T+V EAE+ A
Sbjct: 126 YVGETLVTEAELKA 139


>gi|115377099|ref|ZP_01464314.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Stigmatella aurantiaca DW4/3-1]
 gi|310822809|ref|YP_003955167.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Stigmatella aurantiaca DW4/3-1]
 gi|115365874|gb|EAU64894.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395881|gb|ADO73340.1| Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase FabZ
           [Stigmatella aurantiaca DW4/3-1]
          Length = 153

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 91/143 (63%), Gaps = 7/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ R LPHRYPFLLVD+VV     +     KNVT NEP F GHFPG PVMPGVLILE
Sbjct: 2   DIGEIQRLLPHRYPFLLVDRVVEFVEGQKLTAYKNVTINEPFFNGHFPGHPVMPGVLILE 61

Query: 72  GMAQTAGAICAIH----NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ A AI A      N  ++ A  YLM +D A+FRKPV PGDRLE  +  +R++  +W
Sbjct: 62  ALAQ-ATAILAYKSESMNPENKVA--YLMGVDNAKFRKPVLPGDRLELGIEVLRHKGSVW 118

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
           K +  A V+   VAE E  A V+
Sbjct: 119 KTKGTATVDGVKVAEGEFLATVV 141


>gi|190359394|sp|A5G6H7|FABZ_GEOUR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 93/144 (64%), Gaps = 1/144 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHR+PFL+VD++V ++  +  +G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 2   DINEIMKILPHRFPFLMVDRIVEMEPGKRCVGLKNVTINEPFFQGHFPGHPVMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  + +  +      Y M+ID A+FRKPVFPGD+L   V  + +R  +W   
Sbjct: 62  AMAQVAGIMAYLASDDETRKKVSYFMAIDNAKFRKPVFPGDQLRIEVETIFSRRGIWSVA 121

Query: 131 CCAKVENTVVAEAEICAMVMHEKK 154
             A V+  +  EAE+ A    + K
Sbjct: 122 GKAYVDGVLATEAELKATFAEKAK 145


>gi|15645986|ref|NP_208167.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori 26695]
 gi|14423689|sp|O25928|FABZ_HELPY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|2314546|gb|AAD08419.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase (fabZ)
           [Helicobacter pylori 26695]
          Length = 159

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|148265262|ref|YP_001231968.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacter uraniireducens
           Rf4]
 gi|146398762|gb|ABQ27395.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Geobacter
           uraniireducens Rf4]
          Length = 146

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 93/144 (64%), Gaps = 1/144 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHR+PFL+VD++V ++  +  +G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DINEIMKILPHRFPFLMVDRIVEMEPGKRCVGLKNVTINEPFFQGHFPGHPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  + +  +      Y M+ID A+FRKPVFPGD+L   V  + +R  +W   
Sbjct: 63  AMAQVAGIMAYLASDDETRKKVSYFMAIDNAKFRKPVFPGDQLRIEVETIFSRRGIWSVA 122

Query: 131 CCAKVENTVVAEAEICAMVMHEKK 154
             A V+  +  EAE+ A    + K
Sbjct: 123 GKAYVDGVLATEAELKATFAEKAK 146


>gi|157165313|ref|YP_001467560.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter concisus
           13826]
 gi|166233417|sp|A7ZFK2|FABZ_CAMC1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|112801092|gb|EAT98436.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter concisus 13826]
          Length = 148

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 100/145 (68%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHR+PFLL+D+VV ++  ++ +  KNVT  EP F GHFPG P+ PGV+I+E
Sbjct: 3   DVVEIQKILPHRFPFLLIDRVVELEPAKNIVAYKNVTIGEPIFQGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  +  D++         Y MSID A+FR PV PGDRLEY +N ++++ +
Sbjct: 63  GMAQ-AGGVLAFKSMSDEHQAGIENKVVYFMSIDGAKFRHPVRPGDRLEYRLNVLKHKGN 121

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W  +  A V++ + AEAE+ AM++
Sbjct: 122 IWVLEGKAYVDDVLCAEAELKAMIV 146


>gi|315637946|ref|ZP_07893132.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter upsaliensis JV21]
 gi|315481981|gb|EFU72599.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter upsaliensis JV21]
          Length = 146

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 93/144 (64%), Gaps = 7/144 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++++   LPHRYPFLLVDK+  ++  E   G KN++ ++  F+GHFPG P+ PGVLILE
Sbjct: 3   DVMQIQEILPHRYPFLLVDKITELKIGEVVKGYKNISISDYVFIGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQT G +       D    P     Y   ID+A+FR PV PGDRL+Y +  V+NR  L
Sbjct: 63  GMAQTGGVLA--FESMDNKVNPKEKVVYFTGIDRAKFRNPVRPGDRLDYEMRVVKNRGAL 120

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W F+  A VE  +VAEAE+ AM++
Sbjct: 121 WIFEGKAFVEENLVAEAELKAMIV 144


>gi|145220233|ref|YP_001130942.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Prosthecochloris vibrioformis DSM 265]
 gi|145206397|gb|ABP37440.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Chlorobium
           phaeovibrioides DSM 265]
          Length = 468

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 89/141 (63%), Gaps = 4/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 325 DINAIQKMLPHRYPFLLIDKIVEFKLDEKIVAIKNVTMNEPFFQGHFPGNPVMPGVLIIE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQT G +  + NG D       Y M+IDKARFRKPV PGD L      V  R  + +F
Sbjct: 385 AMAQTGGIM--MLNGKDNTKESVVYFMAIDKARFRKPVLPGDTLVIEGVMVNMRRSVCQF 442

Query: 130 QCCAKVENTVVAEAEICAMVM 150
           +  A V   +V EA + A VM
Sbjct: 443 EAKAFVRGELVCEASLMATVM 463


>gi|83951892|ref|ZP_00960624.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius nubinhibens ISM]
 gi|83836898|gb|EAP76195.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseovarius nubinhibens ISM]
          Length = 156

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 92/146 (63%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L   DI  + R +PHRYPFLLVDKVV+I   +SA GIKNVT NEPHF GHFP +P+MPG
Sbjct: 4   ALKTADIQMIKRLIPHRYPFLLVDKVVDIDGYKSARGIKNVTMNEPHFQGHFPDKPIMPG 63

Query: 67  VLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQTA  +     +  D+    Y M+IDK +FR+ V PGD LE +V  +R +  
Sbjct: 64  VTIVEAMAQTAAVMVGTALDMADKNLLVYFMAIDKCKFRRMVVPGDVLEMNVETMRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF   A VE  +  E E  AM+
Sbjct: 124 GKVWKFTGVATVEGEMACEVEFTAMM 149


>gi|57505538|ref|ZP_00371465.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter upsaliensis RM3195]
 gi|57016085|gb|EAL52872.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter upsaliensis RM3195]
          Length = 146

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 92/144 (63%), Gaps = 7/144 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++   LPHRYPFLLVDK+  ++  E   G KN++ ++  FMGHFPG P+ PGVLILE
Sbjct: 3   DIMQIQEILPHRYPFLLVDKITELKIGEVVKGYKNISISDYVFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQT G +       D    P     Y   ID A+FR PV PGDRL+Y +  ++NR  L
Sbjct: 63  GMAQTGGVLA--FESMDNKVNPKEKVVYFTGIDGAKFRNPVRPGDRLDYEMRVMKNRGAL 120

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W F+  A VE  +VAEAE+ AM++
Sbjct: 121 WIFEGKAFVEENLVAEAELKAMIV 144


>gi|322418270|ref|YP_004197493.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. M18]
 gi|320124657|gb|ADW12217.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. M18]
          Length = 144

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 93/140 (66%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIV++M  LPHRYPFLL+D++V ++  +  +GIKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DIVQIMELLPHRYPFLLIDRIVELEPGKRVVGIKNVTMNEPFFQGHFPGFPVMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A AI A ++  D+      Y M+ID ARFRKPV PGD L   V  + ++  +W  
Sbjct: 63  SMAQCA-AILAYNSVGDEAKEKVSYFMAIDNARFRKPVKPGDTLRIEVETLFSKRGIWSV 121

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A V  T++ EAE+ A +
Sbjct: 122 AAKAYVGETLMTEAELKATL 141


>gi|189346101|ref|YP_001942630.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium limicola DSM 245]
 gi|189340248|gb|ACD89651.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chlorobium limicola DSM 245]
          Length = 467

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 86/143 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG P+MPGVLILE
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLILE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +    N   + +  Y M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGNENIKESVVYFMGIDKARFRKPVLPGDTLVIEAVMTNKRRTVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V   +V EA + A V+ + K
Sbjct: 445 KAFVRGELVCEASLMATVVSKNK 467


>gi|74316814|ref|YP_314554.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Thiobacillus
           denitrificans ATCC 25259]
 gi|91206658|sp|Q3SKN0|FABZ_THIDA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|74056309|gb|AAZ96749.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thiobacillus denitrificans ATCC 25259]
          Length = 145

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M++LPHRYPFLLVDKV  ++  +    +KNVT NEP F GHFPG PVMPGVLILE
Sbjct: 2   DIEQVMQYLPHRYPFLLVDKVTELELGKRITAVKNVTINEPFFNGHFPGAPVMPGVLILE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +      +  +Q    Y   ID ARF+KPV PGD+L      VR    +WK+
Sbjct: 62  AMAQAAGILSFKTKNYSPEQIGIIYFAGIDGARFKKPVKPGDQLVLKAEIVREVRGIWKY 121

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A+V+  +VAEAE+ A +
Sbjct: 122 TGRAEVDGALVAEAELMATL 141


>gi|217032413|ref|ZP_03437907.1| hypothetical protein HPB128_164g13 [Helicobacter pylori B128]
 gi|216945892|gb|EEC24510.1| hypothetical protein HPB128_164g13 [Helicobacter pylori B128]
          Length = 177

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 32  IEHILQILPHRYPMLLVDRITELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 91

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 92  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 151

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 152 QVGGTAQVDGKVVAEAELKAMI 173


>gi|210135561|ref|YP_002302000.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori P12]
 gi|226700472|sp|B6JNP2|FABZ_HELP2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|210133529|gb|ACJ08520.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter pylori P12]
          Length = 159

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|78188145|ref|YP_378483.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium chlorochromatii CaD3]
 gi|78170344|gb|ABB27440.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase /
           UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase [Chlorobium chlorochromatii CaD3]
          Length = 467

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 86/143 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+   + DE  + IKNVT NEP F GHFPG P+MPGVLILE
Sbjct: 325 DINAIQNILPHRYPFLLIDKITEFKLDEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLILE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +    N   + +  Y M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGNDNIKESVVYFMGIDKARFRKPVLPGDTLVIEAVMTNKRRTVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V+  +V EA + A V+ + K
Sbjct: 445 KAYVQGELVCEASLMATVVAKNK 467


>gi|78485619|ref|YP_391544.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thiomicrospira crunogena XCL-2]
 gi|78363905|gb|ABB41870.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Thiomicrospira
           crunogena XCL-2]
          Length = 148

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 89/145 (61%), Gaps = 5/145 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+  +LPHRYPFLLVD+V   +  ES    KNVT+NEP F GHFP  P+MPGV+I+E
Sbjct: 6   NVKEIFEYLPHRYPFLLVDRVTEFKSGESLKAYKNVTYNEPQFTGHFPDNPIMPGVMIIE 65

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +         D  +  YL ++D  RFRKP  PGD+LE+ V  V N+  +WKF
Sbjct: 66  AMAQCTGILAFKTQDVKPDGTSMYYLAAVDNCRFRKPAIPGDKLEFEVKTVNNKKGIWKF 125

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
           +C   V+  ++A    C M+  E+K
Sbjct: 126 ECTTSVDGKLIAS---CDMLCAERK 147


>gi|308183488|ref|YP_003927615.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori PeCan4]
 gi|308065673|gb|ADO07565.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori PeCan4]
          Length = 159

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD         Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDHEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|317014769|gb|ADU82205.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori
           Gambia94/24]
          Length = 159

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|77463265|ref|YP_352769.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides
           2.4.1]
 gi|126462139|ref|YP_001043253.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332558143|ref|ZP_08412465.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides
           WS8N]
 gi|91206647|sp|Q3J2W6|FABZ_RHOS4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|158513437|sp|A3PJG5|FABZ_RHOS1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|77387683|gb|ABA78868.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103803|gb|ABN76481.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332275855|gb|EGJ21170.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides
           WS8N]
          Length = 155

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 92/145 (63%), Gaps = 2/145 (1%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L A DI  + R +PHRYPFLLVD+V +I  ++SA+GIK VT NEP F GHFPG P+ P
Sbjct: 7   ATLSA-DIQLIQRIIPHRYPFLLVDRVRDIVPNKSAVGIKCVTMNEPQFTGHFPGLPIFP 65

Query: 66  GVLILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GV I+E MAQT+  +  +     D+ A  Y M ID A+FR+ V PGD LE  V   R   
Sbjct: 66  GVQIIEAMAQTSAVLVGVSMDLADKGAKVYFMGIDGAKFRRKVVPGDVLEMTVTVKRGGG 125

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WKF+  A V+  + AEAE  AM+
Sbjct: 126 KVWKFEGRASVDGELAAEAEFSAML 150


>gi|90407919|ref|ZP_01216094.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Psychromonas sp. CNPT3]
 gi|90311010|gb|EAS39120.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Psychromonas sp. CNPT3]
          Length = 150

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 72/154 (46%), Positives = 97/154 (62%), Gaps = 15/154 (9%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E+M  LPHRYPFLLVD+V++ +  ++   IKNV+FNEP F GHFPG PV PGV
Sbjct: 5   LNSLDIKEIMDLLPHRYPFLLVDRVIDYEPGKTLQAIKNVSFNEPQFQGHFPGHPVFPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           +I+E +AQ  G +      F  Y  P      +L SIDK RFR+PV PGD LE  V  ++
Sbjct: 65  MIIEALAQATGIL-----AFATYGKPAPNELYFLASIDKVRFRRPVVPGDVLELEVIYLK 119

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
            R  + KF+C AKV+  V  +    AM+M  ++E
Sbjct: 120 ERRGMGKFECTAKVDGEVACQ----AMIMCARRE 149


>gi|305432809|ref|ZP_07401967.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter coli JV20]
 gi|304443963|gb|EFM36618.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Campylobacter coli JV20]
          Length = 146

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (64%), Gaps = 7/144 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++++   LPHRYPFLLVDK+  ++  E   G KN++ ++  FMGHFPG P+ PGVLILE
Sbjct: 3   DVMKIQEILPHRYPFLLVDKITELKVGEVVRGYKNISISDHVFMGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQT G +       D    P     Y   ID A+FR PV PGDRL+Y +  V+NR ++
Sbjct: 63  GMAQTGGVLA--FESMDAKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMQVVKNRGNM 120

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W F+  A V+  +VAEAE+ AM++
Sbjct: 121 WIFKGQAFVDGNLVAEAELKAMIV 144


>gi|307638048|gb|ADN80498.1| 3R-hydroxymyristoyl-acyl carrier protein dehydratase [Helicobacter
           pylori 908]
 gi|325996652|gb|ADZ52057.1| 3R-hydroxymyristoyl-acyl carrier protein dehydratase [Helicobacter
           pylori 2018]
 gi|325998241|gb|ADZ50449.1| 3R-hydroxymyristoyl-acyl carrier protein dehydratase [Helicobacter
           pylori 2017]
          Length = 159

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|91206657|sp|Q31G53|FABZ_THICR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 89/145 (61%), Gaps = 5/145 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+  +LPHRYPFLLVD+V   +  ES    KNVT+NEP F GHFP  P+MPGV+I+E
Sbjct: 3   NVKEIFEYLPHRYPFLLVDRVTEFKSGESLKAYKNVTYNEPQFTGHFPDNPIMPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +         D  +  YL ++D  RFRKP  PGD+LE+ V  V N+  +WKF
Sbjct: 63  AMAQCTGILAFKTQDVKPDGTSMYYLAAVDNCRFRKPAIPGDKLEFEVKTVNNKKGIWKF 122

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
           +C   V+  ++A    C M+  E+K
Sbjct: 123 ECTTSVDGKLIAS---CDMLCAERK 144


>gi|298737035|ref|YP_003729565.1| 3R-hydroxymyristoyl ACP dehydrase [Helicobacter pylori B8]
 gi|298356229|emb|CBI67101.1| 3R-hydroxymyristoyl ACP dehydrase [Helicobacter pylori B8]
          Length = 159

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|119356378|ref|YP_911022.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium phaeobacteroides DSM 266]
 gi|119353727|gb|ABL64598.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase /
           UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase [Chlorobium phaeobacteroides DSM 266]
          Length = 467

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 84/143 (58%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +        Q    Y M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGTENIQEMLVYFMGIDKARFRKPVLPGDTLVIEAVMTNKRRSVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V   +V EA + A VM + K
Sbjct: 445 KAYVRGELVCEASLMATVMPKTK 467


>gi|308185157|ref|YP_003929290.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori SJM180]
 gi|308061077|gb|ADO02973.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori SJM180]
          Length = 159

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDMFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|242279987|ref|YP_002992116.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio salexigens DSM 2638]
 gi|242122881|gb|ACS80577.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio salexigens DSM 2638]
          Length = 154

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 93/146 (63%), Gaps = 1/146 (0%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  DI ++M  LPHRYPFLLVD+V  I   ES    KNVT NEP F GHFPG PVMPGVL
Sbjct: 7   DIIDIKKIMGMLPHRYPFLLVDRVEEITPGESIRAYKNVTMNEPFFQGHFPGLPVMPGVL 66

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           I+E +AQ  G I    +  D     +L + I+K +FR+PV PGD+L   ++ V+ ++ +W
Sbjct: 67  IVEALAQAGGIIVLSTDEVDTEDKVFLFTGINKVKFRRPVVPGDKLVLEISDVKRKMHIW 126

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEK 153
           K +C A V+  V A+ E+ A ++ ++
Sbjct: 127 KMKCVATVDGEVAAQGEVSAAIVDKE 152


>gi|15603889|ref|NP_220404.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia prowazekii str.
           Madrid E]
 gi|6225313|sp|Q9ZED4|FABZ_RICPR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|3860580|emb|CAA14481.1| (3R)-HYDROXYMYRISTOYL-[ACYL CARRIER PROTEIN] DEHYDRATASE (fabZ)
           [Rickettsia prowazekii]
 gi|292571605|gb|ADE29520.1| (3R)-hydroxymyristoyl-(acylcarrier protein)dehydratase [Rickettsia
           prowazekii Rp22]
          Length = 145

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 88/137 (64%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+M  +PHRYPFLLVD+V+ I  ++S IGIKNVT NEP F GHFP RPVMPGVL++E 
Sbjct: 5   ITEIMDLIPHRYPFLLVDRVLKIDPNKSIIGIKNVTVNEPQFTGHFPARPVMPGVLMVES 64

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ A  + A      +    +LMSI+  +FR+ V PGD +  H    + R ++WKF   
Sbjct: 65  MAQLAAILVAKSLDSTKNKEVFLMSIENTKFRRIVQPGDTMHIHSVIDQQRANVWKFSSK 124

Query: 133 AKVENTVVAEAEICAMV 149
             VE  + AE++  AM+
Sbjct: 125 VMVECEIAAESKFTAMI 141


>gi|221639129|ref|YP_002525391.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides
           KD131]
 gi|254788935|sp|B9KRU8|FABZ_RHOSK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|221159910|gb|ACM00890.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rhodobacter sphaeroides KD131]
          Length = 155

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 90/141 (63%), Gaps = 1/141 (0%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           + DI  + R +PHRYPFLLVD+V +I  ++SA+GIK VT NEP F GHFPG P+ PGV I
Sbjct: 10  SADIQLIQRIIPHRYPFLLVDRVRDIVPNKSAVGIKCVTMNEPQFTGHFPGLPIFPGVQI 69

Query: 70  LEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           +E MAQT+  +  +     D+ A  Y M ID A+FR+ V PGD LE  V   R    +WK
Sbjct: 70  IEAMAQTSAVLVGVSMDLADKGAKVYFMGIDGAKFRRKVVPGDVLEMTVTVKRGGGKVWK 129

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           F+  A V+  + AEAE  AM+
Sbjct: 130 FEGRASVDGELAAEAEFSAML 150


>gi|145579403|pdb|2GLL|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579404|pdb|2GLL|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579405|pdb|2GLL|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579406|pdb|2GLL|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579407|pdb|2GLL|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579408|pdb|2GLL|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 gi|145579409|pdb|2GLM|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579410|pdb|2GLM|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579411|pdb|2GLM|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579412|pdb|2GLM|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579413|pdb|2GLM|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579414|pdb|2GLM|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 gi|145579415|pdb|2GLP|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 gi|145579416|pdb|2GLP|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 gi|145579417|pdb|2GLP|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 gi|145579418|pdb|2GLP|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 gi|145579419|pdb|2GLP|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 gi|145579420|pdb|2GLP|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
          Length = 171

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 26  IEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 85

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 86  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 145

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 146 QVGGTAQVDGKVVAEAELKAMI 167


>gi|83647905|ref|YP_436340.1| (3R)-hydroxymyristoyl-ACP dehydratase [Hahella chejuensis KCTC
           2396]
 gi|109828923|sp|Q2SBQ9|FABZ_HAHCH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|83635948|gb|ABC31915.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Hahella
           chejuensis KCTC 2396]
          Length = 144

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 88/139 (63%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+  +LPHRYPFLLVD+V+ I+  E   G+KN+T+NEP F GHFP  P+MPGVLI+E
Sbjct: 2   EINEIKEYLPHRYPFLLVDRVLEIKPGEFIAGVKNITYNEPQFTGHFPDHPIMPGVLIIE 61

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ AG +  +  G    D Y   YL   DK RF+KPV PGD+L      V ++  +WK
Sbjct: 62  AMAQVAGILGFVTTGKKPADGYT-YYLAGTDKVRFKKPVVPGDQLRLEAEIVTDKRGIWK 120

Query: 129 FQCCAKVENTVVAEAEICA 147
           F C A V+  VV  AEI  
Sbjct: 121 FACRALVDGNVVCSAEILT 139


>gi|152992703|ref|YP_001358424.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sulfurovum sp. NBC37-1]
 gi|166234297|sp|A6Q9A8|FABZ_SULNB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|151424564|dbj|BAF72067.1| 3R-hydroxymyristoyl ACP dehydrase [Sulfurovum sp. NBC37-1]
          Length = 149

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 97/144 (67%), Gaps = 5/144 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++VE+ + LPHRYPFLLVD++ ++++     G KNV+ +EP F GHFP  P+ PGV+I+E
Sbjct: 4   NVVEIQKILPHRYPFLLVDRITHLEKGSYIEGYKNVSISEPVFQGHFPDHPIYPGVMIIE 63

Query: 72  GMAQTAGAIC--AIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ  G +   ++ N   +       Y MSIDKA+FR PV PGD+L Y +N ++N+  +
Sbjct: 64  GMAQAGGVLAFESMDNATQEEIANKVVYFMSIDKAKFRSPVTPGDQLVYKLNVIKNKGAI 123

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           W+    A V++ +VAEAE+ AM++
Sbjct: 124 WQLDAKAYVDDKLVAEAELKAMIV 147


>gi|207091896|ref|ZP_03239683.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 159

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++     KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANKKIAAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|188528165|ref|YP_001910852.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori Shi470]
 gi|226700474|sp|B2UVE0|FABZ_HELPS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|188144405|gb|ACD48822.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori Shi470]
 gi|297380558|gb|ADI35445.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Helicobacter pylori v225d]
 gi|308062660|gb|ADO04548.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori Cuz20]
 gi|308064151|gb|ADO06038.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori Sat464]
          Length = 159

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LL+D+VV ++ ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLIDRVVELEANKKIVAYKNITFNEDVFNGHFPDKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|208435269|ref|YP_002266935.1| (3R)-hydroxymyristoyl-(acylcarrierprotein) dehydratase
           [Helicobacter pylori G27]
 gi|226700473|sp|B5Z920|FABZ_HELPG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|208433198|gb|ACI28069.1| (3R)-hydroxymyristoyl-(acylcarrierprotein) dehydratase
           [Helicobacter pylori G27]
          Length = 159

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LL+D+VV ++ +   +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLIDRVVELEANRKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|197117234|ref|YP_002137661.1| (3R)-hydroxyacyl-(acyl carrier protein) dehydratase [Geobacter
           bemidjiensis Bem]
 gi|197086594|gb|ACH37865.1| (3R)-hydroxyacyl-(acyl carrier protein) dehydratase [Geobacter
           bemidjiensis Bem]
          Length = 144

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 88/139 (63%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIV++M  LPHRYPFLLVDK+V ++  +  +GIKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DIVQIMELLPHRYPFLLVDKIVEMEPGKRIVGIKNVTMNEPFFQGHFPGFPVMPGVLIIE 62

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ A  +      G  +    Y M+ID ARFRKPV PGD L   V  +  +  +W   
Sbjct: 63  AMAQVAAILAYKAAEGDAKEKVSYFMAIDNARFRKPVKPGDTLRIEVETLFCKRGIWSVA 122

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V  T++ EAE+ A +
Sbjct: 123 AKAYVGETLMTEAELKATL 141


>gi|197725029|pdb|3B7J|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|197725030|pdb|3B7J|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|197725031|pdb|3B7J|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|197725032|pdb|3B7J|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|197725033|pdb|3B7J|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|197725034|pdb|3B7J|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 gi|217035384|pdb|3CF8|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035385|pdb|3CF8|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035386|pdb|3CF8|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035387|pdb|3CF8|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035388|pdb|3CF8|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035389|pdb|3CF8|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 gi|217035390|pdb|3CF9|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035391|pdb|3CF9|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035392|pdb|3CF9|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035393|pdb|3CF9|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035394|pdb|3CF9|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035395|pdb|3CF9|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 gi|217035396|pdb|3D04|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|217035397|pdb|3D04|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|217035398|pdb|3D04|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|217035399|pdb|3D04|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|217035400|pdb|3D04|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|217035401|pdb|3D04|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 gi|229597720|pdb|3DOY|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597721|pdb|3DOY|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597722|pdb|3DOY|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597723|pdb|3DOY|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597724|pdb|3DOY|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597725|pdb|3DOY|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 gi|229597726|pdb|3DOZ|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597727|pdb|3DOZ|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597728|pdb|3DOZ|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597729|pdb|3DOZ|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597730|pdb|3DOZ|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597731|pdb|3DOZ|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 gi|229597732|pdb|3DP0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597733|pdb|3DP0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597734|pdb|3DP0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597735|pdb|3DP0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597736|pdb|3DP0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597737|pdb|3DP0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 gi|229597738|pdb|3DP1|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597739|pdb|3DP1|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597740|pdb|3DP1|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597741|pdb|3DP1|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597742|pdb|3DP1|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597743|pdb|3DP1|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 gi|229597744|pdb|3DP2|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597745|pdb|3DP2|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597746|pdb|3DP2|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597747|pdb|3DP2|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597748|pdb|3DP2|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597749|pdb|3DP2|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 gi|229597750|pdb|3DP3|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|229597751|pdb|3DP3|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|229597752|pdb|3DP3|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|229597753|pdb|3DP3|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|229597754|pdb|3DP3|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|229597755|pdb|3DP3|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 gi|254574814|pdb|3ED0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|254574815|pdb|3ED0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|254574816|pdb|3ED0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|254574817|pdb|3ED0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|254574818|pdb|3ED0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|254574819|pdb|3ED0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 gi|56684725|gb|AAW22049.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Helicobacter pylori]
          Length = 159

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|317011703|gb|ADU85450.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori
           SouthAfrica7]
          Length = 159

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LL+D+VV ++ ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLIDRVVELEANKKIVAYKNITFNEDVFNGHFPDKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|317013162|gb|ADU83770.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori
           Lithuania75]
          Length = 159

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 94/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++     KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANQKIAAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|332994194|gb|AEF04249.1| (3R)-hydroxymyristoyl-ACP dehydratase [Alteromonas sp. SN2]
          Length = 149

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 94/146 (64%), Gaps = 6/146 (4%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
             L+  +I E++  LPHRYPFLLVD+V +    ES    KN+TFNEP F GHFPGRP+ P
Sbjct: 3   TSLNTIEIQEILSLLPHRYPFLLVDRVTDYVLGESIKAYKNITFNEPCFTGHFPGRPIFP 62

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GVLILE MAQ AG +     G  Q    YL + ID ARF++PV PGD+LE+ V  V+ R 
Sbjct: 63  GVLILEAMAQAAGVLGFKTMG--QNDKLYLYAGIDNARFKRPVVPGDKLEFDVALVKERR 120

Query: 125 DLWKFQCCAKV--ENTVVAEAEICAM 148
            +WKF+  A V  EN  VAE  +CAM
Sbjct: 121 GIWKFKGVATVDGENVCVAEF-MCAM 145


>gi|84500829|ref|ZP_00999064.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanicola batsensis HTCC2597]
 gi|84390896|gb|EAQ03314.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanicola batsensis HTCC2597]
          Length = 154

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 93/146 (63%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L + DI  + R +PHRYPFLLVD+V  I    SA+GIKNVT NEPHF GHFPG+P+MPG
Sbjct: 4   TLKSADIGLIQRIIPHRYPFLLVDRVEEIDGHASALGIKNVTMNEPHFQGHFPGKPIMPG 63

Query: 67  VLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQTA  +  +  +  D+    Y M+I+  +FR+ V PGD L   +  VR +  
Sbjct: 64  VTIVEAMAQTAAVMVGVDMDMADRDLLVYFMAIESCKFRRMVVPGDVLRMRLTTVRGKPG 123

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WKF+  A+VE  +  EAE  AM+
Sbjct: 124 GKVWKFRGVAEVEGELACEAEFTAMM 149


>gi|253702011|ref|YP_003023200.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. M21]
 gi|251776861|gb|ACT19442.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           sp. M21]
          Length = 144

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 88/139 (63%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIV++M  LPHRYPFLLVDK+V ++  +  +GIKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DIVQIMELLPHRYPFLLVDKIVEMEPGKRIVGIKNVTMNEPFFQGHFPGFPVMPGVLIIE 62

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ A  +      G  +    Y M+ID ARFRKPV PGD L   V  +  +  +W   
Sbjct: 63  AMAQVAAILAYKAAEGDAKEKVSYFMAIDNARFRKPVKPGDTLRIEVETLFCKRGIWSVA 122

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V  T++ EAE+ A +
Sbjct: 123 AKAYVGETLMTEAELKATL 141


>gi|319943815|ref|ZP_08018096.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Lautropia
           mirabilis ATCC 51599]
 gi|319743048|gb|EFV95454.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Lautropia
           mirabilis ATCC 51599]
          Length = 170

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 90/142 (63%), Gaps = 3/142 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI E++R+LPHRYPFLL+D+V  I  DE  + IKNVT NE  F GHFP  PVMPGVL+
Sbjct: 7   AIDISEILRYLPHRYPFLLIDRVTEIVHDERILAIKNVTINEHFFQGHFPHLPVMPGVLV 66

Query: 70  LEGMAQTAGAICAIHNG--FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LE MAQ AG +     G   D  +  Y   ID+ARF++PV PGD+L   V   R    +W
Sbjct: 67  LEAMAQAAGILSFASMGRYADSNSVYYFAGIDEARFKRPVSPGDQLVLDVRIARKSRLVW 126

Query: 128 KFQCCAKVENTVVAEAEI-CAM 148
           KF   A V+   VAEA++ CA+
Sbjct: 127 KFHGVATVDGQKVAEADLMCAL 148


>gi|261837484|gb|ACX97250.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter pylori 51]
 gi|261838900|gb|ACX98665.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori 52]
 gi|317176835|dbj|BAJ54624.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori F16]
 gi|317181318|dbj|BAJ59102.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori F57]
          Length = 159

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|317010054|gb|ADU80634.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori India7]
          Length = 159

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 94/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++     KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANKKIAAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQT G +      GFD    +    Y M+IDK +FR PV PGD+LEYH+  ++++  +W
Sbjct: 74  MAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRTPVTPGDKLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|297171201|gb|ADI22209.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured Gemmatimonadales bacterium
           HF0200_34B24]
 gi|297171317|gb|ADI22322.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured actinobacterium HF0500_01C15]
          Length = 142

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 89/144 (61%), Gaps = 10/144 (6%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  ++MR LPHRYP LLVD+VV + + E  +GIKNVT NEP F GHFPG P+MPGVL++E
Sbjct: 2   DSAQIMRLLPHRYPMLLVDRVVEVVKGERIVGIKNVTVNEPFFQGHFPGHPIMPGVLLVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ  G +       D+   P     Y M++DK +FR+PV PGD +      ++ R ++
Sbjct: 62  AMAQVGGLLL-----LDEIEDPEQKVLYFMTMDKVKFRRPVTPGDTITLEAEVLQLRGEV 116

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
            K Q  A VE   VAEAE  A +M
Sbjct: 117 CKMQGTASVEGNTVAEAEFKARIM 140


>gi|296136568|ref|YP_003643810.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thiomonas
           intermedia K12]
 gi|295796690|gb|ADG31480.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thiomonas
           intermedia K12]
          Length = 149

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 2/138 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
            +DI +++  LPHRYP LLVD+VV     +     KNVTFNEP F GHFP +P+MPGVLI
Sbjct: 4   TQDITQILELLPHRYPMLLVDRVVEQVNGKYIKAYKNVTFNEPFFTGHFPQKPIMPGVLI 63

Query: 70  LEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LE +AQ +G  A  ++     Q +  YL+ ID ARF++PV PGDRL+ +V   RN   ++
Sbjct: 64  LEALAQASGILAFGSVGKTPAQGSLYYLVGIDNARFKQPVIPGDRLDLYVEMTRNMRGIY 123

Query: 128 KFQCCAKVENTVVAEAEI 145
           KF   A VE  VVA+AE+
Sbjct: 124 KFTAEASVEGRVVAQAEL 141


>gi|300114866|ref|YP_003761441.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosococcus watsonii C-113]
 gi|299540803|gb|ADJ29120.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosococcus watsonii C-113]
          Length = 149

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D  DI E+++ LPHRYPFLL+D+V+     +S + +KNV++NEP+F GHFPG P+MPGV
Sbjct: 1   MDTLDIHEILKHLPHRYPFLLIDRVIECIPGKSLVAVKNVSYNEPYFQGHFPGLPIMPGV 60

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE +AQ  G  A         + A  Y   ID+ARF++PV PGD++   V  VR+   
Sbjct: 61  LILESLAQATGILAFKTTETMPSEEAIYYFAGIDRARFKRPVGPGDQMRLEVELVRSLRR 120

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           LWKF     V+ ++VA AE+
Sbjct: 121 LWKFTGTVTVDGSLVASAEV 140


>gi|167646756|ref|YP_001684419.1| (3R)-hydroxymyristoyl-ACP dehydratase [Caulobacter sp. K31]
 gi|190359375|sp|B0SZ10|FABZ_CAUSK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|167349186|gb|ABZ71921.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caulobacter sp. K31]
          Length = 163

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 90/144 (62%), Gaps = 1/144 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  +PHRYPFLLVD+  + +  +S +GIK VT NEP F GHFPG PVMPGVLI+E
Sbjct: 19  DIAEILNRIPHRYPFLLVDRAEDYRPHQSIVGIKCVTINEPFFQGHFPGNPVMPGVLIIE 78

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQT   + +     +      + MS+D ARFR PV PGD +   V   R R  ++KF+
Sbjct: 79  ALAQTGAVLMSKSLEVETEGKTIFFMSVDNARFRTPVRPGDVIRMEVEVTRARSSIFKFK 138

Query: 131 CCAKVENTVVAEAEICAMVMHEKK 154
             AKV + V AEAE  AMV+   K
Sbjct: 139 GVAKVGDKVAAEAEFAAMVVETPK 162


>gi|108563747|ref|YP_628063.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori HPAG1]
 gi|123246876|sp|Q1CRN3|FABZ_HELPH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|107837520|gb|ABF85389.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter pylori HPAG1]
          Length = 159

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+++ +Q ++     KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRIIELQANKKIAAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|16126155|ref|NP_420719.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Caulobacter crescentus CB15]
 gi|221234926|ref|YP_002517362.1| (3R)-hydroxymyristoyl-ACP dehydratase [Caulobacter crescentus
           NA1000]
 gi|20138318|sp|Q9A714|FABZ_CAUCR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788921|sp|B8GWR2|FABZ_CAUCN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|13423365|gb|AAK23887.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Caulobacter crescentus CB15]
 gi|220964098|gb|ACL95454.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Caulobacter crescentus NA1000]
          Length = 159

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 89/141 (63%), Gaps = 1/141 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  +PHRYPFLLVD+  +    +S +GIK VT NEP F GHFPG PVMPGVLI+E
Sbjct: 14  DIAEILARIPHRYPFLLVDRAEDYNPHQSIVGIKCVTINEPFFQGHFPGNPVMPGVLIIE 73

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQT   + +     D      + MS+D ARFR PV PGD +   V  +R R  ++KF+
Sbjct: 74  ALAQTGAVLMSKSLEVDTEGKTIFFMSVDNARFRNPVRPGDVIRMEVEVLRARSSIFKFK 133

Query: 131 CCAKVENTVVAEAEICAMVMH 151
             AKV + V AEAE  AMV+ 
Sbjct: 134 GVAKVGDKVAAEAEFAAMVVE 154


>gi|109946695|ref|YP_663923.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter acinonychis
           str. Sheeba]
 gi|123173627|sp|Q17ZK2|FABZ_HELAH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|109713916|emb|CAJ98924.1| (3R)-hydroxymyristoyl-dehydratase [Helicobacter acinonychis str.
           Sheeba]
          Length = 158

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 96/142 (67%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD+VV ++ ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 13  IEHILQILPHRYPMLLVDRVVELEANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 72

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGD+LEYH+  ++++  +W
Sbjct: 73  MAQSGGLLAFTSLWGFDPEMAKTKIVYFMTIDKVKFRIPVTPGDKLEYHLEVLKHKGMIW 132

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 133 QVGGTAQVDGKVVAEAELKAMI 154


>gi|294677171|ref|YP_003577786.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Rhodobacter capsulatus SB 1003]
 gi|294475991|gb|ADE85379.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Rhodobacter capsulatus SB 1003]
          Length = 153

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/149 (48%), Positives = 93/149 (62%), Gaps = 1/149 (0%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +S+ A   + D+  + R +PHRYPFL+VDKV +I   ESA+GIK VT NEP F GHFP  
Sbjct: 1   MSEPAPYTSADLSLIKRIIPHRYPFLMVDKVRDIVPFESAVGIKCVTNNEPQFTGHFPEE 60

Query: 62  PVMPGVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           PVMPGV+I+E MAQTA  +  I  N  D+    Y M+ID  +FR+ V PGD LE HV   
Sbjct: 61  PVMPGVMIVEAMAQTAAVVVGISMNVIDKPLGTYFMAIDGCKFRRKVVPGDVLEMHVTVK 120

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMV 149
           R    +WKF   + VE  + A AE  AM+
Sbjct: 121 RGGGKVWKFLGESFVEGQLAATAEFTAMM 149


>gi|294340696|emb|CAZ89088.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) (17 kDa actomyosin
           component) [Thiomonas sp. 3As]
          Length = 149

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 90/138 (65%), Gaps = 2/138 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
            +DI +++  LPHRYP LLVD+VV     +     KN+TFNEP F GHFP +P+MPGVLI
Sbjct: 4   TQDITQILELLPHRYPMLLVDRVVEQVNGKYIKAYKNITFNEPFFTGHFPQKPIMPGVLI 63

Query: 70  LEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LE +AQ +G  A  ++     Q +  YL+ ID ARF++PV PGDRL+ +V   RN   ++
Sbjct: 64  LEALAQASGILAFGSVGKTPAQGSLYYLVGIDNARFKQPVIPGDRLDLYVEMTRNMRGIY 123

Query: 128 KFQCCAKVENTVVAEAEI 145
           KF   A VE  VVA+AE+
Sbjct: 124 KFTAEASVEGRVVAQAEL 141


>gi|78356420|ref|YP_387869.1| (3R)-hydroxymyristoyl-ACP dehydratase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|91206630|sp|Q312H2|FABZ_DESDG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|78218825|gb|ABB38174.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 154

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 92/143 (64%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYPFLLVD+V++    E    +KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 10  DIRQILGLLPHRYPFLLVDRVLDYTPGECITAVKNVTMNEPFFQGHFPDVPVMPGVLIME 69

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ  G +             +L + +++ RFRKPV+PGDRLE H   +R+++ LWK +
Sbjct: 70  ALAQAGGILVVKSTDTSVEGKLFLFTGMERVRFRKPVYPGDRLELHCRLLRHKLKLWKME 129

Query: 131 CCAKVENTVVAEAEICAMVMHEK 153
             A V+  + AEAE+ A VM+ +
Sbjct: 130 GKAYVDGQLAAEAEMTAAVMNRE 152


>gi|194335782|ref|YP_002017576.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308259|gb|ACF42959.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pelodictyon phaeoclathratiforme BU-1]
          Length = 467

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 86/143 (60%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLL+DK++  + DE  + IKNVT NEP F GHFPG P+MPGVLILE
Sbjct: 325 DINAIQQILPHRYPFLLIDKIIEFKLDEKIVSIKNVTINEPFFQGHFPGNPIMPGVLILE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +    N   + +    M IDKARFRKPV PGD L         R ++ +F  
Sbjct: 385 AMAQTGGIMMLNGNDNIKESVVLFMGIDKARFRKPVLPGDTLVIEAILTNKRRNICQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V   +V EA + A V  + K
Sbjct: 445 KAYVRGELVCEASLMATVAPKSK 467


>gi|304414203|ref|ZP_07395571.1| 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase [Candidatus
           Regiella insecticola LSR1]
 gi|304283417|gb|EFL91813.1| 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase [Candidatus
           Regiella insecticola LSR1]
          Length = 185

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 92/148 (62%), Gaps = 5/148 (3%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  DI E++  LPHRYPFLLVD+V+  ++ +S   +K+V+FNEP F GHFPG+P+ PGVL
Sbjct: 7   DPLDIEEILTLLPHRYPFLLVDRVLEFEKGKSLKALKSVSFNEPFFQGHFPGKPIFPGVL 66

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           ILE MAQ  G I A  +G          Y   ID+ARFR PV PGD++   V   R R  
Sbjct: 67  ILEAMAQATG-ILAFKSGLGGLKSGEIFYFTGIDEARFRLPVTPGDQMILEVTFCRTRCG 125

Query: 126 LWKFQCCAKVENTVVAEAEI-CAMVMHE 152
           + +FQ  A V+N +V EA + CA   H+
Sbjct: 126 ITRFQGVATVDNKIVCEATMTCARNQHK 153


>gi|295689587|ref|YP_003593280.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caulobacter segnis ATCC 21756]
 gi|295431490|gb|ADG10662.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caulobacter segnis ATCC 21756]
          Length = 159

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 88/141 (62%), Gaps = 1/141 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  +PHRYPFLLVD+  +    +S +GIK VT NEP F GHFPG PVMPGVLI+E
Sbjct: 14  DIAEILARIPHRYPFLLVDRAEDYNAHKSIVGIKCVTVNEPFFQGHFPGNPVMPGVLIIE 73

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQT   + +     D      + MS+D ARFR PV PGD L   V  +R R  ++KF+
Sbjct: 74  ALAQTGAVLMSKSLEVDTEGKTIFFMSVDNARFRTPVRPGDVLHMEVEVLRARSSIFKFK 133

Query: 131 CCAKVENTVVAEAEICAMVMH 151
             AKV + V AE E  AMV+ 
Sbjct: 134 GVAKVGDKVAAEVEFAAMVVE 154


>gi|77164336|ref|YP_342861.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosococcus oceani ATCC 19707]
 gi|91206636|sp|Q3JCW5|FABZ_NITOC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|76882650|gb|ABA57331.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Nitrosococcus
           oceani ATCC 19707]
          Length = 149

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D  DI E+++ LPHRYPFLL+D+V+     +S + IKNV++NEP+F GHFPG P+MPGV
Sbjct: 1   MDTLDIHEILKHLPHRYPFLLIDRVIECIPGKSLVAIKNVSYNEPYFQGHFPGLPIMPGV 60

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE +AQ  G  A         + A  Y   ID+ARF++PV PGD++   V  VR+   
Sbjct: 61  LILESLAQATGILAFKTTETMPSEEAIYYFAGIDRARFKRPVGPGDQMRLEVELVRSLRR 120

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           LWKF     V+ ++VA AE+
Sbjct: 121 LWKFTGRVTVDGSLVASAEV 140


>gi|114321004|ref|YP_742687.1| (3R)-hydroxymyristoyl-ACP dehydratase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|122311398|sp|Q0A7J0|FABZ_ALHEH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|114227398|gb|ABI57197.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 155

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 71/137 (51%), Positives = 91/137 (66%), Gaps = 4/137 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++MR LPHRYP LL+D+VV   + E  +GIKNVT NEP+F GHFP +PVMPGVLILE
Sbjct: 13  DINDIMRNLPHRYPMLLIDRVVAFSKRERLVGIKNVTINEPYFAGHFPQKPVMPGVLILE 72

Query: 72  GMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ  G + A  +  ++       YL++IDKARF++PV PGD+L    +  R    LW 
Sbjct: 73  SMAQACG-MLAFKSEQEELGGNHIIYLVAIDKARFKRPVEPGDQLRLEASLKRVMRGLWM 131

Query: 129 FQCCAKVENTVVAEAEI 145
           FQ  A V + + AEAEI
Sbjct: 132 FQAQAWVGDALAAEAEI 148


>gi|88857966|ref|ZP_01132608.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas tunicata D2]
 gi|88819583|gb|EAR29396.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas tunicata D2]
          Length = 150

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 2/142 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI+E+++ LPHRYP LLVDKVV+ +  +S   IKNVT NEP F GHFP +P+ PGV
Sbjct: 5   LNSFDILEIIKLLPHRYPMLLVDKVVDYEAGKSLHAIKNVTINEPIFTGHFPNQPIFPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LILE +AQ  G +             YL  +ID ARF+KPV+PGD +  HV  V+ R ++
Sbjct: 65  LILEALAQATGLLGFKTAENTSENELYLFAAIDNARFKKPVYPGDTMHLHVEFVKERRNI 124

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
           WKF   AKV+  VV  AE+ CA
Sbjct: 125 WKFYGEAKVDGVVVCSAELMCA 146


>gi|51473222|ref|YP_066979.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rickettsia typhi str.
           Wilmington]
 gi|62286791|sp|Q68XZ5|FABZ_RICTY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|51459534|gb|AAU03497.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Rickettsia typhi str. Wilmington]
          Length = 145

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (63%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+M  +PHRYPFLLVD+V+ I  ++S  GIKNVT NEP F GHFP RPVMPGVL++E 
Sbjct: 5   ITEIMDLIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPTRPVMPGVLMVES 64

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ A  + A      +    +LMSI+  +FR+ V PGD +  H    + R ++WKF   
Sbjct: 65  MAQLAAILVAKSLDSTKNKEVFLMSIENTKFRRIVQPGDTMHIHSVIDQQRANVWKFSSK 124

Query: 133 AKVENTVVAEAEICAMV 149
             VE  + AE++  AM+
Sbjct: 125 VMVECEIAAESKFTAMI 141


>gi|218779637|ref|YP_002430955.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfatibacillum alkenivorans AK-01]
 gi|218761021|gb|ACL03487.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfatibacillum alkenivorans AK-01]
          Length = 146

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (64%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++M  +PHRYPFLLVDK++ +   E   G+KNVT NEP F GHFPG P+MPGVL+LE
Sbjct: 6   DVRQIMEIIPHRYPFLLVDKILELVPGEYVKGLKNVTINEPFFQGHFPGEPIMPGVLVLE 65

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTA  +    H   ++  P Y + IDK RFRKPV PGD++ + +   + + ++ K +
Sbjct: 66  AMAQTAAVLAFETHPERERGEPIYFLGIDKVRFRKPVLPGDQIIFELTDYKQKRNIMKMK 125

Query: 131 CCAKVENTVVAEAEICA 147
             A ++  +  EAE+ A
Sbjct: 126 GTATIDGELAVEAELMA 142


>gi|189424996|ref|YP_001952173.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacter lovleyi SZ]
 gi|189421255|gb|ACD95653.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           lovleyi SZ]
          Length = 145

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 88/136 (64%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M+ LPHR+PFL+VD+++ I+  +  +G+KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DINQIMKILPHRHPFLMVDRILEIEVGKRIVGLKNVTINEPFFPGHFPGHPVMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ AG +    +   +    Y   ID ARFRKPV PGD+L + +     +  +W F  
Sbjct: 63  AMAQVAGILAYQSDESVRDKVTYFTGIDNARFRKPVMPGDQLRFEIEATGCKRGIWFFSA 122

Query: 132 CAKVENTVVAEAEICA 147
            A V+  VV EAE+ A
Sbjct: 123 KALVDGKVVTEAELKA 138


>gi|332140480|ref|YP_004426218.1| (3R)-hydroxymyristoyl-ACP dehydratase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550502|gb|AEA97220.1| (3R)-hydroxymyristoyl-ACP dehydratase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 149

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 2/142 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  +I E++  LPHRYPFLLVD+V +    ES    KN+T NEP FMGHFPG+P+ PGV
Sbjct: 5   LNTIEIQEILELLPHRYPFLLVDRVTDYVLGESVKAYKNITINEPCFMGHFPGQPIFPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILE MAQ AG +     G +     Y   ID ARF++PV PGD+LE+ V  V+ R  +W
Sbjct: 65  LILEAMAQAAGVLGFKTMGNNDKLYLY-AGIDNARFKRPVVPGDKLEFDVALVKERRGIW 123

Query: 128 KFQCCAKVENTVVAEAE-ICAM 148
           KF+  A V+  V   AE +CAM
Sbjct: 124 KFKGTASVDGDVACCAEFMCAM 145


>gi|260655099|ref|ZP_05860587.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Jonquetella anthropi E3_33 E1]
 gi|260630210|gb|EEX48404.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Jonquetella anthropi E3_33 E1]
          Length = 154

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 94/146 (64%), Gaps = 1/146 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  +L   LPHRYPFLLVD+V+ ++  +SA  IKNVTFNEP F GHFP + VMPGVLILE
Sbjct: 3   DAEDLKSILPHRYPFLLVDRVLELEPAKSAKAIKNVTFNEPFFQGHFPQKSVMPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQTAG + A   G +  A  +L  +DKA+FRK V PGD+L   V  +R    + K   
Sbjct: 63  ALAQTAGVMLAKGFGLEG-AVSFLTGVDKAKFRKMVVPGDQLVMEVQMIRTLGRMGKVSA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKEKN 157
            AKV++ +VAEA +   ++ +  E +
Sbjct: 122 TAKVDDQMVAEAILSFALLPKSSEDD 147


>gi|217034448|ref|ZP_03439861.1| hypothetical protein HP9810_11g30 [Helicobacter pylori 98-10]
 gi|216943118|gb|EEC22592.1| hypothetical protein HP9810_11g30 [Helicobacter pylori 98-10]
 gi|315586022|gb|ADU40403.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Helicobacter pylori 35A]
 gi|317178337|dbj|BAJ56125.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori F30]
 gi|332672820|gb|AEE69637.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Helicobacter pylori 83]
          Length = 159

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 94/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++     KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANKKIAAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVVAEAELKAMI 155


>gi|317179823|dbj|BAJ57609.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter pylori F32]
          Length = 159

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 94/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 14  IEHILQILPHRYPMLLVDRITELQANKKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 73

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +    Y M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 74  MAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 133

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  V AEAE+ AM+
Sbjct: 134 QVGGTAQVDGKVAAEAELKAMI 155


>gi|255321825|ref|ZP_05362975.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter showae RM3277]
 gi|255300929|gb|EET80196.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter showae RM3277]
          Length = 148

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 96/145 (66%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIVE+ + LPHRYPFLL+D+V  ++  +  +  KNVT  EP F GHFPG P+ PGV+I+E
Sbjct: 3   DIVEIQKILPHRYPFLLIDRVTELEPAKHIVAYKNVTIGEPVFQGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  +  D++         Y MSID A+FR P+ PGDRLEY +  ++++ +
Sbjct: 63  GMAQ-AGGVLAFKSMNDEHQANIENKVVYFMSIDGAKFRHPIRPGDRLEYRLEVLKHKGN 121

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W  +  A V+ T+  EAE+ AM++
Sbjct: 122 IWVLKGEAYVDGTLSCEAELKAMIV 146


>gi|258543974|ref|ZP_05704208.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Cardiobacterium hominis ATCC 15826]
 gi|258520820|gb|EEV89679.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Cardiobacterium hominis ATCC 15826]
          Length = 159

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (62%), Gaps = 10/145 (6%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI E+ R+LPHRYPFLL+D++  ++       IKNVT NEP F GHFPG+ VMPGVL+
Sbjct: 6   AMDIEEIRRYLPHRYPFLLIDRITEVEIGSHIKAIKNVTANEPFFQGHFPGKAVMPGVLV 65

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP---------YLMSIDKARFRKPVFPGDRLEYHVNKV 120
           +E MAQ AG I  + +G  +             + + IDKARFR+ V PGD+L   +  +
Sbjct: 66  IEAMAQAAG-ILGVKSGRRELGLSDEPEEDGIYFFVGIDKARFRRTVVPGDQLHLEIKII 124

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEI 145
           R+R  +W F   A+V+ T+V EAEI
Sbjct: 125 RSRRGIWSFTAEARVDGTLVCEAEI 149


>gi|193212197|ref|YP_001998150.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobaculum parvum NCIB 8327]
 gi|193085674|gb|ACF10950.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chlorobaculum parvum NCIB 8327]
          Length = 467

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 85/142 (59%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +        + +  + M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEAVMTNMRRTVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEK 153
            A V   +V EA + A VM +K
Sbjct: 445 KAYVRGELVCEASLMATVMDKK 466


>gi|21674480|ref|NP_662545.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium tepidum TLS]
 gi|47605895|sp|Q8KBX0|LPXZ_CHLTE RecName: Full=Bifunctional enzyme lpxC/fabZ; Includes: RecName:
           Full=UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase; AltName: Full=UDP-3-O-acyl-GlcNAc
           deacetylase; Includes: RecName:
           Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|21647669|gb|AAM72887.1| UDP-3-O-3-hydroxymyristoyl N-acetylglucosamine deacetylase /
           (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Chlorobium tepidum TLS]
          Length = 467

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 85/142 (59%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLIIE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +        + +  + M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEAVMTNMRRTVCQFDA 444

Query: 132 CAKVENTVVAEAEICAMVMHEK 153
            A V   +V EA + A VM +K
Sbjct: 445 KAYVRGELVCEASLMATVMEKK 466


>gi|258406348|ref|YP_003199090.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfohalobium retbaense DSM 5692]
 gi|257798575|gb|ACV69512.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfohalobium retbaense DSM 5692]
          Length = 152

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 6/152 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M   ++ ++ +DI+ +   LPHRYPFLLVD+V+     ES   IKNVTFNEP+F GHFP 
Sbjct: 1   MSESVSVVECRDILAM---LPHRYPFLLVDRVLQYAPYESLQAIKNVTFNEPYFQGHFPD 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLM--SIDKARFRKPVFPGDRLEYHVN 118
            PVMPGVLILE +AQ AG I  + +  +       +   I+K RFR+PVFPGD+L   V 
Sbjct: 58  YPVMPGVLILEALAQ-AGGILVVKSMPEIIGSKIFLFTGIEKVRFRQPVFPGDQLHLSVE 116

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAEICAMVM 150
            VR+++++WK +  A+VE  +VA+ E  A ++
Sbjct: 117 YVRHKLNMWKMRATAQVEQRLVAQGEFNASIV 148


>gi|53803385|ref|YP_114859.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Methylococcus capsulatus str. Bath]
 gi|62286764|sp|Q604U1|FABZ_METCA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|53757146|gb|AAU91437.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Methylococcus capsulatus str. Bath]
          Length = 146

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 91/139 (65%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +  FLPHRYPFLLVD+V+  +  +  + IKNVT+NEP F GHFP  P+MPGVLI+E
Sbjct: 2   DIQAIKEFLPHRYPFLLVDRVLECEPGKRLLAIKNVTYNEPFFQGHFPRVPIMPGVLIIE 61

Query: 72  GMAQTAGAICA--IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQT G + +    +   + A  YL+ +DK RF++PV PGD+L      +R++ ++W F
Sbjct: 62  ALAQTTGLLASETAPDVLGKGATYYLVGLDKVRFKRPVVPGDQLRLEATYLRHKRNIWAF 121

Query: 130 QCCAKVENTVVAEAEI-CA 147
            C A VE   VA AEI CA
Sbjct: 122 ACRADVEGEFVASAEIMCA 140


>gi|154175396|ref|YP_001407539.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter curvus 525.92]
 gi|166233418|sp|A7GWE7|FABZ_CAMC5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|112803829|gb|EAU01173.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter curvus 525.92]
          Length = 148

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 96/145 (66%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHR+PFLL+D+V  ++  +  +  KNVT  EP F GHFPG P+ PGV+I+E
Sbjct: 3   DVVEIQKILPHRFPFLLIDRVTELEPAKHIVAYKNVTIGEPIFQGHFPGHPIYPGVMIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  +  D++         Y MSIDKA+FR PV PGDRLEY +  ++++ +
Sbjct: 63  GMAQ-AGGVLAFKSMSDEHQADIENKVVYFMSIDKAKFRHPVRPGDRLEYRLEVLKHKGN 121

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W     A ++  + AEAE+ AM++
Sbjct: 122 IWVLDGKAYIDGNLCAEAELKAMIV 146


>gi|57168393|ref|ZP_00367527.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter coli RM2228]
 gi|57020201|gb|EAL56875.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter coli RM2228]
          Length = 142

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 91/142 (64%), Gaps = 7/142 (4%)

Query: 14  VELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGM 73
           +++   LPHRYPFLLVDK+  ++  E   G KN++ ++  FMGHFPG P+ PGVLILEGM
Sbjct: 1   MKIQEILPHRYPFLLVDKITELKVGEVVRGYKNISISDHVFMGHFPGHPIYPGVLILEGM 60

Query: 74  AQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           AQT G +       D    P     Y   ID A+FR PV PGDRL+Y +  V+NR ++W 
Sbjct: 61  AQTGGVLA--FESMDAKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMQVVKNRGNMWI 118

Query: 129 FQCCAKVENTVVAEAEICAMVM 150
           F+  A V+  +VAEAE+ AM++
Sbjct: 119 FKGQAFVDGNLVAEAELKAMIV 140


>gi|256823116|ref|YP_003147079.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Kangiella
           koreensis DSM 16069]
 gi|256796655|gb|ACV27311.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Kangiella
           koreensis DSM 16069]
          Length = 156

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/148 (47%), Positives = 95/148 (64%), Gaps = 3/148 (2%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           +D+  +++ DI E+M+ LPHRYPFLLVD+VV+ +  E    IKNVT NEP F GHFP RP
Sbjct: 4   NDVTEMNSMDIYEVMKHLPHRYPFLLVDRVVDFKAGEYLKAIKNVTVNEPFFPGHFPHRP 63

Query: 63  VMPGVLILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           V PGVL+LE MAQ +G  A     +     +  Y + ID ARF+KPV PGD++   V  +
Sbjct: 64  VFPGVLMLEAMAQASGILAFKTTESLPTDDSLFYFVGIDDARFKKPVEPGDQVVMEVTVL 123

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEI-CA 147
           + + D+WKF   A V+  VV  AE+ CA
Sbjct: 124 KRKRDMWKFSAVATVDGKVVCSAELMCA 151


>gi|310816024|ref|YP_003963988.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Ketogulonicigenium vulgare Y25]
 gi|308754759|gb|ADO42688.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Ketogulonicigenium vulgare Y25]
          Length = 164

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 88/146 (60%), Gaps = 3/146 (2%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L   DI  +   LPHRYPFLLVD+V++I    SA+GIKNV+ NEPHF GHFPG P+MPG
Sbjct: 15  TLLTADIQVIQSILPHRYPFLLVDRVIDIDGTTSAVGIKNVSMNEPHFQGHFPGNPIMPG 74

Query: 67  VLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR-- 123
           V I+E MAQTA  +     G  D     Y M ID+ +FR+ V PGD+L   V  +R +  
Sbjct: 75  VTIVEAMAQTATVMVGAALGKTDNSIMVYFMGIDECKFRRKVVPGDQLRMKVTTLRGKPG 134

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +W+F+  A V+  +  E E  AM 
Sbjct: 135 GKVWRFRGEATVDGELACECEFTAMT 160


>gi|332307494|ref|YP_004435345.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174823|gb|AEE24077.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 148

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 96/151 (63%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M++++  L  ++I+EL   LPHRYPFLL+D+V +    ES    KN+TFNEP F GHFPG
Sbjct: 1   MVNNINQLGIEEILEL---LPHRYPFLLLDRVTDYTLGESITAYKNITFNEPCFTGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN 118
           +P+ PGVLILE +AQ AG +      N  D Y       IDKARF++PV PGDRL+ +V 
Sbjct: 58  KPIFPGVLILEALAQAAGVLGFKTAGNSDDLY---LYAGIDKARFKQPVVPGDRLDMNVR 114

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAE-ICAM 148
            ++ R  +WKF     V+   V EAE +CAM
Sbjct: 115 LIKERRGIWKFHGVGSVDGKDVCEAEFMCAM 145


>gi|221133304|ref|ZP_03559609.1| 3-hydroxymyristol acyl carrier protein dehydratase [Glaciecola sp.
           HTCC2999]
          Length = 148

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 94/143 (65%), Gaps = 4/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  +I E+M  LPHRYPFLLVD+V + +  +S    KN+TFNEP F GHFPG+P+ PGV
Sbjct: 5   LNTIEIREIMELLPHRYPFLLVDRVTDYELGQSIKAYKNITFNEPCFTGHFPGQPIFPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LILE +AQ AG +       ++    YL + +D ARF+KPV PGD+LE  V  V+ R  +
Sbjct: 65  LILEALAQVAGVLG--FKSMEKTDKLYLFAGVDNARFKKPVVPGDKLEMEVELVKERRGI 122

Query: 127 WKFQCCAKVENTVVAEAE-ICAM 148
           WKF+  A+V+   V  ++ +CAM
Sbjct: 123 WKFKGVARVDGDEVCSSDFMCAM 145


>gi|89054942|ref|YP_510393.1| (3R)-hydroxymyristoyl-ACP dehydratase [Jannaschia sp. CCS1]
 gi|109828931|sp|Q28PJ4|FABZ_JANSC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|88864491|gb|ABD55368.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Jannaschia sp.
           CCS1]
          Length = 161

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 89/141 (63%), Gaps = 3/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + R LPHRYPFLLVD+V +I+  +SA+G+KNVT NEPHF GHFPG P+MPGV I+E
Sbjct: 10  DIDLIQRILPHRYPFLLVDRVRDIEPFKSAVGLKNVTVNEPHFQGHFPGVPIMPGVTIVE 69

Query: 72  GMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR--VDLWK 128
            MAQTA  +  +     D+    Y M ID  +FR+ V PGD LE HV   R +    +WK
Sbjct: 70  AMAQTAAVMVGVSADLADKNFLVYFMGIDSCKFRRKVGPGDVLELHVTATRGKPGAKVWK 129

Query: 129 FQCCAKVENTVVAEAEICAMV 149
           F   A+V+  +  E    AM+
Sbjct: 130 FDGRAEVDGELACECSFTAMM 150


>gi|145579421|pdb|2GLV|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579422|pdb|2GLV|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579423|pdb|2GLV|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579424|pdb|2GLV|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579425|pdb|2GLV|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579426|pdb|2GLV|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579427|pdb|2GLV|G Chain G, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579428|pdb|2GLV|H Chain H, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579429|pdb|2GLV|I Chain I, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579430|pdb|2GLV|J Chain J, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579431|pdb|2GLV|K Chain K, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
 gi|145579432|pdb|2GLV|L Chain L, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori
          Length = 171

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 94/142 (66%), Gaps = 5/142 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+EG
Sbjct: 26  IEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEG 85

Query: 73  MAQTAGAICAIH-NGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           MAQ+ G +      GFD    +      M+IDK +FR PV PGDRLEYH+  ++++  +W
Sbjct: 86  MAQSGGFLAFTSLWGFDPEIAKTKIVAFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIW 145

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           +    A+V+  VVAEAE+ AM+
Sbjct: 146 QVGGTAQVDGKVVAEAELKAMI 167


>gi|34556514|ref|NP_906329.1| (3R)-hydroxymyristoyl-ACP dehydratase [Wolinella succinogenes DSM
           1740]
 gi|47605632|sp|Q7MAS2|FABZ_WOLSU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|34482228|emb|CAE09229.1| PUTATIVE 3R-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN [Wolinella
           succinogenes]
          Length = 151

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 98/149 (65%), Gaps = 7/149 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHR+PFLLVD+V  +  +ES    KN+T NE  F GHFP +PV PGVL++E
Sbjct: 4   DVQKIKEILPHRFPFLLVDRVTALTSEESIEAYKNITINEEVFQGHFPIKPVYPGVLVIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  + F + A        Y MSIDKA+FR PV PGD+L Y +N ++++  
Sbjct: 64  GMAQ-AGGVLAFVSMFGEEASNHDEKIVYFMSIDKAKFRVPVTPGDKLVYRLNVLKHKGS 122

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           +W  +  A V++ +VAEAE+ AMV  ++K
Sbjct: 123 IWILEGRAYVDDKLVAEAELKAMVADKEK 151


>gi|223038656|ref|ZP_03608949.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter rectus RM3267]
 gi|222880058|gb|EEF15146.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter rectus RM3267]
          Length = 148

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 94/145 (64%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIVE+ + LPHRYPFLL+D+V  ++  +  +  KNVT  EP F GHFPG P+ PGV+I+E
Sbjct: 3   DIVEIQKILPHRYPFLLIDRVTELEPAKHIVAYKNVTIGEPVFQGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  +  D +         Y MSID A+FR P+ PGDRLEY +  ++++ +
Sbjct: 63  GMAQ-AGGVLAFKSMSDAHQAGIENKVVYFMSIDGAKFRHPIRPGDRLEYRLEVLKHKGN 121

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W  +  A V+  +  EAE+ AM++
Sbjct: 122 IWVLKGEAYVDGAIACEAELKAMIV 146


>gi|313672268|ref|YP_004050379.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939024|gb|ADR18216.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 146

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 5/146 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGI-KNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI +++  LPHRYPFLLVDKV  +++DE++I   KNVT NEP FMGHFP  P+MPGVL +
Sbjct: 2   DIKKILELLPHRYPFLLVDKV--LEKDENSITAQKNVTINEPFFMGHFPSEPIMPGVLQI 59

Query: 71  EGMAQTAGAICAIH-NGFDQY-APPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E +AQ  G +C  H +G D   A  + MSID A+FRKPV PGD L   V   + + ++++
Sbjct: 60  EALAQAGGILCFDHLDGIDSSNAEIFFMSIDNAKFRKPVIPGDILTLKVELTKKKGNIFR 119

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
            +    V+  +V EAE  AMV  + +
Sbjct: 120 LRGVVLVDGNIVTEAEFMAMVRKKSR 145


>gi|116625257|ref|YP_827413.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|122252400|sp|Q01T92|FABZ_SOLUE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|116228419|gb|ABJ87128.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 162

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 96/145 (66%), Gaps = 4/145 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+   LPHRYPFLLVD+++ ++ D   +GIKNVTFNEP F GHFP  PVMPGV+I+E
Sbjct: 5   DINEIRAILPHRYPFLLVDRILEMETDR-IVGIKNVTFNEPQFTGHFPDFPVMPGVMIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQTAG +  +H+  D+     L+ +I+ ARFRKPV PGD L   +  ++ +  + K  
Sbjct: 64  AMAQTAG-VLVLHSMPDRANKLVLLVAIENARFRKPVVPGDTLRMEMKIIKRKASVAKMA 122

Query: 131 CCAKVENTVVAEAEI-CAMVMHEKK 154
             A V+  VVAEAE+ C +   E+K
Sbjct: 123 GIATVDGVVVAEAEVMCKLADKEEK 147


>gi|109897585|ref|YP_660840.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudoalteromonas atlantica T6c]
 gi|123171511|sp|Q15WF2|FABZ_PSEA6 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|109699866|gb|ABG39786.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Pseudoalteromonas
           atlantica T6c]
          Length = 148

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 94/151 (62%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M++++  L  ++I+EL   LPHRYPFLL+D+V +    ES    KN+TFNEP F GHFPG
Sbjct: 1   MVNNINQLGIEEILEL---LPHRYPFLLLDRVTDYTLGESITAYKNITFNEPCFTGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN 118
           +P+ PGVLILE +AQ AG +      N  D Y       IDKARF+ PV PGDRL+  V 
Sbjct: 58  KPIFPGVLILEALAQAAGVLGFKTAGNSDDLY---LYAGIDKARFKHPVVPGDRLDMDVR 114

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAE-ICAM 148
            ++ R  +WKF     V+   V EAE +CAM
Sbjct: 115 LIKERRGIWKFHGVGSVDGKAVCEAEFMCAM 145


>gi|315453103|ref|YP_004073373.1| hydroxymyristoyl-(acyl-carrier protein)dehydratase [Helicobacter
           felis ATCC 49179]
 gi|315132155|emb|CBY82783.1| hydroxymyristoyl-(acyl-carrier protein)dehydratase [Helicobacter
           felis ATCC 49179]
          Length = 165

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 97/158 (61%), Gaps = 5/158 (3%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
           C+   DI  + + LPHRYPFLLVD+VV ++  +     KN+T+NE  F GHFP +P+ PG
Sbjct: 4   CVLEMDIHAIAQILPHRYPFLLVDRVVRLETYKQVHAYKNITYNEEVFTGHFPSKPIYPG 63

Query: 67  VLILEGMAQTAG-----AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           VLI+EGMAQ  G     ++  +     Q    Y M+ID  +FR PV PGD+L YH+  ++
Sbjct: 64  VLIVEGMAQAGGLLAFVSLFGVSPEIAQTKLVYFMTIDSVKFRNPVIPGDQLHYHLEVLK 123

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNES 159
            +  +W+    A+V + ++AEAE+ AM++ ++  K  S
Sbjct: 124 YKGMIWQVGGTARVNDKIMAEAELKAMIVDKESGKRNS 161


>gi|229597707|pdb|3D6X|A Chain A, Crystal Structure Of Campylobacter Jejuni Fabz
 gi|229597708|pdb|3D6X|B Chain B, Crystal Structure Of Campylobacter Jejuni Fabz
 gi|229597709|pdb|3D6X|C Chain C, Crystal Structure Of Campylobacter Jejuni Fabz
 gi|229597710|pdb|3D6X|D Chain D, Crystal Structure Of Campylobacter Jejuni Fabz
 gi|229597711|pdb|3D6X|E Chain E, Crystal Structure Of Campylobacter Jejuni Fabz
 gi|229597712|pdb|3D6X|F Chain F, Crystal Structure Of Campylobacter Jejuni Fabz
          Length = 146

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 92/143 (64%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYPFLLVDK+  ++  E  +G KN++ ++  F GHFPG P+ PGVLILE
Sbjct: 3   DVXQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVFXGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           G AQT G + A  +  D+  P     Y   ID A+FR PV PGDRL+Y  + V+NR + W
Sbjct: 63  GXAQT-GGVLAFESXEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEXSVVKNRGNXW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
            F+  A V+  +VAEAE+ A ++
Sbjct: 122 IFKGQAFVDGNLVAEAELKAXIV 144


>gi|190359398|sp|A0RMT3|FABZ_CAMFF RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 148

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 95/145 (65%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHRYPFLL+D+V  ++  +S    KN+T  E  F GHFPG P+ PGV+I+E
Sbjct: 3   DVVEIQKILPHRYPFLLIDRVCELETGKSVYAYKNITIAEQIFEGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG I A  +  D           Y MSID+A+FR PV PGD+LEY +  ++++ +
Sbjct: 63  GMAQ-AGGILAFKSAEDPSGLSIENKVVYFMSIDRAKFRNPVKPGDKLEYRLEVLKHKGN 121

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W     A V++ +VAEAE+ AM++
Sbjct: 122 VWVLDGKAYVDDKLVAEAELKAMIV 146


>gi|239992969|ref|ZP_04713493.1| (3R)-hydroxymyristoyl-ACP dehydratase [Alteromonas macleodii ATCC
           27126]
          Length = 149

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 90/142 (63%), Gaps = 2/142 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  +I E++  LPHRYPFLLVD+V +    ES    KN+T NEP FMGHFP +P+ PGV
Sbjct: 5   LNTIEIQEILELLPHRYPFLLVDRVTDYVLGESVKAYKNITINEPCFMGHFPEQPIFPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LILE MAQ AG +     G +     Y   ID ARF++PV PGDRLE+ V  V+ R  +W
Sbjct: 65  LILEAMAQAAGVLGFKTMGNNDKLYLY-AGIDNARFKRPVVPGDRLEFDVALVKERRGIW 123

Query: 128 KFQCCAKVENTVVAEAE-ICAM 148
           KF+  A V+  +   AE +CAM
Sbjct: 124 KFKGTASVDGDIACVAEFMCAM 145


>gi|298529240|ref|ZP_07016643.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298510676|gb|EFI34579.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 155

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 91/144 (63%), Gaps = 1/144 (0%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I +++ FLPHRYPFLLVD+VV ++  +S   +KNVT NEP F GHFP  PVMPGVLILE 
Sbjct: 11  IQDILNFLPHRYPFLLVDRVVQLEPFKSLKALKNVTINEPFFQGHFPDYPVMPGVLILES 70

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           +AQ  G + A           +L + +DK RFRKPVFPGD L  H+   R+R++LW+   
Sbjct: 71  LAQAGGLLVAGSVPDQMQGKIFLFTGVDKVRFRKPVFPGDSLYMHITYDRHRMNLWRMHG 130

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V++ V AE    A ++  + +
Sbjct: 131 QAVVQDRVAAEGMFSATIVDREDQ 154


>gi|312142803|ref|YP_003994249.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Halanaerobium sp. 'sapolanicus']
 gi|311903454|gb|ADQ13895.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Halanaerobium sp. 'sapolanicus']
          Length = 149

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 89/140 (63%), Gaps = 4/140 (2%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  DI  +   LPHRYP LLVDK+  + + ES +GIKNVT NE  F+GH+P RP+MPGVL
Sbjct: 6   DIIDINTIRSILPHRYPLLLVDKIEEMTKGESILGIKNVTINEEFFLGHYPERPIMPGVL 65

Query: 69  ILEGMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           I+E MAQ AG +  I+  FD      P   SIDKA+FR PV PGD+L   V  VR R  +
Sbjct: 66  IIEAMAQVAGIL--IYYSFDDMEDKLPIFTSIDKAKFRNPVVPGDQLNIKVEIVRLRKRI 123

Query: 127 WKFQCCAKVENTVVAEAEIC 146
            K +  A V++ + AEA++ 
Sbjct: 124 SKVKAAAYVDDQIAAEAQMM 143


>gi|288941769|ref|YP_003444009.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Allochromatium vinosum DSM 180]
 gi|288897141|gb|ADC62977.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Allochromatium vinosum DSM 180]
          Length = 170

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 92/136 (67%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYPFLLVDKV++ + +E    +KNVTFNEP F GHFP RPVMPGVLI+E
Sbjct: 26  DIHKVLSLLPHRYPFLLVDKVIDYKVNEYLTALKNVTFNEPFFTGHFPVRPVMPGVLIVE 85

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G  A+ +  +   + +  Y + IDKARF++PV PGD+L   V     R  +WKF
Sbjct: 86  AMAQATGLLAMASRPDLVGEKSLYYFVGIDKARFKRPVEPGDQLVMEVRLGPVRRGIWKF 145

Query: 130 QCCAKVENTVVAEAEI 145
              A+V++ VVA AEI
Sbjct: 146 DGEARVDDKVVATAEI 161


>gi|189423832|ref|YP_001951009.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacter lovleyi SZ]
 gi|189420091|gb|ACD94489.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Geobacter
           lovleyi SZ]
          Length = 150

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 89/137 (64%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +M+ LPHR+PFLLVD++V ++  +  +GIKNV+ NEP F GHFPG PVMPGVLI+E
Sbjct: 8   DVNAIMKILPHRFPFLLVDRIVELEHGKRCVGIKNVSINEPFFPGHFPGHPVMPGVLIVE 67

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  + +  +      Y M+ID A+FRKPV PGD+L   +    NR  +W   
Sbjct: 68  AMAQVAGIMAYLASDDETRKKVSYFMAIDSAKFRKPVMPGDQLRIEITTTMNRRGIWGVD 127

Query: 131 CCAKVENTVVAEAEICA 147
             A V++ +V EA + A
Sbjct: 128 GKAFVDDKLVTEASLKA 144


>gi|237752787|ref|ZP_04583267.1| 3R-hydroxymyristoyl ACP dehydrase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376276|gb|EEO26367.1| 3R-hydroxymyristoyl ACP dehydrase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 154

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 94/152 (61%), Gaps = 9/152 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYP LLVD++  I  + S  G KNVT NE  F GHFP +P+ PGV I+E
Sbjct: 4   DVQKIREILPHRYPLLLVDRITAITPNVSIEGYKNVTINEDVFNGHFPVQPIYPGVYIIE 63

Query: 72  GMAQTAGAICAI-------HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GMAQT G +  +       +N  D+    Y MSIDKA+FR PV PGDRL Y +  ++ + 
Sbjct: 64  GMAQTGGVLAFVSMFGENANNNGDKIV--YFMSIDKAKFRNPVVPGDRLTYKLEVIKQKG 121

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKKEK 156
            +W  Q  A V+  +VAEAE+ AMV+   ++K
Sbjct: 122 GIWVLQGYAYVDEKLVAEAELKAMVVDNAEKK 153


>gi|119946586|ref|YP_944266.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Psychromonas ingrahamii 37]
 gi|158513121|sp|A1SYV2|FABZ_PSYIN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|119865190|gb|ABM04667.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Psychromonas
           ingrahamii 37]
          Length = 150

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 15/154 (9%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E+M  LPHRYPFLLVD+V++    +   GIKN++FNEP F GHFP  P+ PGV
Sbjct: 5   LNSLDIKEIMDLLPHRYPFLLVDRVLDYVPGKRLHGIKNISFNEPQFTGHFPDTPIYPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVR 121
           +ILE +AQ  G +      F  Y  P      +L S+DK RFR+PV PGD L+  V  ++
Sbjct: 65  MILESLAQATGVL-----AFATYGKPAVNELYFLASMDKVRFRRPVIPGDVLDLEVIYLK 119

Query: 122 NRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           +R  + KF+C AKV+  V  E    AM+M  ++E
Sbjct: 120 DRRGMGKFECVAKVDGQVACE----AMIMCARRE 149


>gi|118475594|ref|YP_891516.1| (3R)-hydroxymyristoyl-ACP dehydratase [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414820|gb|ABK83240.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter fetus subsp. fetus 82-40]
          Length = 162

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 96/145 (66%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHRYPFLL+D+V  ++  +S    KN+T  E  F GHFPG P+ PGV+I+E
Sbjct: 17  DVVEIQKILPHRYPFLLIDRVCELETGKSVYAYKNITIAEQIFEGHFPGHPIYPGVMIIE 76

Query: 72  GMAQTAGAICAIHNGFD------QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG I A  +  D      +    Y MSID+A+FR PV PGD+LEY +  ++++ +
Sbjct: 77  GMAQ-AGGILAFKSAEDPSGLSIENKVVYFMSIDRAKFRNPVKPGDKLEYRLEVLKHKGN 135

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W     A V++ +VAEAE+ AM++
Sbjct: 136 VWVLDGKAYVDDKLVAEAELKAMIV 160


>gi|251771050|gb|EES51634.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptospirillum ferrodiazotrophum]
          Length = 149

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 89/140 (63%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPFLLVD+V+ ++ +   + IKNVT NEP F GHFPG P+MPGVL++E
Sbjct: 5   EIGEILSILPHRYPFLLVDRVLEVEPNHRIVAIKNVTINEPFFQGHFPGTPMMPGVLLVE 64

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G  AIC+     D    P+ + ID ARFR+PV PGD+L   +  ++ R   W+ 
Sbjct: 65  AMAQVGGILAICSGQEKEDHI--PFFLGIDDARFRRPVLPGDQLRITMTTLKVRGSSWRM 122

Query: 130 QCCAKVENTVVAEAEICAMV 149
                V + +V EA + AM+
Sbjct: 123 AGTVHVADQLVCEATLLAMI 142


>gi|288572987|ref|ZP_06391344.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568728|gb|EFC90285.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 91/139 (65%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRD-ESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI ++M FLPHRYPFLLVD++  ++ D E  +G+KNVT NEP FMGHFPG PVMPGVLI+
Sbjct: 3   DINKIMEFLPHRYPFLLVDRI--LESDLERVVGLKNVTINEPFFMGHFPGEPVMPGVLII 60

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E M QT GA+  +     +    YL S+ KARFR+PV PGD+L       R R  + K  
Sbjct: 61  EAMGQT-GAVVLLSKPEFEGKVVYLTSVVKARFRRPVRPGDQLITTATLTRLRGKVGKVS 119

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV   VVAEAE+  +V
Sbjct: 120 TVAKVGGDVVAEAELGFVV 138


>gi|322379410|ref|ZP_08053780.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter suis HS1]
 gi|322380888|ref|ZP_08054967.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter suis HS5]
 gi|321146692|gb|EFX41513.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter suis HS5]
 gi|321148119|gb|EFX42649.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter suis HS1]
          Length = 163

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 5/153 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLLVD++V+++  +     KN+T+NE  F GHFP RP+ PGVLI+E
Sbjct: 9   DIHMISQILPHRYPFLLVDRIVHLEPYKEVHAFKNITYNEEVFTGHFPSRPIYPGVLIVE 68

Query: 72  GMAQTAG--AICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ  G  A  ++     + A     Y M+ID+ +FR PV PGD+L YH++  ++R  +
Sbjct: 69  GMAQAGGLLAFISLFGVSPEVAATKLVYFMTIDRVKFRNPVIPGDQLHYHLSAQKHRGMI 128

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEKKEKNES 159
           W+    AKV   +VAEAE+ AM++  +    E+
Sbjct: 129 WQVGGVAKVAEKIVAEAELKAMIVDREANNREA 161


>gi|193215648|ref|YP_001996847.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chloroherpeton thalassium ATCC 35110]
 gi|193089125|gb|ACF14400.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chloroherpeton thalassium ATCC 35110]
          Length = 474

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 88/141 (62%), Gaps = 4/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D   + R +PHRYPFLL+DK+V  + DE  +G+KNVT NEP F GHFPG P+MPGVLILE
Sbjct: 325 DSQAIARIIPHRYPFLLIDKIVEFELDERIVGVKNVTINEPFFQGHFPGNPIMPGVLILE 384

Query: 72  GMAQTAGAICAIHN-GF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ+ G +    N GF D+    + M IDKARFRKPV PGD L         R ++  F
Sbjct: 385 AMAQSGGIMLLNGNEGFHDKLV--FFMGIDKARFRKPVVPGDTLTIESIMKNRRRNVCMF 442

Query: 130 QCCAKVENTVVAEAEICAMVM 150
              A V   +V EAE+ A V+
Sbjct: 443 SSKAYVRGELVCEAELMATVI 463


>gi|292492498|ref|YP_003527937.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosococcus halophilus Nc4]
 gi|291581093|gb|ADE15550.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosococcus halophilus Nc4]
          Length = 149

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D  DI E+++ LPHRYPFLL+D+++     +S + IKNV++NEP+F GHFP  PVMPGV
Sbjct: 1   MDTLDIHEILKHLPHRYPFLLIDRIIECTPGKSLVAIKNVSYNEPYFQGHFPEMPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE +AQ  G +          Q A  Y   ID+ARF++PV PGD++   V  VR+   
Sbjct: 61  LILESLAQATGILAFKTQATLPSQEAIYYFAGIDRARFKRPVEPGDQMRLEVELVRSLRR 120

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           LWKF     V+ ++VA A++
Sbjct: 121 LWKFTGKVTVDGSLVASADV 140


>gi|225024876|ref|ZP_03714068.1| hypothetical protein EIKCOROL_01764 [Eikenella corrodens ATCC
           23834]
 gi|224942356|gb|EEG23565.1| hypothetical protein EIKCOROL_01764 [Eikenella corrodens ATCC
           23834]
          Length = 154

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 93/138 (67%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  L R LPHRYPFLL+D+V+  ++++S   IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 11  DVRTLQRLLPHRYPFLLLDRVIGFEKEKSLTAIKNVSVNEPFFQGHFPEFPVMPGVLIIE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPPY-LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +  +  G  +    Y  + ID+ARF++ V PGD+++ H++ + ++ D+ KF+
Sbjct: 71  AMAQAAGVLAILSRGERKENEIYFFVGIDEARFKRQVVPGDQVQIHLDVITHKRDIGKFK 130

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  + AEA I CA
Sbjct: 131 ATATVDGQIAAEAVIMCA 148


>gi|237750427|ref|ZP_04580907.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Helicobacter
           bilis ATCC 43879]
 gi|229373957|gb|EEO24348.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Helicobacter
           bilis ATCC 43879]
          Length = 162

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 5/150 (3%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           L   +  +I ++M+ LPHRYP LLVD+V+++   +     KNVT NE  F+GHFP  P+ 
Sbjct: 7   LQTYENLNIDKIMQVLPHRYPMLLVDRVLSLNPHKEIKAYKNVTINEEVFLGHFPKEPIY 66

Query: 65  PGVLILEGMAQTAGAICAIHN-GFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNK 119
           PGV+I+EGMAQ  G +  +   G D  A      Y M+ID  +FR PV PGDRL YH+  
Sbjct: 67  PGVMIIEGMAQAGGILAFVSTWGLDFDASKDKIVYFMTIDNVKFRVPVRPGDRLTYHMEV 126

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMV 149
           ++ R ++W+ Q  A V++++V+EAE+ AMV
Sbjct: 127 MKQRSNVWQLQGRAYVDDSLVSEAELKAMV 156


>gi|224372107|ref|YP_002606479.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Nautilia
           profundicola AmH]
 gi|223589077|gb|ACM92813.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Nautilia
           profundicola AmH]
          Length = 146

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD++ +++  E   G  N++     F GHFPG P+ PGVLI+E
Sbjct: 4   DINQIQEMLPHRYPFLLVDRITDVKEGEYVEGYLNISITNQVFQGHFPGHPIYPGVLIIE 63

Query: 72  GMAQTAG----AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQT       + +     D+    Y MSIDKA+FRKPV PGD+L Y ++ +++R  +W
Sbjct: 64  GMAQTGAILPFTVMSKEELNDKVV--YFMSIDKAKFRKPVLPGDKLVYKISTIKHRGKIW 121

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
           + +  A V+  +V+EAE+ AM+M
Sbjct: 122 QLKGEAYVDGELVSEAELKAMIM 144


>gi|300704220|ref|YP_003745823.1| (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Ralstonia
           solanacearum CFBP2957]
 gi|299071884|emb|CBJ43213.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Ralstonia
           solanacearum CFBP2957]
          Length = 164

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (65%), Gaps = 5/151 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V+ ++  +    IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 16  NIKKILELLPHRYPILLVDRVLELEPRKRIKAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 75

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +    +    Q    YL +SID ARF++ V PGD+L  +   +R++  +WKF
Sbjct: 76  ALAQTAALLTFGESDHKRQENQLYLFVSIDGARFKRQVTPGDQLVLNAELLRSKSGMWKF 135

Query: 130 QCCAKVENTVVAEAEI-CAMVMHEKKEKNES 159
           +  A V+N V AEAEI CA  + E K K E+
Sbjct: 136 KVFATVDNEVAAEAEIMCA--VREDKSKGEA 164


>gi|171463282|ref|YP_001797395.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|226700248|sp|B1XTV4|FABZ_POLNS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|171192820|gb|ACB43781.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 149

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI ++++ LPHRYPFLLVD+V+ I   ES   +KNVT NEP F GHFPG P+MPGVLI
Sbjct: 6   AIDINKILKLLPHRYPFLLVDRVLEISPRESITALKNVTMNEPFFQGHFPGFPMMPGVLI 65

Query: 70  LEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           +E +AQTA A+    +   + A  Y   ID ARF+KPV PGD+L       R+R  ++KF
Sbjct: 66  IEALAQTA-ALLTFSDERAEDAIYYFAGIDGARFKKPVLPGDQLIMTAKLERDRAGIYKF 124

Query: 130 QCCAKVENTVVAEAEI-CAM 148
              A  +  + AEA I CA+
Sbjct: 125 AVQATADGEIAAEANITCAV 144


>gi|89068196|ref|ZP_01155606.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanicola granulosus HTCC2516]
 gi|89046113|gb|EAR52171.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Oceanicola granulosus HTCC2516]
          Length = 156

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 89/151 (58%), Gaps = 3/151 (1%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           ++D       DI  +   LPHRYPFLLVD+VV I   ++A GIKNV+ NEPHF GHFPG 
Sbjct: 1   MTDSPAPTEADIHLIQAILPHRYPFLLVDRVVQIDGIKTARGIKNVSMNEPHFQGHFPGN 60

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQ-YAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           PVMPGV I+E MAQTA  +     G  +     Y M ID  +FR+ V PGD+L   +   
Sbjct: 61  PVMPGVTIVEAMAQTAAVMVGTSLGLTEGNLRVYFMGIDGCKFRRKVVPGDQLLLDLETT 120

Query: 121 RNRVD--LWKFQCCAKVENTVVAEAEICAMV 149
           R R    +WKF   A V+  + AEAE  AM+
Sbjct: 121 RGRPGGKVWKFAGRATVDGELAAEAEFTAMM 151


>gi|332980875|ref|YP_004462316.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Mahella
           australiensis 50-1 BON]
 gi|332698553|gb|AEE95494.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Mahella
           australiensis 50-1 BON]
          Length = 144

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 90/135 (66%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD+++ ++  + A+GIKNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 2   DIKDIQNILPHRYPFLLVDRILEVEDGKKAVGIKNVTVNEPFFQGHFPGNPIMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  ++   ++        IDKARFR+PV PGD+L   V  V+ +  + K + 
Sbjct: 62  AMAQV-GAVAVLNMEENKNKLAMFAGIDKARFRRPVVPGDQLRMEVELVKVKGSIGKGKG 120

Query: 132 CAKVENTVVAEAEIC 146
            A V + +VAEAE+ 
Sbjct: 121 MAYVADELVAEAELM 135


>gi|224418549|ref|ZP_03656555.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter canadensis MIT
           98-5491]
 gi|253826899|ref|ZP_04869784.1| (3R)-hydroxymyristoyl ACP dehydratase [Helicobacter canadensis MIT
           98-5491]
 gi|313142077|ref|ZP_07804270.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter canadensis MIT 98-5491]
 gi|253510305|gb|EES88964.1| (3R)-hydroxymyristoyl ACP dehydratase [Helicobacter canadensis MIT
           98-5491]
 gi|313131108|gb|EFR48725.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter canadensis MIT 98-5491]
          Length = 156

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 7/150 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYP LLVD++ +I  +++    KN+T NE  F GHFP +P+ PGV I+E
Sbjct: 4   DVQKIREILPHRYPLLLVDRITSITPNQTIEAYKNITINEEVFNGHFPVQPIYPGVYIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  + F + +        Y MSIDKA+FR PV PGD+L Y +  ++ +  
Sbjct: 64  GMAQ-AGGVLAFMSMFGEDSSNNGDKIVYFMSIDKAKFRNPVTPGDKLTYKLEVIKQKGG 122

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           +W  Q  A VE  +VAEAE+ AM++ + KE
Sbjct: 123 IWVLQGYAYVEEKLVAEAELKAMIVDKNKE 152


>gi|71907383|ref|YP_284970.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Dechloromonas
           aromatica RCB]
 gi|91206629|sp|Q47F81|FABZ_DECAR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|71847004|gb|AAZ46500.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Dechloromonas
           aromatica RCB]
          Length = 144

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/141 (47%), Positives = 91/141 (64%), Gaps = 7/141 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+E++  LPHRYPFLLVD+V+ I+  +S    KNVT NEP F+GHFP  PVMPGVLI+E
Sbjct: 2   DIIEILEHLPHRYPFLLVDRVLEIEPGKSIHAYKNVTINEPFFVGHFPHHPVMPGVLIME 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ AG +       D+   P    Y   ID+ARF+KPV PGD+L  H+   R    +W
Sbjct: 62  ALAQAAGILS--FKSMDEKPSPDTVFYFAGIDEARFKKPVMPGDQLHLHIEIERQMRGVW 119

Query: 128 KFQCCAKVENTVVAEAEI-CA 147
           K++  A+V+  + A A++ CA
Sbjct: 120 KYKAEARVDGQLAASAKLMCA 140


>gi|58584313|ref|YP_197886.1| (3R)-hydroxymyristoyl-ACP dehydratase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75498140|sp|Q5GTN0|FABZ_WOLTR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|58418629|gb|AAW70644.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 146

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 91/143 (63%), Gaps = 4/143 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLLVD+V+     +S   IKNVTFNEP F+GHFP  P+MPGVLI+E
Sbjct: 4   NISDIIKILPHSYPFLLVDRVIECDPSKSIKAIKNVTFNEPFFIGHFPNHPIMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            +AQ A AIC +  G          YLMSI+ A+FRKPV PGD L    +    R+ + K
Sbjct: 64  SLAQ-ASAICILGKGSKSTMENKVVYLMSIENAKFRKPVTPGDTLILQADFKNARLSVCK 122

Query: 129 FQCCAKVENTVVAEAEICAMVMH 151
           F+C A V    VAEA I AM+ +
Sbjct: 123 FECFAYVGEEKVAEATILAMLQN 145


>gi|329850627|ref|ZP_08265472.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ
           [Asticcacaulis biprosthecum C19]
 gi|328840942|gb|EGF90513.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ
           [Asticcacaulis biprosthecum C19]
          Length = 168

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 93/146 (63%), Gaps = 1/146 (0%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A D  E+++ +PHRYPFLL+D+  N  +++S  GIKNVTFNEP F GHFP  PVMPGVL+
Sbjct: 23  AVDYAEILKRIPHRYPFLLIDRGENWVKNKSMTGIKNVTFNEPFFTGHFPENPVMPGVLL 82

Query: 70  LEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           +E M QT   + +     + +    + MS+D  RFR PV PGD +   V  VR+R D++K
Sbjct: 83  IEAMGQTGAVLMSKSLDVEVEGKTIFFMSVDGVRFRSPVRPGDVVRMPVEVVRHRGDVFK 142

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
           F+  A V + +V EAE  AMV+   K
Sbjct: 143 FRGEAYVGDKIVCEAEFAAMVVESPK 168


>gi|83749787|ref|ZP_00946761.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Ralstonia
           solanacearum UW551]
 gi|207723365|ref|YP_002253764.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3r)-hydroxymyristoyl acp dehydrase) [Ralstonia
           solanacearum MolK2]
 gi|207743233|ref|YP_002259625.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3r)-hydroxymyristoyl acp dehydrase) [Ralstonia
           solanacearum IPO1609]
 gi|83723544|gb|EAP70748.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Ralstonia
           solanacearum UW551]
 gi|206588564|emb|CAQ35527.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3r)-hydroxymyristoyl acp dehydrase) [Ralstonia
           solanacearum MolK2]
 gi|206594630|emb|CAQ61557.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3r)-hydroxymyristoyl acp dehydrase) [Ralstonia
           solanacearum IPO1609]
          Length = 164

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 98/151 (64%), Gaps = 5/151 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V+ ++  +    IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 16  NIKKILELLPHRYPILLVDRVLELEPRKRIKAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 75

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +    +    Q    YL  SID ARF++ V PGD+L  +   +R++  +WKF
Sbjct: 76  ALAQTAALLTFGESDHKRQENQLYLFASIDGARFKRQVTPGDQLVLNAELLRSKSGMWKF 135

Query: 130 QCCAKVENTVVAEAEI-CAMVMHEKKEKNES 159
           +  A V+N + AEAEI CA  + E K K E+
Sbjct: 136 KVFATVDNEIAAEAEIMCA--VREDKSKGEA 164


>gi|320353428|ref|YP_004194767.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Desulfobulbus
           propionicus DSM 2032]
 gi|320121930|gb|ADW17476.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Desulfobulbus
           propionicus DSM 2032]
          Length = 151

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 87/136 (63%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYPFLLVD++V +++ ++  G+KNVT NEP F GHFPG PVMPGVLILE
Sbjct: 13  DIKGIMEILPHRYPFLLVDRIVELEKGKTITGVKNVTMNEPFFQGHFPGEPVMPGVLILE 72

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +  + +        Y   +DKARFR+ V PGD+L   +  ++ +  + K   
Sbjct: 73  AMAQTGGILACLSDADMIGRLVYFAGVDKARFRRVVRPGDQLVMKLEMIKQKGKVTKMAG 132

Query: 132 CAKVENTVVAEAEICA 147
            A V++ +  EAE+ A
Sbjct: 133 KAYVDDQLATEAELMA 148


>gi|291278540|ref|YP_003495375.1| 3R-hydroxymyristoyl ACP dehydrase [Deferribacter desulfuricans
           SSM1]
 gi|290753242|dbj|BAI79619.1| 3R-hydroxymyristoyl ACP dehydrase [Deferribacter desulfuricans
           SSM1]
          Length = 142

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 93/141 (65%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLLVD+V+ +  +E+   +KNVT NE  F+GHFP  PVMPGVLI+E
Sbjct: 2   DINMIKDILPHRYPFLLVDRVLEMD-NETIKALKNVTMNEEFFLGHFPENPVMPGVLIIE 60

Query: 72  GMAQTAGAICAIHNGFDQY---APPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            +AQ AG I A     ++    A  Y M+ID A+FRKPV PGD+L   V+ V+ + D+WK
Sbjct: 61  ALAQ-AGGILAFQFYSEEEKKNAKVYFMAIDNAKFRKPVIPGDQLMLEVSVVKRKKDVWK 119

Query: 129 FQCCAKVENTVVAEAEICAMV 149
            +  AKV+  VV EAE  AMV
Sbjct: 120 LKGEAKVDGAVVCEAEFMAMV 140


>gi|24373208|ref|NP_717251.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella oneidensis MR-1]
 gi|33516896|sp|Q8EGG4|FABZ_SHEON RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|24347429|gb|AAN54695.1|AE015609_14 (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella oneidensis MR-1]
          Length = 154

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 91/145 (62%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   MNTMDITEILKYLPHRYPFLLIDRVLDFTPGESLHAIKNVTINEPFFQGHFPIQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A     D   PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 65  LILEAMAQATG-LLAFKTMSDDVPPPGVLYYFAGIDNARFRRVVEPGDQIHFEVKMIKER 123

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   AKV+  VV  AEI CA
Sbjct: 124 RGIGVFYGEAKVDGEVVCSAEIMCA 148


>gi|189499519|ref|YP_001958989.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Chlorobium phaeobacteroides BS1]
 gi|189494960|gb|ACE03508.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chlorobium phaeobacteroides BS1]
          Length = 467

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLL+DK+V  + D+  + IKNVT NE  F GHFPG P+MPGVLI+E
Sbjct: 325 DINAIQKILPHRYPFLLIDKIVEFKLDDKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIVE 384

Query: 72  GMAQTAGAICAIHNGFDQYA--PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQT G +  + NG D       Y M IDKARFRKPV PGD L         R  + +F
Sbjct: 385 AMAQTGGIM--MLNGNDNIGNMQVYFMGIDKARFRKPVIPGDTLVIEAVMKSRRRSVCQF 442

Query: 130 QCCAKVENTVVAEAEICAMVMHEK 153
              A V   +V EA + A V+ +K
Sbjct: 443 DAKAYVRGDLVCEASLMATVVEKK 466


>gi|120555448|ref|YP_959799.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Marinobacter aquaeolei VT8]
 gi|158513049|sp|A1U3P3|FABZ_MARAV RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|120325297|gb|ABM19612.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Marinobacter
           aquaeolei VT8]
          Length = 145

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 84/137 (61%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++ +LPHRYPFLLVD+V  +++ +S  G KNV+FNEP F GHFP  P+MPGVLI+E 
Sbjct: 4   IDEILEYLPHRYPFLLVDRVTEVEKGKSIKGYKNVSFNEPFFTGHFPDNPIMPGVLIIEA 63

Query: 73  MAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           MAQ +G      +          YL    KARF++PV PGDRL+     +  +  +WKF 
Sbjct: 64  MAQLSGILGFVTVERKPSDGVVQYLAGSSKARFKRPVLPGDRLDMESEFISGKRGIWKFD 123

Query: 131 CCAKVENTVVAEAEICA 147
           C A V+  VV  AEI  
Sbjct: 124 CRALVDGEVVCVAEILT 140


>gi|206602501|gb|EDZ38982.1| Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase (FabZ)
           [Leptospirillum sp. Group II '5-way CG']
          Length = 173

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 90/139 (64%), Gaps = 2/139 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPFLLVD+++ ++  +  +G+KNVT NEP F+GHFPG P+MPGVL++E
Sbjct: 18  NIQEILDILPHRYPFLLVDRILEVEPGKRIVGVKNVTINEPFFVGHFPGFPIMPGVLLIE 77

Query: 72  GMAQTAGAICAIHNGFDQYA-PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G I AI +G ++    PY M ID+ARFR P  PGD L   +     R   WK +
Sbjct: 78  AMAQ-VGGILAICSGQEKTGCIPYFMGIDRARFRHPAGPGDTLVITLTTRNVRGSSWKME 136

Query: 131 CCAKVENTVVAEAEICAMV 149
              +V    + EAEI AM+
Sbjct: 137 GEIRVGEKRICEAEIMAMI 155


>gi|190359491|sp|A0KZ12|FABZ_SHESA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 154

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 91/145 (62%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   MNTMDITEILKYLPHRYPFLLIDRVLDYTPGESLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A     D   PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 65  LILEAMAQATG-LLAFKTMSDDVPPPGVLYYFAGIDNARFRRVVEPGDQIHFEVKMIKER 123

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   AKV+  VV  AEI CA
Sbjct: 124 RGIGVFYGEAKVDGEVVCSAEIMCA 148


>gi|117921245|ref|YP_870437.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella sp. ANA-3]
 gi|117613577|gb|ABK49031.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella sp.
           ANA-3]
          Length = 150

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 91/145 (62%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 1   MNTMDITEILKYLPHRYPFLLIDRVLDYTPGESLHAIKNVTINEPFFQGHFPVQPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A     D   PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 61  LILEAMAQATG-LLAFKTMSDDVPPPGVLYYFAGIDNARFRRVVEPGDQIHFEVKMIKER 119

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   AKV+  VV  AEI CA
Sbjct: 120 RGIGVFYGEAKVDGEVVCSAEIMCA 144


>gi|326794446|ref|YP_004312266.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Marinomonas mediterranea MMB-1]
 gi|326545210|gb|ADZ90430.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Marinomonas mediterranea MMB-1]
          Length = 145

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+ R+LPHRYPFLLVD+V  +  ++S +  KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   DVNEIRRYLPHRYPFLLVDRVTELNLNDSIVAYKNVTVNEPFFNGHFPDHPVMPGVLIIE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +    +    +  +  Y +  D  RF++PV PGDRL+     V  R  +WKF
Sbjct: 63  AMAQAAGVLGFKTMDKTPEDGSIYYFVGADNTRFKRPVVPGDRLQLEAKIVTERRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
           +C A VE  +   A I CA
Sbjct: 123 ECKATVEGELACSATILCA 141


>gi|299067470|emb|CBJ38669.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Ralstonia
           solanacearum CMR15]
          Length = 164

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 94/146 (64%), Gaps = 2/146 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V+ ++  +    IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 16  NIKKILELLPHRYPMLLVDRVLEMEPGKRIKAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 75

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +     N   Q    YL +SID ARF++ V PGD+L  +   +R++  +WKF
Sbjct: 76  ALAQTAALLTFGESNHKRQENQLYLFVSIDGARFKRQVTPGDQLVLNAELLRSKSGMWKF 135

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKE 155
           +  A V N V AEAEI   V  +K +
Sbjct: 136 KVFATVGNEVAAEAEIMCAVREDKSK 161


>gi|238897800|ref|YP_002923479.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465557|gb|ACQ67331.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 170

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 93/141 (65%), Gaps = 2/141 (1%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  DI E++  LPHRYPFLLVD+V+++++++S   IKN++FNEP F GHFP +P+ PGVL
Sbjct: 25  DILDIREILDLLPHRYPFLLVDRVIDLKKNKSLRAIKNISFNEPFFQGHFPKKPIFPGVL 84

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           ILE MAQ  G +     G  Q    Y  + I+KARF++PV PGD++   VN +  R+   
Sbjct: 85  ILEAMAQATGILAFKSKGKLQSGEIYYFACIEKARFKRPVHPGDQMILEVNFLNERLGCA 144

Query: 128 KFQCCAKVENTVVAEAE-ICA 147
           +F   AKV+  +V EA  +CA
Sbjct: 145 RFTGVAKVDEELVCEATMMCA 165


>gi|325294762|ref|YP_004281276.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065210|gb|ADY73217.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 145

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 90/142 (63%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+E+M+ +PHRYPFLLVDK++  +  +  +GIKNVT NEP+F GHFPG P+MPG L++E
Sbjct: 4   DIMEIMKLIPHRYPFLLVDKIIEFEPKKRIVGIKNVTINEPYFQGHFPGHPIMPGALLIE 63

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            MAQ    +  +   FD    +Y   Y M IDKARFRKPV PGD + + +     +  L 
Sbjct: 64  AMAQVGCVL--MFKSFDITPEEYV-VYFMGIDKARFRKPVRPGDTVRFVLEPKTIKKKLS 120

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K    A V   VV EAEI AM+
Sbjct: 121 KMVGTAYVGEDVVCEAEIMAMI 142


>gi|195953307|ref|YP_002121597.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Hydrogenobaculum sp. Y04AAS1]
 gi|226700244|sp|B4U908|FABZ_HYDS0 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|195932919|gb|ACG57619.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 148

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 92/138 (66%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++E+M+ +PHRYP LLVDK++ ++  +  +G+KNV+ NEP F GHFPG P+MPGVL+LE
Sbjct: 2   DVLEIMKIIPHRYPLLLVDKILEMELGKRIVGLKNVSVNEPFFQGHFPGYPLMPGVLMLE 61

Query: 72  GMAQTAGAICAIHNGFD--QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +     G +  +YA  +   ID+ARF++PV+PGD+L   +  +  +  + K 
Sbjct: 62  AMAQVGGILMIKSLGLEIGKYAVVF-AGIDEARFKRPVYPGDQLIMELETISLKKTISKM 120

Query: 130 QCCAKVENTVVAEAEICA 147
           +  A V N VVAEA + A
Sbjct: 121 KGTATVNNQVVAEAILMA 138


>gi|157962693|ref|YP_001502727.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella pealeana ATCC
           700345]
 gi|157847693|gb|ABV88192.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella pealeana ATCC 700345]
          Length = 165

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+++FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGV
Sbjct: 17  LNTMDIKEILKFLPHRYPFLLIDRVLDFTPGETLHAIKNVTINEPFFQGHFPVQPVMPGV 76

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE MAQ  G  A   +       A  Y   IDKARF++ V PGD+L + V  ++ R  
Sbjct: 77  LILEAMAQATGLLAFKTMSEEPSNDALYYFAGIDKARFKRVVEPGDQLHFEVQMIKERRG 136

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AEI CA
Sbjct: 137 IGVFTGVAKVDGEVVCSAEIMCA 159


>gi|308071135|ref|YP_003872740.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Paenibacillus polymyxa E681]
 gi|305860414|gb|ADM72202.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Paenibacillus polymyxa E681]
          Length = 148

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 87/134 (64%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   +PHR PFLLVD+++ ++  + A+GIKNVT NEPHF+GHFPG PVMPGVLI E
Sbjct: 7   DVNQIQEIIPHRAPFLLVDRIIELEEGKRAVGIKNVTMNEPHFIGHFPGYPVMPGVLITE 66

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +H   ++    +L  +D  RFR  V PGD L   V   R++    K + 
Sbjct: 67  ALAQV-GAVALLHLESNRGKIGFLAGLDGFRFRGQVVPGDTLTLEVEITRSKGAFGKGKA 125

Query: 132 CAKVENTVVAEAEI 145
            AKV +TVVAE EI
Sbjct: 126 TAKVGDTVVAEGEI 139


>gi|226226994|ref|YP_002761100.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Gemmatimonas aurantiaca T-27]
 gi|226090185|dbj|BAH38630.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Gemmatimonas aurantiaca T-27]
          Length = 424

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (64%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++++ LPHRYPFLLVD+++ ++  +  +G+KNVT NEP F GHFPG P+MPGVLI+E 
Sbjct: 285 IEDILQVLPHRYPFLLVDRILELEEGKRIVGLKNVTINEPFFQGHFPGHPIMPGVLIIEA 344

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ  G +             Y MS+D  +FR+PV PGD+L + +  ++ R  + K +  
Sbjct: 345 MAQVGGMLLMRTVTDPSTKVVYFMSLDNVKFRRPVKPGDQLRFEMEVLQMRGTMCKMRGV 404

Query: 133 AKVENTVVAEAEICAMV 149
           A V+  VV EAE+ AMV
Sbjct: 405 AYVDGQVVTEAEMAAMV 421


>gi|225630813|ref|YP_002727604.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           sp. wRi]
 gi|225677031|ref|ZP_03788042.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|254788541|sp|C0R4H1|FABZ_WOLWR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|225590928|gb|EEH12144.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225592794|gb|ACN95813.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           sp. wRi]
          Length = 143

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 91/141 (64%), Gaps = 1/141 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLLVD+V+     +S   IKNVTFNEP F+GHFPG P+MPGVLI+E
Sbjct: 4   NISDIIKILPHSYPFLLVDRVIECDPGKSIKAIKNVTFNEPFFIGHFPGHPIMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ A AIC +     +    YL SI+ A+FRKPV PGD L    N     + + KF+C
Sbjct: 64  SLAQ-ASAICVLGKETIENKVVYLRSIENAKFRKPVTPGDTLILQANIQSVCLGVHKFRC 122

Query: 132 CAKVENTVVAEAEICAMVMHE 152
            A V    VAEA I A++ ++
Sbjct: 123 IASVSEEKVAEATISAVLQNK 143


>gi|300691593|ref|YP_003752588.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Ralstonia
           solanacearum PSI07]
 gi|299078653|emb|CBJ51311.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Ralstonia
           solanacearum PSI07]
          Length = 164

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 95/146 (65%), Gaps = 2/146 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V+ ++  +    IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 16  NIKKILELLPHRYPMLLVDRVLELEPRKRIKAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 75

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +    +    Q    YL +SID ARF++ V PGD+L  +   +R++  +WKF
Sbjct: 76  ALAQTAALLTFGESDHKRQENQLYLFVSIDGARFKRQVTPGDQLVLNAELLRSKSGMWKF 135

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKE 155
           +  A V+N + AEAEI   V  +K +
Sbjct: 136 KVFATVDNEIAAEAEIMCAVREDKSK 161


>gi|190359490|sp|A8H6K5|FABZ_SHEPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 153

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+++FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEILKFLPHRYPFLLIDRVLDFTPGETLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE MAQ  G  A   +       A  Y   IDKARF++ V PGD+L + V  ++ R  
Sbjct: 65  LILEAMAQATGLLAFKTMSEEPSNDALYYFAGIDKARFKRVVEPGDQLHFEVQMIKERRG 124

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AEI CA
Sbjct: 125 IGVFTGVAKVDGEVVCSAEIMCA 147


>gi|302343536|ref|YP_003808065.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfarculus baarsii DSM 2075]
 gi|301640149|gb|ADK85471.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfarculus baarsii DSM 2075]
          Length = 158

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 9/152 (5%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
           C+D + I+EL   LPHRYPFLL+D+V+ ++  +  + IKNVT+NEP F GHFPG PVMPG
Sbjct: 5   CMDIQRIIEL---LPHRYPFLLIDRVLELEPRKRIVAIKNVTYNEPFFQGHFPGLPVMPG 61

Query: 67  VLILEGMAQTAGAICAIHN---GFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           VLI+E M Q AG I   H    G D     Y MS+D  +FR+PV PGD+L   VN     
Sbjct: 62  VLIVEAMGQ-AGGIMVYHEVPAGSDIII--YFMSLDNVKFRRPVVPGDQLLIEVNSTHLS 118

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
              WK    A V+  + A+AE+ A V    K+
Sbjct: 119 SRAWKMAGKAYVDGKLAAQAELSAAVQISDKK 150


>gi|113970965|ref|YP_734758.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella sp. MR-4]
 gi|114048189|ref|YP_738739.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella sp. MR-7]
 gi|123029486|sp|Q0HGW6|FABZ_SHESM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|123326338|sp|Q0HT73|FABZ_SHESR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|113885649|gb|ABI39701.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella sp.
           MR-4]
 gi|113889631|gb|ABI43682.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella sp.
           MR-7]
          Length = 154

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 91/145 (62%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   MNTMDITEILKYLPHRYPFLLIDRVLDYTPGESLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A     D   PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 65  LILEAMAQATG-LLAFKTMSDDVPPPGVLYYFAGIDNARFRRVVEPGDQIHFDVKMIKER 123

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   AKV+  VV  AEI CA
Sbjct: 124 RGIGVFYGEAKVDGEVVCSAEIMCA 148


>gi|153870284|ref|ZP_01999717.1| (3R)-hydroxymyristoyl ACP dehydratase [Beggiatoa sp. PS]
 gi|152073249|gb|EDN70282.1| (3R)-hydroxymyristoyl ACP dehydratase [Beggiatoa sp. PS]
          Length = 149

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 2/143 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +++ DI ++ + L HRYPFLL+D+V++    ES + IKNVT+NEP F GHFP RP+MPGV
Sbjct: 1   MNSMDIHQIFQHLHHRYPFLLIDRVLDYTVGESLVAIKNVTYNEPFFQGHFPHRPIMPGV 60

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++E MAQ  G +         +  +  YL+ +D ARF++PV PGD+L   V   R    
Sbjct: 61  LLIEAMAQATGILSFKTAQAQPEDNSLYYLVGVDNARFKQPVEPGDQLLIEVKLTRTTRG 120

Query: 126 LWKFQCCAKVENTVVAEAEICAM 148
           +WK+   AKVE+ +VA A++  M
Sbjct: 121 VWKYAATAKVEDKLVASADLMCM 143


>gi|39997363|ref|NP_953314.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacter sulfurreducens
           PCA]
 gi|47605591|sp|P61453|FABZ_GEOSL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|39984254|gb|AAR35641.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Geobacter
           sulfurreducens PCA]
 gi|298506300|gb|ADI85023.1| (3R)-hydroxyacyl-(acyl carrier protein) dehydratase [Geobacter
           sulfurreducens KN400]
          Length = 150

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 87/145 (60%), Gaps = 3/145 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHRYPFLLVD++V     E  +GIKNV+ NEP F GHFPG PVMPGVLI+E
Sbjct: 6   DINEIMKILPHRYPFLLVDRIVEYVAGERIVGIKNVSINEPFFQGHFPGHPVMPGVLIVE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G    +  G D+      Y  SID  +FRKPV PGD+L   V     +  +W F
Sbjct: 66  AMAQVGGIYAYVTLG-DEVRDKVCYFASIDNVKFRKPVVPGDQLRIEVTISGCKRGIWCF 124

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
              A V   +V EAE+ A    ++K
Sbjct: 125 SARATVNGKLVTEAELKATFADKEK 149


>gi|118578784|ref|YP_900034.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pelobacter propionicus DSM 2379]
 gi|118501494|gb|ABK97976.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase /
           3-hydroxyacyl-[acyl-carrier-protein] dehydratase
           [Pelobacter propionicus DSM 2379]
          Length = 147

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+M+ LPHR PFL+VD+++ ++  E  +GIKN T +E  F GHFPG PVMPGVLI+E
Sbjct: 4   DVNEIMKVLPHRPPFLMVDRIIELEGGERCVGIKNTTMDEHFFQGHFPGHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ A  +    +G D +    Y M+ID A+FRKPVFPGD+L   V  ++ R  +W   
Sbjct: 64  AMAQVACLMAYKADGTDYHNKVCYFMAIDNAKFRKPVFPGDQLRLEVTTLQRRRGVWVIS 123

Query: 131 CCAKVENTVVAEAEICAMVM 150
               VE+T+V EA+  A ++
Sbjct: 124 GKTYVEDTLVCEADFKATLV 143


>gi|317486628|ref|ZP_07945445.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bilophila
           wadsworthia 3_1_6]
 gi|316922011|gb|EFV43280.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bilophila
           wadsworthia 3_1_6]
          Length = 153

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++ FLPHRYPFLLVD+V  I   E     K V+FNEP F GHFPG PVMPGVLI+E
Sbjct: 8   DIRKILEFLPHRYPFLLVDRVNEIVDGEYIKAHKCVSFNEPFFQGHFPGVPVMPGVLIIE 67

Query: 72  GMAQTAGAICAIHNGFD---QYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ AG +  +H GFD        +L S ++K RFR+PVFPGDRL      +R+++ LW
Sbjct: 68  ALAQ-AGGLLVLH-GFDPSETAGKLFLFSGLEKVRFRRPVFPGDRLVLECRLIRHKLKLW 125

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K +  A V+  + AEAEI A V
Sbjct: 126 KMEGRAYVDGVLAAEAEITAAV 147


>gi|149194748|ref|ZP_01871843.1| (3R)-hydroxymyristoyl ACP dehydratase [Caminibacter mediatlanticus
           TB-2]
 gi|149135171|gb|EDM23652.1| (3R)-hydroxymyristoyl ACP dehydratase [Caminibacter mediatlanticus
           TB-2]
          Length = 146

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 92/142 (64%), Gaps = 4/142 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD++ +++  E   G  N++     F GHFPG P+ PGVLI+E
Sbjct: 4   DINQIQEMLPHRYPFLLVDRITDVKDGEFVEGYLNISITNSVFQGHFPGHPIYPGVLIIE 63

Query: 72  GMAQTAGAI---CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           GMAQT GAI     +     +    Y MSIDKA+FRKPV PGD+L Y V+ +++R  +W 
Sbjct: 64  GMAQT-GAILPFTIMDKSELKEKVVYFMSIDKAKFRKPVKPGDKLTYKVSTIKHRGKIWH 122

Query: 129 FQCCAKVENTVVAEAEICAMVM 150
            +  A V+  +VAEAE+ AM+M
Sbjct: 123 LKGEAFVDGDLVAEAELKAMIM 144


>gi|299136289|ref|ZP_07029473.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium sp. MP5ACTX8]
 gi|298602413|gb|EFI58567.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium sp. MP5ACTX8]
          Length = 187

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 90/148 (60%), Gaps = 5/148 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIVE+M  LPHRYPFLL+D+V+ I+R    + IKNVT NEPHF+GHFP  P+MPGVL +E
Sbjct: 32  DIVEIMSLLPHRYPFLLIDRVIEIERRTRVVAIKNVTVNEPHFVGHFPDYPIMPGVLTIE 91

Query: 72  GMAQTAGA--ICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G   +  I +  D+        I++A FR+PV PGD+L   V  +  R    K 
Sbjct: 92  AMAQAGGTLLLTEIPDRGDKLM--VFTGIEEAHFRRPVLPGDQLRIEVKVLNWRSRAVKM 149

Query: 130 QCCAKVENTVVAEAEI-CAMVMHEKKEK 156
           Q    V+  VVA+A I C +V   +K K
Sbjct: 150 QGVCTVDGKVVADATITCQLVPRMRKPK 177


>gi|77360949|ref|YP_340524.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|91206642|sp|Q3IIY5|FABZ_PSEHT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|76875860|emb|CAI87081.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 150

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 92/144 (63%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E++  LPHRYP LLVD+V++    +S   IKNVT NEP F GHFP +P+ PGV
Sbjct: 5   LNSLDIQEILSLLPHRYPMLLVDRVIDFTPGKSLHAIKNVTINEPIFTGHFPNQPIFPGV 64

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +    + N  +     YL  ++D ARF+KPV PGD +  HV  ++ R 
Sbjct: 65  LILEAMAQATGLLGFKTVENRSENEL--YLFAAVDNARFKKPVLPGDTMHLHVEFLKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
           +LWKF   AKV+  +V  AEI CA
Sbjct: 123 NLWKFAAEAKVDGKLVCSAEIMCA 146


>gi|194333342|ref|YP_002015202.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Prosthecochloris aestuarii DSM 271]
 gi|194311160|gb|ACF45555.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Prosthecochloris aestuarii DSM 271]
          Length = 467

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 85/145 (58%), Gaps = 2/145 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLL+DK+V  + DE  + IKNVT NE  F GHFPG P+MPGVLI+E
Sbjct: 325 DINAIQNILPHRYPFLLIDKIVEFKLDEKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIIE 384

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQT G +    N        Y M IDKARFRKPV PGD L         R  + +F  
Sbjct: 385 AMAQTGGIMMLNGNDNINDMQVYFMGIDKARFRKPVVPGDTLVIEAVMKSRRRSVCQFDG 444

Query: 132 CAKVENTVVAEAEICAMVMHEKKEK 156
            A V   +V EA + A V+  KKEK
Sbjct: 445 KAYVRGELVCEASLMATVV--KKEK 467


>gi|241662954|ref|YP_002981314.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ralstonia pickettii 12D]
 gi|309782127|ref|ZP_07676857.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ralstonia
           sp. 5_7_47FAA]
 gi|240864981|gb|ACS62642.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ralstonia
           pickettii 12D]
 gi|308919193|gb|EFP64860.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ralstonia
           sp. 5_7_47FAA]
          Length = 167

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 99/153 (64%), Gaps = 9/153 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V++++  +S   IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 19  NIKKILDLLPHRYPMLLVDRVISLEPRKSITAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 78

Query: 72  GMAQTAGAIC---AIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQTA  +    A H   +     YL +SID ARF++ V PGD+L      +R++  +W
Sbjct: 79  ALAQTAALLTFGEADHERKENQL--YLFVSIDGARFKRQVTPGDQLVMTAELLRSKSGMW 136

Query: 128 KFQCCAKVENTVVAEAEI-CAMVMHEKKEKNES 159
           KF+   KV+  V  EAEI CA  + E K K E+
Sbjct: 137 KFKVYGKVDGEVAVEAEIMCA--VREDKSKGEA 167


>gi|187928378|ref|YP_001898865.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ralstonia pickettii 12J]
 gi|187725268|gb|ACD26433.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ralstonia
           pickettii 12J]
          Length = 167

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 99/153 (64%), Gaps = 9/153 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V++++  +S   IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 19  NIKKILDLLPHRYPMLLVDRVISLEPRKSITAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 78

Query: 72  GMAQTAGAIC---AIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQTA  +    A H   +     YL +SID ARF++ V PGD+L      +R++  +W
Sbjct: 79  ALAQTAALLTFGEADHERKENQL--YLFVSIDGARFKRQVTPGDQLVMTAELLRSKSGMW 136

Query: 128 KFQCCAKVENTVVAEAEI-CAMVMHEKKEKNES 159
           KF+   KV+  V  EAEI CA  + E K K E+
Sbjct: 137 KFKVYGKVDGEVAVEAEIMCA--VREDKSKGEA 167


>gi|152995312|ref|YP_001340147.1| (3R)-hydroxymyristoyl-ACP dehydratase [Marinomonas sp. MWYL1]
 gi|189044390|sp|A6VUT3|FABZ_MARMS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|150836236|gb|ABR70212.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Marinomonas sp. MWYL1]
          Length = 145

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 89/139 (64%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+ ++LPHRYPFLLVD++V I  ++S I  KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   DVNEIRQYLPHRYPFLLVDRIVEINLNDSIIAYKNVTINEPFFNGHFPNHPVMPGVLIIE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +   ++    +  +  Y +  D ARF++PV PGDRL+     +  +  +WKF
Sbjct: 63  AMAQAAGVLGFKSMDKKPEDGSIYYFVGADNARFKRPVVPGDRLQLEAKIIAEKRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
           +C A V+  +   A I CA
Sbjct: 123 ECRATVDGQLACSATIMCA 141


>gi|328954377|ref|YP_004371711.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454701|gb|AEB10530.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase
           [Desulfobacca acetoxidans DSM 11109]
          Length = 155

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 88/147 (59%), Gaps = 1/147 (0%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D   + ++M +LPHRYPFLLVD+++ +   +   G+KNVT NEP F GHFPGRPVMPGVL
Sbjct: 5   DQLAVEDIMHYLPHRYPFLLVDRILQVTPGKFIKGLKNVTLNEPFFQGHFPGRPVMPGVL 64

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPPY-LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           I E MAQ  G +  +          Y  + +DK RFR+PV PGD+L   +  +R    +W
Sbjct: 65  ICEAMAQVGGVLAYMSTQAHLEKKLYFFVGMDKVRFRRPVVPGDQLIMEMTTIRGGKKVW 124

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEKK 154
           K    A VE+ VVAE E  A +  E+ 
Sbjct: 125 KMLGKALVEDNVVAEGEFMAALSREES 151


>gi|17546134|ref|NP_519536.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ralstonia solanacearum
           GMI1000]
 gi|24211700|sp|Q8XZI0|FABZ_RALSO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|17428430|emb|CAD15117.1| probable (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3r)-hydroxymyristoyl acp dehydrase) [Ralstonia
           solanacearum GMI1000]
          Length = 164

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 2/146 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  LPHRYP LLVD+V+ ++  +    IKNVTFNEP F GHFPG PVMPGVL+LE
Sbjct: 16  NIKKILELLPHRYPMLLVDRVLEMEPRKRIKAIKNVTFNEPFFNGHFPGHPVMPGVLMLE 75

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +     N   Q    YL +SID ARF++ V PGD+L  +   +R++  +WKF
Sbjct: 76  ALAQTAALLTFGESNHKRQENQLYLFVSIDGARFKRQVTPGDQLVLNAELLRSKSGMWKF 135

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKE 155
           +  A V++ V AEAEI   V  +K +
Sbjct: 136 KVFATVDDEVAAEAEIMCAVREDKSK 161


>gi|160872227|ref|ZP_02062359.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rickettsiella grylli]
 gi|159121026|gb|EDP46364.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rickettsiella grylli]
          Length = 147

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  DI E++ +LP RYP L++DKV+ I   +S + +KNVT NEP+F+GHFPG P+MPGVL
Sbjct: 3   DIMDIQEILTYLPQRYPILMIDKVIKIVPGKSIVALKNVTVNEPYFLGHFPGNPIMPGVL 62

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           ILE MAQ  G +    N  ++    YL + ID+ARF+KPV PGD+L      ++ + ++W
Sbjct: 63  ILETMAQATGILALHANRENKEGFLYLFAGIDEARFKKPVVPGDQLLIEAEVLKVKGNVW 122

Query: 128 KFQCCAKVENTVVAEA 143
           K +  AKV N +  EA
Sbjct: 123 KCKVIAKVGNELACEA 138


>gi|167624884|ref|YP_001675178.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella halifaxensis
           HAW-EB4]
 gi|189044400|sp|B0TP72|FABZ_SHEHH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|167354906|gb|ABZ77519.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella halifaxensis HAW-EB4]
          Length = 153

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+++FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEILKFLPHRYPFLLIDRVLDFTPGETLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE MAQ  G  A   +       A  Y   IDKARF++ V PGD+L + V  ++ R  
Sbjct: 65  LILEAMAQATGLLAFKTMSEEPSNDALYYFAGIDKARFKRVVEPGDQLHFEVQMIKERRG 124

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  +V  AEI CA
Sbjct: 125 IGVFTGVAKVDGEIVCSAEIMCA 147


>gi|152980532|ref|YP_001353737.1| (3R)-hydroxymyristoyl-ACP dehydratase [Janthinobacterium sp.
           Marseille]
 gi|151280609|gb|ABR89019.1| 3R-hydroxymyristoyl ACP dehydrase [Janthinobacterium sp. Marseille]
          Length = 161

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 91/140 (65%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ ++LPHRYP LLVD+V+N +  +S   IKNVT NE  F GHFP +PVMPGVL++E
Sbjct: 10  DINQIKQYLPHRYPLLLVDRVLNWESGKSITAIKNVTVNEEFFNGHFPHKPVMPGVLMIE 69

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +  +  G   D  +  Y + ID ARF++PV PGD+L+  V  +RN   +WK+
Sbjct: 70  ALAQTAALLSFLTMGQKPDDNSVVYFIGIDGARFKRPVEPGDQLKMEVEILRNARGIWKY 129

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +    V+  +  EAE+ C M
Sbjct: 130 KATGSVDGQLALEAELMCTM 149


>gi|190359400|sp|A1W907|FABZ_ACISJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 94/145 (64%), Gaps = 13/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+V  ++R +  + IKNVT NEP F GHFP RPVMPGVLILE
Sbjct: 2   DIHQILKLLPHRYPFLLVDRVNELERGKRILAIKNVTINEPFFTGHFPARPVMPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQY--APP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ AG +      FD    AP      Y + ID ARF++PV PGD+L   V   R + 
Sbjct: 62  ALAQAAGLLS-----FDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVELDRIKG 116

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            ++KF+  A+V ++V  EAEI C M
Sbjct: 117 GIYKFKGVARVGDSVACEAEIMCTM 141


>gi|120610514|ref|YP_970192.1| (3R)-hydroxymyristoyl-ACP dehydratase [Acidovorax citrulli AAC00-1]
 gi|190359311|sp|A1TN80|FABZ_ACIAC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|120588978|gb|ABM32418.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Acidovorax
           citrulli AAC00-1]
          Length = 146

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 13/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+VV ++R E    IKNVT NEP F GHFP RPVMPGVL+LE
Sbjct: 3   DIHQILKLLPHRYPFLLVDRVVELERGERIQAIKNVTINEPFFTGHFPNRPVMPGVLMLE 62

Query: 72  GMAQTAGAICAIHNGFDQY--APP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ AG +      FD    AP      Y + ID ARF++PV PGD+L   V   R + 
Sbjct: 63  ALAQAAGLLS-----FDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVKLDRIKG 117

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            ++KF   A+V ++V  EAEI C M
Sbjct: 118 GIYKFGGVARVGDSVACEAEIMCTM 142


>gi|121594912|ref|YP_986808.1| (3R)-hydroxymyristoyl-ACP dehydratase [Acidovorax sp. JS42]
 gi|222110437|ref|YP_002552701.1| (3r)-hydroxymyristoyl-acp dehydratase [Acidovorax ebreus TPSY]
 gi|120606992|gb|ABM42732.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Acidovorax sp.
           JS42]
 gi|221729881|gb|ACM32701.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidovorax ebreus TPSY]
          Length = 146

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 94/145 (64%), Gaps = 13/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+V  ++R +  + IKNVT NEP F GHFP RPVMPGVLILE
Sbjct: 3   DIHQILKLLPHRYPFLLVDRVNELERGKRILAIKNVTINEPFFTGHFPARPVMPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQY--APP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ AG +      FD    AP      Y + ID ARF++PV PGD+L   V   R + 
Sbjct: 63  ALAQAAGLLS-----FDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVELDRIKG 117

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            ++KF+  A+V ++V  EAEI C M
Sbjct: 118 GIYKFKGVARVGDSVACEAEIMCTM 142


>gi|242310373|ref|ZP_04809528.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter pullorum MIT 98-5489]
 gi|239522771|gb|EEQ62637.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter pullorum MIT 98-5489]
          Length = 155

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 91/152 (59%), Gaps = 9/152 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYP LLVD++  I  ++S    KN+T NE  F GHFP +P+ PGV I+E
Sbjct: 4   DVQKIREILPHRYPLLLVDRITAITPNQSIEAYKNITINEEIFNGHFPIQPIYPGVYIIE 63

Query: 72  GMAQTAGAICAI-------HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GMAQ  G +  I        N  D+    Y MSIDKA+FR PV PGD L Y +  V+ + 
Sbjct: 64  GMAQAGGVLAFISMFGEDSSNNGDKIV--YFMSIDKAKFRNPVTPGDTLVYKLEVVKQKG 121

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKKEK 156
            +W  Q  A V   +VAEAE+ AM++ + KEK
Sbjct: 122 GIWVLQGYAYVNEKLVAEAELKAMIVDKTKEK 153


>gi|124514697|gb|EAY56209.1| Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase (FabZ)
           [Leptospirillum rubarum]
          Length = 173

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 89/139 (64%), Gaps = 2/139 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPFLLVD+++ ++  +  +G+KNVT NEP F+GHFPG P+MPGVL++E
Sbjct: 18  NIQEILDILPHRYPFLLVDRILEVEPGKRIVGVKNVTMNEPFFVGHFPGFPIMPGVLLIE 77

Query: 72  GMAQTAGAICAIHNGFDQYA-PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G I AI +G ++    PY M ID+ARFR P  PGD L   +     R   WK +
Sbjct: 78  AMAQV-GGILAICSGQEKTGCIPYFMGIDRARFRHPAGPGDTLVISLTTRNVRGSSWKME 136

Query: 131 CCAKVENTVVAEAEICAMV 149
               V    + EAEI AM+
Sbjct: 137 GEIHVGEKRICEAEIMAMI 155


>gi|190359392|sp|A6SZP0|FABZ_JANMA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 156

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 91/140 (65%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ ++LPHRYP LLVD+V+N +  +S   IKNVT NE  F GHFP +PVMPGVL++E
Sbjct: 5   DINQIKQYLPHRYPLLLVDRVLNWESGKSITAIKNVTVNEEFFNGHFPHKPVMPGVLMIE 64

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +  +  G   D  +  Y + ID ARF++PV PGD+L+  V  +RN   +WK+
Sbjct: 65  ALAQTAALLSFLTMGQKPDDNSVVYFIGIDGARFKRPVEPGDQLKMEVEILRNARGIWKY 124

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +    V+  +  EAE+ C M
Sbjct: 125 KATGSVDGQLALEAELMCTM 144


>gi|86146878|ref|ZP_01065197.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio sp. MED222]
 gi|218710307|ref|YP_002417928.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio splendidus LGP32]
 gi|254788540|sp|B7VIQ7|FABZ_VIBSL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|85835330|gb|EAQ53469.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio sp. MED222]
 gi|218323326|emb|CAV19503.1| (3R)-hydroxymyristoyl-[acyl carrier protein]dehydratase [Vibrio
           splendidus LGP32]
          Length = 150

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 87/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL+VD+V + +++++   IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLMVDRVTSFEKEKTLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSGNELYYFASVDKAKFRKPVVPGDQLVIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IASFNGVAKVDGVVVCSAELKCA 146


>gi|183597585|ref|ZP_02959078.1| hypothetical protein PROSTU_00868 [Providencia stuartii ATCC 25827]
 gi|188023082|gb|EDU61122.1| hypothetical protein PROSTU_00868 [Providencia stuartii ATCC 25827]
          Length = 150

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 97/148 (65%), Gaps = 5/148 (3%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD   L+ ++I+EL   LPHRYPFLLVD+V++ ++ +S   +KNV+FNEP F GHFPG+
Sbjct: 1   MSDNHTLNIEEILEL---LPHRYPFLLVDRVLDFEKGKSLRAVKNVSFNEPFFQGHFPGK 57

Query: 62  PVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           P+ PGVLILE MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  +
Sbjct: 58  PIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDNARFKRPVLPGDQMILEVEFI 117

Query: 121 RNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           + R  + +F+  AKV+  V  EAE +CA
Sbjct: 118 KERRGVARFKGVAKVDGEVACEAEMMCA 145


>gi|308751544|gb|ADO45027.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Hydrogenobacter thermophilus TK-6]
          Length = 149

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 90/138 (65%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  LPHRYP LLVDK++ IQ  +  +G+KNV+ NEP+F GHFPG P+MPGV ILE
Sbjct: 3   DIREIMEVLPHRYPILLVDKILEIQIGKRIVGLKNVSINEPYFQGHFPGFPLMPGVYILE 62

Query: 72  GMAQTAGAICAIHNGFD--QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +     G +  +YA  +   ID+ARF+KP++PGD+L   +  V  +  L K 
Sbjct: 63  AMAQVGGILMIKSLGLEIGKYAIVF-AGIDEARFKKPIYPGDQLIMELEVVSLKRTLSKM 121

Query: 130 QCCAKVENTVVAEAEICA 147
           +  A V+  VVAEA + A
Sbjct: 122 KGKATVDGQVVAEAVLYA 139


>gi|121998239|ref|YP_001003026.1| (3R)-hydroxymyristoyl-ACP dehydratase [Halorhodospira halophila
           SL1]
 gi|121589644|gb|ABM62224.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Halorhodospira
           halophila SL1]
          Length = 163

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +S+     A DI  +M  LPHRYP LL+D+V++ Q  E    IKNVT NEP F+GHFP +
Sbjct: 11  VSERDAQGATDIEGIMNLLPHRYPLLLIDRVLDFQPHEHLASIKNVTINEPFFVGHFPQK 70

Query: 62  PVMPGVLILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           PVMPGVLILE +AQ  G  A  ++ +        YL+ IDKARF++PV PGD+L + V+ 
Sbjct: 71  PVMPGVLILESLAQACGMLAFKSVQDTLTDNDVLYLVGIDKARFKRPVQPGDQLRHDVSV 130

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEI 145
            R    +W F+    V+  + AE EI
Sbjct: 131 RRVTRGIWIFEARGSVDGELAAECEI 156


>gi|89092099|ref|ZP_01165054.1| (3R)-hydroxymyristoyl ACP dehydratase [Oceanospirillum sp. MED92]
 gi|89083834|gb|EAR63051.1| (3R)-hydroxymyristoyl ACP dehydratase [Oceanospirillum sp. MED92]
          Length = 145

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (62%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+  +LPHRYPFLLVD+V+ +++ ES + IKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   DVNEIREYLPHRYPFLLVDRVLELEKGESIVAIKNVTVNEPFFNGHFPDHPVMPGVLIVE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +    +       +  Y +  DK RF++PV PGD+L+     +  R  +WKF
Sbjct: 63  AMAQAAGILGFKTMDKKPQDGSIYYFVGSDKLRFKRPVVPGDQLKLEAKVISERRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
              A VE   V+ A I CA
Sbjct: 123 DVRASVEGDTVSSATILCA 141


>gi|315636713|ref|ZP_07891943.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Arcobacter butzleri JV22]
 gi|315479028|gb|EFU69731.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Arcobacter butzleri JV22]
          Length = 147

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 4/143 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++   LPHRYP LLVD++ +++  +S  G KN++ +EP F GHFPG P+ PGVLILE
Sbjct: 3   DIMQIQEILPHRYPLLLVDRITDMEVKKSIKGFKNISISEPAFQGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQ  G +    +       +    Y MSID A+FR PV PGDRL+Y +  V+ +  L 
Sbjct: 63  GMAQCGGVLALKSSDLTDEEMKNKVIYFMSIDNAKFRNPVRPGDRLDYELTAVKMKSTLM 122

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
             +  A V+  + AEAE  AM++
Sbjct: 123 VLEGKAYVDGKLTAEAEFKAMIV 145


>gi|119898189|ref|YP_933402.1| (3R)-hydroxymyristoyl-ACP dehydratase [Azoarcus sp. BH72]
 gi|158512910|sp|A1K6R0|FABZ_AZOSB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|119670602|emb|CAL94515.1| probable (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Azoarcus sp. BH72]
          Length = 145

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 93/140 (66%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++++LPHRYPFLLVD+V+ ++ ++  + +KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 2   DINEIVQYLPHRYPFLLVDRVLELEENKRILALKNVTMNEPFFPGHFPHHPVMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G   DQ +  Y   ID  RF++PV PGD+L   V   +++ +++K+
Sbjct: 62  AMAQAAAVLSFKSMGVKPDQNSVVYFAGIDAVRFKRPVVPGDQLLMEVEITQSKRNIYKY 121

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A+V   +  EAE+ CA+
Sbjct: 122 KGVARVNGEIATEAELMCAL 141


>gi|288817946|ref|YP_003432293.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Hydrogenobacter thermophilus TK-6]
 gi|288787345|dbj|BAI69092.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Hydrogenobacter thermophilus TK-6]
          Length = 148

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 93/148 (62%), Gaps = 3/148 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  LPHRYP LLVDK++ IQ  +  +G+KNV+ NEP+F GHFPG P+MPGV ILE
Sbjct: 2   DIREIMEVLPHRYPILLVDKILEIQIGKRIVGLKNVSINEPYFQGHFPGFPLMPGVYILE 61

Query: 72  GMAQTAGAICAIHNGFD--QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +     G +  +YA  +   ID+ARF+KP++PGD+L   +  V  +  L K 
Sbjct: 62  AMAQVGGILMIKSLGLEIGKYAIVF-AGIDEARFKKPIYPGDQLIMELEVVSLKRTLSKM 120

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKEKN 157
           +  A V+  VVAEA + A     K+ K 
Sbjct: 121 KGKATVDGQVVAEAVLYAAARELKELKR 148


>gi|157738415|ref|YP_001491099.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Arcobacter
           butzleri RM4018]
 gi|166971614|sp|A8EWV6|FABZ_ARCB4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157700269|gb|ABV68429.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Arcobacter
           butzleri RM4018]
          Length = 147

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 4/143 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++   LPHRYP LLVD++ +++  +S  G KN++ +EP F GHFPG P+ PGVLILE
Sbjct: 3   DIMQIQEILPHRYPLLLVDRITDMEVKKSIKGYKNISISEPAFQGHFPGHPIYPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           GMAQ  G +    +       +    Y MSID A+FR PV PGDRL+Y +  V+ +  L 
Sbjct: 63  GMAQCGGVLALKSSDLTDEEMKEKVIYFMSIDNAKFRNPVRPGDRLDYELTAVKMKSTLM 122

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
             +  A V+  + AEAE  AM++
Sbjct: 123 VLEGKAYVDGKLTAEAEFKAMIV 145


>gi|315499840|ref|YP_004088643.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Asticcacaulis excentricus CB 48]
 gi|315417852|gb|ADU14492.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Asticcacaulis excentricus CB 48]
          Length = 165

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 90/140 (64%), Gaps = 5/140 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M+ +PHRYPFLL+D+  N  +++S +GIKNVTFNEP F GHFP  PVMPGVLI+E + 
Sbjct: 25  EVMKRIPHRYPFLLIDRGENWIKNKSMVGIKNVTFNEPFFNGHFPENPVMPGVLIIEALG 84

Query: 75  QTAGAICAIHNGFD---QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           QT   + +     D   +    + M +D  +FR PV PGD+L  HV   R+R D++KF+ 
Sbjct: 85  QTGAVLMS--KSLDVSVEGKTIFFMGVDGVKFRSPVRPGDQLRMHVEVTRHRGDVFKFRG 142

Query: 132 CAKVENTVVAEAEICAMVMH 151
            A V N +V E E  AMV+ 
Sbjct: 143 EAFVNNKIVCECEFAAMVVE 162


>gi|148981144|ref|ZP_01816306.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrionales bacterium
           SWAT-3]
 gi|145960971|gb|EDK26296.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrionales bacterium
           SWAT-3]
          Length = 150

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 87/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL+VD+V + +++++   IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLMVDRVTSFEKEKTLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSGNELYYFASVDKAKFRKPVVPGDQLVIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IASFNGVAKVDGEVVCSAELKCA 146


>gi|84389781|ref|ZP_00991333.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio splendidus 12B01]
 gi|84376882|gb|EAP93756.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio splendidus 12B01]
          Length = 150

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 87/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL+VD+V + +++++   IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLMVDRVTSFEKEKTLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSGNELYYFASVDKAKFRKPVVPGDQLIIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IASFNGVAKVDGVVVCSAELKCA 146


>gi|304312459|ref|YP_003812057.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [gamma
           proteobacterium HdN1]
 gi|301798192|emb|CBL46414.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [gamma
           proteobacterium HdN1]
          Length = 145

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (62%), Gaps = 2/134 (1%)

Query: 14  VELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGM 73
            E++  LP RYPFLLVD+V+ +   E  + +KN+T NEP F GHFPG P+ PG+++LE M
Sbjct: 5   TEILPILPQRYPFLLVDRVLEVVPGEYCVAVKNITANEPQFTGHFPGNPIFPGMMLLEAM 64

Query: 74  AQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           AQTAG  A+     G  +      + +D  RFR+P  PGD++      V  + ++WKF+C
Sbjct: 65  AQTAGVLAVKTRSEGLRERTAAVFVGVDNVRFRRPAIPGDQIIMRAELVTTKRNIWKFRC 124

Query: 132 CAKVENTVVAEAEI 145
            AK++  + AEAEI
Sbjct: 125 EAKIDGVLAAEAEI 138


>gi|297538514|ref|YP_003674283.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylotenera sp. 301]
 gi|297257861|gb|ADI29706.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylotenera sp. 301]
          Length = 158

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/152 (46%), Positives = 94/152 (61%), Gaps = 11/152 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPF+L+D++V+++  +    +KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 11  DIHEILEHLPHRYPFVLIDRIVSLELGKEITALKNVTINEPFFPGHFPHHPVMPGVLIVE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ A  +     G    A P      Y   ID ARF+KPV PGD++  +V   R    
Sbjct: 71  AMAQAAAVLSFKTMG----AKPSDDSVYYFAGIDSARFKKPVSPGDQVILNVKIDRILKG 126

Query: 126 LWKFQCCAKVENTVVAEAE-ICAMVMHEKKEK 156
           +WK+   A+V+  VVAEAE +C +   EKKEK
Sbjct: 127 IWKYSGVARVDGVVVAEAEMMCILKTIEKKEK 158


>gi|91792922|ref|YP_562573.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella denitrificans OS217]
 gi|123356873|sp|Q12NX6|FABZ_SHEDO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91714924|gb|ABE54850.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           denitrificans OS217]
          Length = 153

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 93/144 (64%), Gaps = 5/144 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E++++LPHRYPFLL+D+V++  R ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEILKYLPHRYPFLLIDRVLDFTRGESLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G + A     ++ +P    Y   IDKARF++ V PGD++ +HV  ++ R 
Sbjct: 65  LILEAMAQATG-LLAFKTMSEEPSPNVLYYFAGIDKARFKRVVGPGDQIHFHVKMIKERR 123

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +  F   A V+  +   AEI CA
Sbjct: 124 GIGVFIGEAYVDGELACSAEIMCA 147


>gi|212636266|ref|YP_002312791.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella piezotolerans
           WP3]
 gi|212557750|gb|ACJ30204.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella piezotolerans WP3]
          Length = 146

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGVLILE
Sbjct: 2   DIKEILKFLPHRYPFLLIDRVLDFTPGETLHAIKNVTINEPFFQGHFPVQPVMPGVLILE 61

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G  A   + +     A  Y   IDKARF++ V PGD+L + V  ++ R  +  F
Sbjct: 62  AMAQATGLLAFKTMSDAPSNDALYYFAGIDKARFKRVVEPGDQLHFEVKMIKERRGIGVF 121

Query: 130 QCCAKVENTVVAEAEI-CA 147
              AKV+  VV  AEI CA
Sbjct: 122 TGEAKVDGEVVCSAEIMCA 140


>gi|302392923|ref|YP_003828743.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Acetohalobium
           arabaticum DSM 5501]
 gi|302205000|gb|ADL13678.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Acetohalobium
           arabaticum DSM 5501]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 83/135 (61%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+   LPHRYPFLL+D+++  +  E  +G+KNVT NE  F GH+P  PVMPGVLI+E
Sbjct: 3   DINEIKDILPHRYPFLLIDRILEFEEKERVVGLKNVTVNEEFFNGHYPEHPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +    N  ++   PY   IDKARFRKPV PGD+L      ++ R  + K   
Sbjct: 63  TMAQIGGFVMMDSNEENKEQLPYFAGIDKARFRKPVVPGDQLRIEAEVLKLRGKIGKISA 122

Query: 132 CAKVENTVVAEAEIC 146
            A V+  V AEA++ 
Sbjct: 123 TASVDGEVAAEAKLM 137


>gi|254508679|ref|ZP_05120794.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus 16]
 gi|219548436|gb|EED25446.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus 16]
          Length = 152

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 11  NITEIQELLPHRYPFLLIDRVTDYQEEKYLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  V+ R  
Sbjct: 71  AMAQATGLL-----AFKSFGAPSENELYYFASVDKAKFRKPVVPGDQLVIEVEFVKERRG 125

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 126 IAAFNGVAKVDGEVVCSAELKCA 148


>gi|297172574|gb|ADI23544.1| UDP-3-O-acyl-N-acetylglucosamine deacetylase [uncultured
           Gemmatimonadales bacterium HF0770_41L09]
          Length = 428

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 89/139 (64%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  ++M++LPHRYP LLVD++   +  +  +GIKNVT NEP F GH+PG PVMPGVLI+E
Sbjct: 288 DTAKIMQYLPHRYPMLLVDRITEYEAGKRIVGIKNVTINEPFFQGHYPGHPVMPGVLIIE 347

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +        +    Y MS+D+ ++RKPV PGD + + +  ++ R  + K + 
Sbjct: 348 AMAQVGGLLLMEEVEKHEDKVVYFMSLDRVKWRKPVTPGDTIVFELELLQFRRQVCKLKG 407

Query: 132 CAKVENTVVAEAEICAMVM 150
              VE T+VAEAE+ A ++
Sbjct: 408 QGFVEGTLVAEAEMMATIV 426


>gi|190359393|sp|A1WX12|FABZ_HALHL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 153

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI  +M  LPHRYP LL+D+V++ Q  E    IKNVT NEP F+GHFP +PVMPGVLI
Sbjct: 9   ATDIEGIMNLLPHRYPLLLIDRVLDFQPHEHLASIKNVTINEPFFVGHFPQKPVMPGVLI 68

Query: 70  LEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LE +AQ  G  A  ++ +        YL+ IDKARF++PV PGD+L + V+  R    +W
Sbjct: 69  LESLAQACGMLAFKSVQDTLTDNDVLYLVGIDKARFKRPVQPGDQLRHDVSVRRVTRGIW 128

Query: 128 KFQCCAKVENTVVAEAEI 145
            F+    V+  + AE EI
Sbjct: 129 IFEARGSVDGELAAECEI 146


>gi|268678826|ref|YP_003303257.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268616857|gb|ACZ11222.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 149

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 90/146 (61%), Gaps = 9/146 (6%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+ + LPHR+PFLL+D+V  +Q   S    KNVT  E  F GHFP  P+ PGV+I+E
Sbjct: 4   DVVEIQKILPHRFPFLLIDRVTALQSGTSIEAYKNVTIGEQIFQGHFPEHPIYPGVMIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP-------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GMAQ  G +       D+ A         Y MSID A+FR PV PGD+L Y +  +++R 
Sbjct: 64  GMAQAGGVLA--FKSMDEEAQEGTKEKVVYFMSIDNAKFRNPVRPGDKLVYQLAVLKHRG 121

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVM 150
           ++W     A V++ +VAEAE+ AM++
Sbjct: 122 NIWVLDAKAYVDDKLVAEAELKAMIV 147


>gi|126666169|ref|ZP_01737149.1| (3R)-hydroxymyristoyl ACP dehydratase [Marinobacter sp. ELB17]
 gi|126629491|gb|EBA00109.1| (3R)-hydroxymyristoyl ACP dehydratase [Marinobacter sp. ELB17]
          Length = 145

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 87/139 (62%), Gaps = 10/139 (7%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++ +LPHRYPFLLVD+V +I+  +S  G KNV+FNEP F GHFP  P+MPGVLI+E 
Sbjct: 4   INEILEYLPHRYPFLLVDRVTDIESGKSIKGYKNVSFNEPFFEGHFPNNPIMPGVLIIEA 63

Query: 73  MAQTAGAICAIH------NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           MAQ +G +  +       +G  Q    YL    K RF++PV PGD+L      V  +  +
Sbjct: 64  MAQLSGILGFVTVGRKPADGLVQ----YLAGARKVRFKRPVLPGDQLCMESEVVSTKRGI 119

Query: 127 WKFQCCAKVENTVVAEAEI 145
           WKF+C A V N VV  AEI
Sbjct: 120 WKFECRALVNNEVVCAAEI 138


>gi|42520889|ref|NP_966804.1| (3R)-hydroxymyristoyl-ACP dehydratase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99036029|ref|ZP_01315067.1| hypothetical protein Wendoof_01000084 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|47605593|sp|P61455|FABZ_WOLPM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|42410629|gb|AAS14738.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/141 (47%), Positives = 91/141 (64%), Gaps = 1/141 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLLVD+V+     +S   IKNVTFNEP F+GHFPG P+MPGVLI+E
Sbjct: 4   NISDIIKTLPHSYPFLLVDRVIECDPGKSIKAIKNVTFNEPFFIGHFPGHPIMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ A AIC +     +    YL SI+ A+FRK V PGD L    N     + ++KF+C
Sbjct: 64  SLAQ-ASAICVLGKETIENKVVYLRSIENAKFRKLVTPGDTLILQANIQSVCLGVYKFRC 122

Query: 132 CAKVENTVVAEAEICAMVMHE 152
            A V    VAEA I A++ ++
Sbjct: 123 IASVSEEKVAEATISAVLQNK 143


>gi|294084077|ref|YP_003550835.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663650|gb|ADE38751.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 152

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (62%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+ + +PHR P LL+D+V ++  D+ A GIK V+  EP F+GHFP  PVMPGVLI+E
Sbjct: 9   NIDEIKKLIPHRPPLLLIDRVEDVISDQEATGIKAVSMGEPFFVGHFPDFPVMPGVLIVE 68

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTA  + A+  G   +    +  +I+KARFR PV PGD +  HV K   +  LWKF 
Sbjct: 69  ALAQTAACMVAVTLGDATKGKLVFFTTIEKARFRTPVRPGDMMRLHVTKTAAKGPLWKFT 128

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A V+   VAEAE  AM +
Sbjct: 129 GIASVDGKTVAEAEFGAMTV 148


>gi|297171247|gb|ADI22254.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured Gemmatimonadales bacterium
           HF0200_36I24]
 gi|297171370|gb|ADI22374.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured nuHF2 cluster bacterium
           HF0500_02A10]
          Length = 136

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 92/138 (66%), Gaps = 4/138 (2%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M +LPHRYP LLVD++++ +     +GIKNVT NEP F GHFPG P+MPGVL++E MAQ 
Sbjct: 1   MEYLPHRYPLLLVDRILDFEPGIRIVGIKNVTINEPFFQGHFPGHPIMPGVLVIEAMAQV 60

Query: 77  AGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
            G +    + +  D+    Y +S+D  ++RKPV PGD+L + V  V++R ++ K +   +
Sbjct: 61  GGLLLMDTVEDPKDKVV--YFLSLDNVKWRKPVIPGDQLVFEVKMVQSRKNVCKLRGVGR 118

Query: 135 VENTVVAEAEICAMVMHE 152
           V + VVAEA++ A +M +
Sbjct: 119 VGDKVVAEADLMARIMDK 136


>gi|319956956|ref|YP_004168219.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Nitratifractor
           salsuginis DSM 16511]
 gi|319419360|gb|ADV46470.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Nitratifractor
           salsuginis DSM 16511]
          Length = 152

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +++E+ + LPHR+PFLLVD++  ++   S  G KNV+ +EP F GHFP  P+ PGV+I+E
Sbjct: 7   NVIEIQKILPHRFPFLLVDRITALEPGRSVEGYKNVSISEPVFQGHFPDHPIYPGVMIIE 66

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           GMAQ AG + A  +   Q          Y MSIDKA+FR PV PGD+L Y +  V+N+  
Sbjct: 67  GMAQ-AGGVLAFKSMDSQGQEATQDKVVYFMSIDKAKFRAPVTPGDKLVYRLEVVKNKGA 125

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
           +W     A V+  +VAEA++ AM++
Sbjct: 126 VWFLDGKAYVDEKLVAEAQLKAMIV 150


>gi|145589621|ref|YP_001156218.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|190359449|sp|A4SYU0|FABZ_POLSQ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145048027|gb|ABP34654.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 149

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 88/140 (62%), Gaps = 2/140 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI ++++ LPHRYPFLLVD+V+ I   E+   +KNVT NEP F GHFP  PVMPGVLI
Sbjct: 6   AIDIHKILQLLPHRYPFLLVDRVLEITPRETITALKNVTMNEPFFQGHFPDFPVMPGVLI 65

Query: 70  LEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           +E +AQTA A+        + A  Y   ID ARF+KPV PGD+L       R R  ++KF
Sbjct: 66  IEALAQTA-ALLTFSEERAEDAIYYFAGIDGARFKKPVLPGDQLIMTARLERGRAGIYKF 124

Query: 130 QCCAKVENTVVAEAEI-CAM 148
              A V+  + AEA I CA+
Sbjct: 125 AVQATVDGEIAAEANITCAV 144


>gi|56478862|ref|YP_160451.1| (3R)-hydroxymyristoyl-ACP dehydratase [Aromatoleum aromaticum EbN1]
 gi|62286723|sp|Q5NZG4|FABZ_AZOSE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56314905|emb|CAI09550.1| (3R)-hydroxyacyl-[acyl carrier protein] dehydratase [Aromatoleum
           aromaticum EbN1]
          Length = 145

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 94/140 (67%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++++LPHRYPFLLVD+V+ I+  +  + +KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 2   DINEILQYLPHRYPFLLVDRVLEIEEGKRILALKNVTMNEPFFPGHFPHHPVMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G   D+ +  Y   ID  RF++PV PGD+L + V   +++ +++K+
Sbjct: 62  AMAQAAALLSFKSMGVKPDENSVVYFAGIDNVRFKRPVVPGDQLLFDVVITQSKRNIYKY 121

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A+V+  +  EAE+ CA+
Sbjct: 122 KGVARVDGELATEAELTCAL 141


>gi|297171673|gb|ADI22667.1| UDP-3-O-acyl-N-acetylglucosamine deacetylase [uncultured
           Gemmatimonadales bacterium HF0500_22O06]
          Length = 428

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 89/139 (64%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  ++M++LPHRYP LLVD++   +  +  +GIKNVT NEP F GH+PG PVMPGVLI+E
Sbjct: 288 DTAKIMQYLPHRYPMLLVDRITEYEAGKRIVGIKNVTINEPFFQGHYPGHPVMPGVLIIE 347

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +        +    Y MS+D+ ++RKPV PGD + + +  ++ R  + K + 
Sbjct: 348 AMAQVGGLLLMEEVEKHEDKVVYFMSLDRVKWRKPVTPGDTIVFELELLQFRRQVCKLKG 407

Query: 132 CAKVENTVVAEAEICAMVM 150
              VE T+VAEAE+ A ++
Sbjct: 408 QGFVEGTLVAEAEMMATIV 426


>gi|217970569|ref|YP_002355803.1| (3R)-hydroxymyristoyl-ACP dehydratase [Thauera sp. MZ1T]
 gi|217507896|gb|ACK54907.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thauera
           sp. MZ1T]
          Length = 144

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (65%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++++LPHRYPFLLVD+++ I+    A G+KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 2   DIKEILQYLPHRYPFLLVDRMLEIEPGVRARGLKNVTMNEPFFPGHFPHHPVMPGVLIIE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G   D  +  Y   ID ARF++PV PGD+L + V     + +++K+
Sbjct: 62  AMAQAAALLSFKSTGVKPDDNSVVYFAGIDNARFKRPVVPGDQLIFDVEITHAKRNIYKY 121

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A V+  + AEAE+ CA+
Sbjct: 122 KARASVDGELAAEAELMCAI 141


>gi|262197153|ref|YP_003268362.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haliangium ochraceum DSM 14365]
 gi|262080500|gb|ACY16469.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haliangium ochraceum DSM 14365]
          Length = 167

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 91/143 (63%), Gaps = 6/143 (4%)

Query: 9   DAKDIV---ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           DA  I+   E+   +PHR+PFLLVD+V+++  D+  + IKNV+FNEP F GHFPG P+MP
Sbjct: 21  DASTIITAQEIANLIPHRFPFLLVDRVLSVDSDK-IVAIKNVSFNEPFFPGHFPGMPIMP 79

Query: 66  GVLILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GVLI+E MAQ  G + A  + F+ +      M+IDK +FRKPV PGD+L   V  +R R 
Sbjct: 80  GVLIVEAMAQAGGVLAARTSDFNPETQVVMFMAIDKVKFRKPVTPGDQLHIEVVPLR-RG 138

Query: 125 DLWKFQCCAKVENTVVAEAEICA 147
            +WK Q  A V+  V   AE  A
Sbjct: 139 KIWKMQGTATVDGQVACTAEFLA 161


>gi|51246796|ref|YP_066680.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Desulfotalea psychrophila LSv54]
 gi|62286793|sp|Q6AJ07|FABZ_DESPS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|50877833|emb|CAG37673.1| probable (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Desulfotalea psychrophila LSv54]
          Length = 150

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 94/148 (63%), Gaps = 3/148 (2%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD+      DIV ++  LPHRYPF++VD++++I   +  +G+KNVTFNE +F GHFPG 
Sbjct: 1   MSDVITPGEIDIVGILDLLPHRYPFVMVDRILSIDPGKEIVGLKNVTFNEQYFQGHFPGE 60

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNK 119
           PVMPGVL+LEG+AQ  G + A +   D       +   +DKARFRKPV PGD+L Y V  
Sbjct: 61  PVMPGVLMLEGLAQV-GCVHAFYTEPDAVGKKLAFFAGVDKARFRKPVRPGDQLIYKVQL 119

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICA 147
           V+ +  +        V++ VV +AE+ A
Sbjct: 120 VKEKRSIIFMSAKGYVDDQVVVQAELMA 147


>gi|323497987|ref|ZP_08102996.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio sinaloensis DSM
           21326]
 gi|323317032|gb|EGA70034.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio sinaloensis DSM
           21326]
          Length = 150

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLIDRVTDYQEEKYLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  V+ R  
Sbjct: 69  AMAQATGLL-----AFKSFGAPAENELYYFASVDKAKFRKPVVPGDQLVIEVEFVKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  +V  AE+ CA
Sbjct: 124 IAAFNGVAKVDGEIVCSAELKCA 146


>gi|319762186|ref|YP_004126123.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Alicycliphilus denitrificans BC]
 gi|330826002|ref|YP_004389305.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Alicycliphilus denitrificans K601]
 gi|317116747|gb|ADU99235.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Alicycliphilus denitrificans BC]
 gi|329311374|gb|AEB85789.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Alicycliphilus denitrificans K601]
          Length = 146

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 94/145 (64%), Gaps = 13/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+VV + R +    IKNVT NEP F GHFP RPVMPGVL+LE
Sbjct: 3   DIHQILKLLPHRYPFLLVDRVVELDRGKRIQAIKNVTINEPFFTGHFPARPVMPGVLMLE 62

Query: 72  GMAQTAGAICAIHNGFDQY--APP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ AG +      FD    AP      Y + ID ARF++PV PGD+L   V+  R + 
Sbjct: 63  ALAQAAGLLS-----FDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVSLDRIKG 117

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            ++KF+  A+V +++  EAEI C M
Sbjct: 118 GIYKFKGVARVGDSMACEAEIMCTM 142


>gi|92112707|ref|YP_572635.1| (3R)-hydroxymyristoyl-ACP dehydratase [Chromohalobacter salexigens
           DSM 3043]
 gi|91795797|gb|ABE57936.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Chromohalobacter
           salexigens DSM 3043]
          Length = 147

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 15/145 (10%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+  +LPHRYPFLLVD+V  I   E+ +  KNV+ NEP F GHFP  P+MPGVLI+E
Sbjct: 4   DINEIREYLPHRYPFLLVDRVTEITLGETIVAYKNVSINEPFFNGHFPHHPIMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGF--------DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
            MAQ  G +     GF        D Y   YL+  D  RF++PV PGD+L    N +R +
Sbjct: 64  AMAQACGIL-----GFKTVNKLPADGYV-YYLVGSDNVRFKRPVMPGDQLRLEANVIRGK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF C A V+  +  EAE ICA
Sbjct: 118 RGIWKFACRATVDGELACEAEIICA 142


>gi|218888084|ref|YP_002437405.1| (3R)-hydroxymyristoyl-ACP dehydratase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|226700459|sp|B8DJ60|FABZ_DESVM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|218759038|gb|ACL09937.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 154

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYPFLLVD+V      E   G KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 10  DIRQILGLLPHRYPFLLVDRVTEYVPGEYIKGYKNVTMNEPFFEGHFPGVPVMPGVLIME 69

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ  G +             +L + I+  RFRKPV+PGD+LE H   +R+++ LWK +
Sbjct: 70  ALAQAGGILVVKSTDTPVEDKLFLFTGIESVRFRKPVYPGDKLELHCRLLRHKLKLWKME 129

Query: 131 CCAKVENTVVAEAEICAMVMHEK 153
             A V+  + AEA + A V + +
Sbjct: 130 GFAYVDGKLAAEAVMTAAVTNRE 152


>gi|301057961|ref|ZP_07199018.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium NaphS2]
 gi|300447928|gb|EFK11636.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium NaphS2]
          Length = 148

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 94/146 (64%), Gaps = 7/146 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L  +DI E+   LPHRYPFLLVD+++ ++ ++   GIKNVT NEP F GHFPG P+MPGV
Sbjct: 5   LTYQDISEI---LPHRYPFLLVDRIIELELNQRVAGIKNVTANEPFFQGHFPGEPIMPGV 61

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYL--MSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LI+E MAQ  G +   +I    ++  P  +  +++DK +FRKPV PGD++ + +  +R  
Sbjct: 62  LIIEAMAQVGGILARLSIPEVLEKEDPDSIRFVAMDKVKFRKPVVPGDQIRFEIEPLRKG 121

Query: 124 VDLWKFQCCAKVENTVVAEAEICAMV 149
             +WK    A V+  +VAEA + A +
Sbjct: 122 TKVWKVAGKAFVDGQLVAEAVLVATI 147


>gi|300311504|ref|YP_003775596.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Herbaspirillum seropedicae SmR1]
 gi|300074289|gb|ADJ63688.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 154

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 92/144 (63%), Gaps = 3/144 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +++ DI ++ ++LPHRYP LLVD+V+N +  ++   IKNVT NE  F GHFP +PVMPGV
Sbjct: 1   MNSLDINQIKQYLPHRYPLLLVDRVLNWESGKTITAIKNVTVNEEFFNGHFPHKPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++E +AQTA  +  +  G   D+    Y + ID ARF++PV PGD+L+  V   R    
Sbjct: 61  LMIEALAQTAALLSFLTEGRKPDENTVVYFVGIDNARFKRPVEPGDQLKMEVEITRRARG 120

Query: 126 LWKFQCCAKVENTVVAEAEI-CAM 148
           +WK++  A V+  V  E ++ C M
Sbjct: 121 IWKYRAVATVDGQVAVEGDLMCTM 144


>gi|322434316|ref|YP_004216528.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium sp. MP5ACTX9]
 gi|321162043|gb|ADW67748.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium sp. MP5ACTX9]
          Length = 177

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  LPHRYPFLL+D+V+ I+R +  + IKNVT NEPHF GHFP  P+MPGVL++E
Sbjct: 24  DITEIMAILPHRYPFLLIDRVIEIERKQRIVAIKNVTVNEPHFTGHFPDYPIMPGVLMVE 83

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT GA+                 I+ ARFR+PV PGD+L   V  V  R  + K   
Sbjct: 84  AIAQTGGALLLTEIEDRDQKLMVFTGIESARFRRPVTPGDQLRIEVKVVNWRTRVVKMAG 143

Query: 132 CAKVENTVVAEAEI-CAM 148
              V+  VV +A + CA+
Sbjct: 144 VITVDGKVVCDATVTCAL 161


>gi|190359397|sp|Q1R022|FABZ_CHRSD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 15/145 (10%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+  +LPHRYPFLLVD+V  I   E+ +  KNV+ NEP F GHFP  P+MPGVLI+E
Sbjct: 2   DINEIREYLPHRYPFLLVDRVTEITLGETIVAYKNVSINEPFFNGHFPHHPIMPGVLIIE 61

Query: 72  GMAQTAGAICAIHNGF--------DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
            MAQ  G +     GF        D Y   YL+  D  RF++PV PGD+L    N +R +
Sbjct: 62  AMAQACGIL-----GFKTVNKLPADGYV-YYLVGSDNVRFKRPVMPGDQLRLEANVIRGK 115

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF C A V+  +  EAE ICA
Sbjct: 116 RGIWKFACRATVDGELACEAEIICA 140


>gi|323495351|ref|ZP_08100429.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio brasiliensis LMG
           20546]
 gi|323310422|gb|EGA63608.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio brasiliensis LMG
           20546]
          Length = 150

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLIDRVIDFQEEKYLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVVPGDQLVIEVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F+  AKV+  VV  AE+ CA
Sbjct: 124 IAAFKGTAKVDGEVVCSAELKCA 146


>gi|289548752|ref|YP_003473740.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermocrinis albus DSM 14484]
 gi|289182369|gb|ADC89613.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermocrinis albus DSM 14484]
          Length = 153

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 94/142 (66%), Gaps = 6/142 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           LDA+ I+E+   LPHRYP LLVDK+++++  +  +G+KNV+ NEP+F GHFPG P+MPGV
Sbjct: 3   LDARQIMEI---LPHRYPLLLVDKILHMELGKRIVGVKNVSVNEPYFQGHFPGFPLMPGV 59

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            ILE MAQ  G   I ++     +YA  +   ID+ARF+KPVFPGD+L   +  +  +  
Sbjct: 60  YILEAMAQVGGILMIKSLDLQVGKYAVVF-AGIDEARFKKPVFPGDQLLLELEVISLKKT 118

Query: 126 LWKFQCCAKVENTVVAEAEICA 147
           L K +  AKV   VVAEA + A
Sbjct: 119 LSKMKGVAKVNGQVVAEAVLYA 140


>gi|309390189|gb|ADO78069.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Halanaerobium
           praevalens DSM 2228]
          Length = 149

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 88/137 (64%), Gaps = 4/137 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYP LLVDK+  +++ ES IGIKNVT NE  F+GH+P  P+MPGVLI+E
Sbjct: 9   DISVIRSILPHRYPLLLVDKIEKVEKKESIIGIKNVTINEEFFLGHYPDHPIMPGVLIVE 68

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +  I+  F++     P   SIDKA+FR PV PGD+L   V  VR R  + K 
Sbjct: 69  AMAQVAGIL--IYYSFEEMEDKLPIFTSIDKAKFRTPVKPGDQLRMKVEIVRLRKRISKV 126

Query: 130 QCCAKVENTVVAEAEIC 146
           +  A V + + AEAE+ 
Sbjct: 127 KGKAYVGDNLAAEAEMM 143


>gi|146278180|ref|YP_001168339.1| (3R)-hydroxymyristoyl-ACP dehydratase [Rhodobacter sphaeroides ATCC
           17025]
 gi|166233432|sp|A4WUH0|FABZ_RHOS5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145556421|gb|ABP71034.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 155

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 2/133 (1%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A L A DI  + R +PHRYPFLLVD+V +I  ++SA+GIK VT NEP F GHFPG P+ P
Sbjct: 7   ATLSA-DIQLIQRIIPHRYPFLLVDRVRDIVPNQSAVGIKCVTMNEPQFTGHFPGLPIFP 65

Query: 66  GVLILEGMAQTAGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GV I+E MAQTA  +  +     D+ A  Y M ID A+FR+ V PGD LE  V   R   
Sbjct: 66  GVQIIEAMAQTAAVLVGVSLDLADKGAKVYFMGIDGAKFRRKVVPGDVLEMTVTVKRGGG 125

Query: 125 DLWKFQCCAKVEN 137
            +WKF+  A V+ 
Sbjct: 126 KVWKFEGRASVDG 138


>gi|260893804|ref|YP_003239901.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ammonifex
           degensii KC4]
 gi|260865945|gb|ACX53051.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Ammonifex
           degensii KC4]
          Length = 151

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 94/150 (62%), Gaps = 3/150 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +   LPHRYPFLL+D+V+ ++  + A+GIKNVT NE  F GHFPG PVMPGVLI+E
Sbjct: 3   DVRAIQELLPHRYPFLLLDRVILLEPGKRAVGIKNVTINELFFAGHFPGYPVMPGVLIVE 62

Query: 72  GMAQ-TAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ TA A+  +++  D+   P L  IDKARFR+PVFPGD L   V  +R +  + K +
Sbjct: 63  ALAQLTAVAVLKLNDFQDKI--PLLAGIDKARFRRPVFPGDTLRLEVEVLRLKGMVGKAK 120

Query: 131 CCAKVENTVVAEAEICAMVMHEKKEKNESH 160
             A V   + AEAEI       K E+ +  
Sbjct: 121 GQAWVGEELAAEAEIVFAAGERKSEEEKDR 150


>gi|326316584|ref|YP_004234256.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373420|gb|ADX45689.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 146

 Score =  129 bits (325), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 92/145 (63%), Gaps = 13/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+VV ++R +    IKNVT NEP F GHFP RPVMPGVL+LE
Sbjct: 3   DIHQILKLLPHRYPFLLVDRVVELERGQRIQAIKNVTINEPFFTGHFPSRPVMPGVLMLE 62

Query: 72  GMAQTAGAICAIHNGFDQY--APP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ AG +      FD    AP      Y + ID ARF++PV PGD+L   V   R + 
Sbjct: 63  ALAQAAGLLS-----FDMMGEAPGDDKVFYFVGIDGARFKRPVEPGDQLILDVKLDRIKG 117

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            ++KF   A+V ++   EAEI C M
Sbjct: 118 GIYKFVGVARVGDSTACEAEIMCTM 142


>gi|310644364|ref|YP_003949123.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Paenibacillus polymyxa SC2]
 gi|309249315|gb|ADO58882.1| Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus polymyxa SC2]
          Length = 148

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 86/134 (64%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   +PHR PFLLVD+++ ++  + A+GIKNVT  EPHF+GHFPG PVMPGVLI E
Sbjct: 7   DVNQIQEIIPHRPPFLLVDRIIELEEGKRAVGIKNVTMTEPHFIGHFPGYPVMPGVLITE 66

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +H   ++    +L  +D  RFR  V PGD L   V   R++    K + 
Sbjct: 67  ALAQV-GAVALLHLESNRGKIGFLAGLDGFRFRGQVVPGDTLTLEVEITRSKGAFGKGKA 125

Query: 132 CAKVENTVVAEAEI 145
            AKV +TVVAE EI
Sbjct: 126 TAKVGDTVVAEGEI 139


>gi|134094571|ref|YP_001099646.1| (3R)-hydroxymyristoyl-ACP dehydratase [Herminiimonas
           arsenicoxydans]
          Length = 178

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ ++LPHRYP LLVD+V+  +  +S   IKNVT NE  F GHFP +PVMPGVL++E
Sbjct: 27  DINQIKQYLPHRYPMLLVDRVLTWESGKSITAIKNVTANEEFFNGHFPHKPVMPGVLMIE 86

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +  +  G   D  +  Y + ID ARF++PV PGD+L+  V  +RN   +WK+
Sbjct: 87  ALAQTAALLSFLTMGQKPDDNSVVYFIGIDGARFKRPVEPGDQLKMEVEILRNARGIWKY 146

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +    V+  +  EAE+ C M
Sbjct: 147 KATGSVDGQLALEAELMCTM 166


>gi|149192149|ref|ZP_01870370.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio shilonii AK1]
 gi|148834019|gb|EDL51035.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio shilonii AK1]
          Length = 150

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 84/142 (59%), Gaps = 12/142 (8%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+   LPHRYPFLL+D+V + Q ++    IKNV+ NEP F GHFP  PV PGVLILE 
Sbjct: 10  ITEIQELLPHRYPFLLIDRVTDYQEEKYLTAIKNVSVNEPQFTGHFPQLPVFPGVLILEA 69

Query: 73  MAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           MAQ  G +      F  +  P      Y  S+DKA+FRKPV PGD+L   V  ++ R  +
Sbjct: 70  MAQATGLLA-----FKSFGAPKGNELYYFASVDKAKFRKPVVPGDQLIIEVEFIKERRGI 124

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
             F   AKV+  VV  AE+ CA
Sbjct: 125 AAFNGVAKVDGEVVCSAELKCA 146


>gi|78223557|ref|YP_385304.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacter metallireducens
           GS-15]
 gi|91206632|sp|Q39T45|FABZ_GEOMG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|78194812|gb|ABB32579.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Geobacter
           metallireducens GS-15]
          Length = 150

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 84/138 (60%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHRYPFLLVD++V     E  +GIKNVT NEP F GHFPG P+MPGVLI+E
Sbjct: 6   DINEIMKILPHRYPFLLVDRIVEHVPGERIVGIKNVTINEPFFQGHFPGHPIMPGVLIVE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G I A     D+      Y  SID  +FRKPV PGD+L   V     +  +W F
Sbjct: 66  AMAQV-GGILAYMASDDEVRNKVCYFASIDNVKFRKPVLPGDQLRIEVAATGCKRGIWCF 124

Query: 130 QCCAKVENTVVAEAEICA 147
              A V+  V  +AE+ A
Sbjct: 125 SAKAIVKGKVTTQAELKA 142


>gi|188997396|ref|YP_001931647.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932463|gb|ACD67093.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 11  KDIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           +D++++M  LPHRYPFLLVD+++ I  +   I  +KNVT NEP FMGHFPG PVMPGVLI
Sbjct: 2   EDVLKIMEVLPHRYPFLLVDRILEIDVENMKIKALKNVTINEPFFMGHFPGNPVMPGVLI 61

Query: 70  LEGMAQTAGAI----CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           +E MAQ    +      I +G   +A     SI++A+FRKPV PGD++ + V  +  +  
Sbjct: 62  IEAMAQVGAYLMLKKAGIEDGIVLFA-----SIEEAKFRKPVVPGDQIIFEVEGINIKKS 116

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
           + K +  AKV++ VV EA + A V
Sbjct: 117 MGKIKAIAKVDDQVVCEAILMAAV 140


>gi|257459197|ref|ZP_05624316.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter gracilis RM3268]
 gi|257443582|gb|EEV18706.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Campylobacter gracilis RM3268]
          Length = 149

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 92/145 (63%), Gaps = 6/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHR+PFLL+D+V  +   ES    KNVT+NE  F GHFPG P+ PGV+I+E
Sbjct: 3   DINEILSILPHRFPFLLIDRVEELSIGESIKAYKNVTYNEQIFQGHFPGHPIYPGVMIIE 62

Query: 72  GMAQTAGAIC---AIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           G+AQ  G +       +G D      Y MSID A+FR PV PGD+LEY ++ ++ R  +W
Sbjct: 63  GLAQAGGVLAFKSMEKDGVDLSDKVVYFMSIDNAKFRNPVRPGDKLEYRISVIKYRGRIW 122

Query: 128 KFQCCAKVEN--TVVAEAEICAMVM 150
             +  A + +  T+ A+AE+ AM+M
Sbjct: 123 VLKGEAYINDGATLAAQAELQAMIM 147


>gi|268590521|ref|ZP_06124742.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Providencia rettgeri DSM 1131]
 gi|291314107|gb|EFE54560.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Providencia rettgeri DSM 1131]
          Length = 150

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 96/148 (64%), Gaps = 5/148 (3%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD   L+ ++I+EL   LPHRYPFLLVD+V++ ++ +S   +KNV+FNEP F GHFP +
Sbjct: 1   MSDNHTLNIEEILEL---LPHRYPFLLVDRVLDFEKGKSLRAVKNVSFNEPFFQGHFPSK 57

Query: 62  PVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           P+ PGVLILE MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  +
Sbjct: 58  PIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDNARFKRPVLPGDQMVLEVEFI 117

Query: 121 RNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           + R  + +F+  AKV+  V  EAE +CA
Sbjct: 118 KERRGVARFKGVAKVDGEVACEAEMMCA 145


>gi|315127153|ref|YP_004069156.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas sp. SM9913]
 gi|315015667|gb|ADT69005.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Pseudoalteromonas sp. SM9913]
          Length = 150

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 91/144 (63%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E++  LPHRYP LL+D+V++    ES   IKNV+ NEP F GHFP +P+ PGV
Sbjct: 5   LNSLDIQEILSLLPHRYPMLLIDRVIDFTPGESLHAIKNVSINEPIFTGHFPNQPIFPGV 64

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +    + N  +     YL  ++D ARF++PV PGD +  HV  ++ R 
Sbjct: 65  LILESMAQATGLLGFKTVENRSENEL--YLFAAVDNARFKQPVVPGDTMHLHVKFLKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
           ++WKF   AKV+   V  AEI CA
Sbjct: 123 NIWKFAAEAKVDGKTVCSAEIMCA 146


>gi|258592399|emb|CBE68708.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [NC10
           bacterium 'Dutch sediment']
          Length = 159

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 90/140 (64%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD+++ I+  +  +G+KNVT NE  F GHFPG+PVMPGVL++E
Sbjct: 3   DIRQIQEMLPHRYPFLLVDRILEIEPGKRVVGLKNVTINESFFQGHFPGQPVMPGVLVIE 62

Query: 72  GMAQTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     N   +    Y   ID A+FR+PV PGD++ + +  ++ R    + Q
Sbjct: 63  AMAQVGGVLLMRTLNVSAEKKLVYFTGIDHAKFRRPVLPGDQVRFEIELLQIRSRNCRMQ 122

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A V++ +VAEAE+  MV+
Sbjct: 123 AMAFVQDKLVAEAELSCMVV 142


>gi|153003990|ref|YP_001378315.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaeromyxobacter sp.
           Fw109-5]
 gi|166233409|sp|A7H9D5|FABZ_ANADF RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|152027563|gb|ABS25331.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaeromyxobacter sp. Fw109-5]
          Length = 158

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 98/158 (62%), Gaps = 3/158 (1%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++ A     D+  + R LPHR PFLLVD+VV ++     +  K+VT NEP F+GHFPG
Sbjct: 1   MSAERASAPVMDVEAIQRILPHRPPFLLVDRVVAVEPGVRLVAWKSVTMNEPFFVGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAP---PYLMSIDKARFRKPVFPGDRLEYHV 117
           +PVMPGVLILE +AQ    +     G D+       YLMSID A+FR+PV PGDRLE HV
Sbjct: 61  KPVMPGVLILEALAQACALLAVKSMGPDEDVDEKITYLMSIDGAKFRRPVVPGDRLELHV 120

Query: 118 NKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
             V+ +  +W+ +  A V+   VAEA+  AM+   ++E
Sbjct: 121 EVVKRKGAIWRQKGTAIVDGQTVAEADFMAMLADREQE 158


>gi|226700727|sp|A4G4T2|FABZ_HERAR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|193222298|emb|CAL61519.2| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) [Herminiimonas
           arsenicoxydans]
          Length = 156

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ ++LPHRYP LLVD+V+  +  +S   IKNVT NE  F GHFP +PVMPGVL++E
Sbjct: 5   DINQIKQYLPHRYPMLLVDRVLTWESGKSITAIKNVTANEEFFNGHFPHKPVMPGVLMIE 64

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA  +  +  G   D  +  Y + ID ARF++PV PGD+L+  V  +RN   +WK+
Sbjct: 65  ALAQTAALLSFLTMGQKPDDNSVVYFIGIDGARFKRPVEPGDQLKMEVEILRNARGIWKY 124

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +    V+  +  EAE+ C M
Sbjct: 125 KATGSVDGQLALEAELMCTM 144


>gi|221066096|ref|ZP_03542201.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Comamonas
           testosteroni KF-1]
 gi|299532315|ref|ZP_07045708.1| (3R)-hydroxymyristoyl-ACP dehydratase [Comamonas testosteroni S44]
 gi|220711119|gb|EED66487.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Comamonas
           testosteroni KF-1]
 gi|298719723|gb|EFI60687.1| (3R)-hydroxymyristoyl-ACP dehydratase [Comamonas testosteroni S44]
          Length = 146

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 94/142 (66%), Gaps = 2/142 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++ LPHRYPFLLVD+V+ ++R+     IKNVTFNEP F GHFPGRPVMPGVLILE
Sbjct: 3   DIQEILKQLPHRYPFLLVDRVLELERNTRIKAIKNVTFNEPFFTGHFPGRPVMPGVLILE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG +   A+    D+    Y + ID ARF++PV PGD+L   +   R R  +WKF
Sbjct: 63  ALAQAAGLLAFDAMGQVPDENNIYYFVGIDSARFKRPVVPGDQLALEITIDRVRGGIWKF 122

Query: 130 QCCAKVENTVVAEAEICAMVMH 151
              A V+  V AEA++   + H
Sbjct: 123 NAVASVDGEVAAEAQLMCTMRH 144


>gi|261253717|ref|ZP_05946290.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           orientalis CIP 102891]
 gi|260937108|gb|EEX93097.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           orientalis CIP 102891]
          Length = 150

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLIDRVIDFQEEKYLTAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVVPGDQLIIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F+  AKV+  VV  AE+ CA
Sbjct: 124 IAAFKGVAKVDGEVVCSAELKCA 146


>gi|264679356|ref|YP_003279263.1| beta-hydroxyacyl-(acyl-carrier-protein) [Comamonas testosteroni
           CNB-2]
 gi|262209869|gb|ACY33967.1| beta-hydroxyacyl-(acyl-carrier-protein) [Comamonas testosteroni
           CNB-2]
          Length = 145

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 94/142 (66%), Gaps = 2/142 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++ LPHRYPFLLVD+V+ ++R+     IKNVTFNEP F GHFPGRPVMPGVLILE
Sbjct: 2   DIQEILKQLPHRYPFLLVDRVLELERNTRIKAIKNVTFNEPFFTGHFPGRPVMPGVLILE 61

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG +   A+    D+    Y + ID ARF++PV PGD+L   +   R R  +WKF
Sbjct: 62  ALAQAAGLLAFDAMGQVPDENNIYYFVGIDSARFKRPVVPGDQLALEITIDRVRGGIWKF 121

Query: 130 QCCAKVENTVVAEAEICAMVMH 151
              A V+  V AEA++   + H
Sbjct: 122 NAVASVDGEVAAEAQLMCTMRH 143


>gi|242240385|ref|YP_002988566.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Dickeya
           dadantii Ech703]
 gi|242132442|gb|ACS86744.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Dickeya
           dadantii Ech703]
          Length = 151

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+V+N +  +    +KNVT NEP F GHFPG+P+ PGVLILE
Sbjct: 9   DIGEILDLLPHRYPFLLVDRVLNFEEGKFLRAVKNVTVNEPFFQGHFPGKPIFPGVLILE 68

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y  +ID+ARF++PV PGD++   V  ++ R  + +F+
Sbjct: 69  AMAQATGILAFKSVGKLEPGELYYFAAIDEARFKRPVLPGDQMILEVEFIKERRGVARFR 128

Query: 131 CCAKVENTVVAEAE-ICA 147
             AKV+  V  EAE +CA
Sbjct: 129 GVAKVDGEVACEAEMMCA 146


>gi|332289938|ref|YP_004420790.1| hypothetical protein UMN179_01878 [Gallibacterium anatis UMN179]
 gi|330432834|gb|AEC17893.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 151

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 88/137 (64%), Gaps = 1/137 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHRYPFLLVD+V++ +  +    IKNV+ NEP F GHFP +P+ PGVLILE
Sbjct: 11  DIDEIMQLLPHRYPFLLVDRVLDFEEGKWIKAIKNVSVNEPCFTGHFPQKPIFPGVLILE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ AG +        +    Y  +ID ARF+KPVFPGD+L   +   R R  + +F+ 
Sbjct: 71  ALAQAAGVLAFKTTQLSENELYYFAAIDNARFKKPVFPGDQLLLTIEFERERRGVMRFKG 130

Query: 132 CAKVENTVVAEAEI-CA 147
            A ++  +V EA++ CA
Sbjct: 131 VATIDGQLVCEADLMCA 147


>gi|302383597|ref|YP_003819420.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302194225|gb|ADL01797.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 158

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 90/156 (57%), Gaps = 12/156 (7%)

Query: 2   ISDLACLDAK-DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           ++D    D K D  E+MR LPHRYPFLLVDK        S +GIKNVT NEP F GHFP 
Sbjct: 1   MTDPTTDDIKIDYAEVMRRLPHRYPFLLVDKAEAFVPATSIVGIKNVTHNEPFFPGHFPI 60

Query: 61  RPVMPGVLILEGMAQTAGAI------CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLE 114
            PVMPGVLI+E MAQT   +       A+ +    +     MSID  RFRKP  PGD+L 
Sbjct: 61  DPVMPGVLIVEAMAQTGALLMSKTLDVAVADKVIMF-----MSIDGVRFRKPARPGDQLR 115

Query: 115 YHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVM 150
             V   R R D +KF+    +E  + AEAE  AMV+
Sbjct: 116 MEVKVTRARGDAYKFRGETFIEGKLAAEAEFMAMVV 151


>gi|330445156|ref|ZP_08308808.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489347|dbj|GAA03305.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 151

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL++D+V+N    ++   IKNV+ NEP F GHFP  PV PGV+ILE
Sbjct: 9   NITEIQELLPHRYPFLMIDRVINYDEGKTLTAIKNVSVNEPQFTGHFPNMPVFPGVMILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPAENELYYFASIDKAKFRKPVGPGDQLVLEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAMFNGVAKVDGEVVCSAELKCA 146


>gi|297565313|ref|YP_003684285.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Meiothermus silvanus DSM 9946]
 gi|296849762|gb|ADH62777.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Meiothermus silvanus DSM 9946]
          Length = 142

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 91/142 (64%), Gaps = 3/142 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI+E+++FLPHRYPFLL+D+V  ++ DE     +KNVT NEPHF GHFPG P+MPGVLIL
Sbjct: 2   DILEILKFLPHRYPFLLIDRV--LEADEKHFKALKNVTINEPHFTGHFPGYPIMPGVLIL 59

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E MAQ + A+ A   G       +L++++ ARF+KPV PGD L      +  R  L K +
Sbjct: 60  ESMAQASIAVVAKQPGVQPGGLVFLVAVEDARFKKPVVPGDTLVLQGELLTFRRGLGKVR 119

Query: 131 CCAKVENTVVAEAEICAMVMHE 152
             A V+  V AEA +  +V  E
Sbjct: 120 VQALVDEEVHAEATLTFVVRGE 141


>gi|312879631|ref|ZP_07739431.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Aminomonas
           paucivorans DSM 12260]
 gi|310782922|gb|EFQ23320.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Aminomonas
           paucivorans DSM 12260]
          Length = 151

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+E+   LPHRYPFLLVD+++  + +   +GIKNVT NEP F GHFP  PVMPGVL+LE
Sbjct: 3   DILEIQARLPHRYPFLLVDRILEAEGNR-VVGIKNVTINEPFFQGHFPQEPVMPGVLVLE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            M Q A  I ++  GF++    +L S+++A+FR+PV PGD+L      V+ R  + K   
Sbjct: 62  AMGQVASIIVSLQPGFEKMV-AFLTSVEEAKFRRPVRPGDQLRTEAELVKFRSRMGKIHA 120

Query: 132 CAKVENTVVAEAEI 145
              V+  +VAEA +
Sbjct: 121 RGTVDGELVAEATL 134


>gi|160902499|ref|YP_001568080.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Petrotoga
           mobilis SJ95]
 gi|189044392|sp|A9BK14|FABZ_PETMO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|160360143|gb|ABX31757.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Petrotoga
           mobilis SJ95]
          Length = 139

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/134 (48%), Positives = 88/134 (65%), Gaps = 3/134 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+M+ LPHRYPFLLVD V+ +  +E     KNV+ NE  F GHFP  P+MPGVLI+E
Sbjct: 2   NIEEIMKILPHRYPFLLVDGVLELN-EEKIKAFKNVSINESFFQGHFPNYPIMPGVLIVE 60

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           GMAQTAG +  +    D+   P    IDKARF+K V PGD+L Y +  ++ + +++K + 
Sbjct: 61  GMAQTAGLL--LLKDTDENVIPLFTGIDKARFKKEVRPGDKLIYDLEILQKKANMFKLKG 118

Query: 132 CAKVENTVVAEAEI 145
            A VE  V A+AEI
Sbjct: 119 IATVEEQVCAQAEI 132


>gi|170692153|ref|ZP_02883316.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia graminis C4D1M]
 gi|209518719|ref|ZP_03267535.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. H160]
 gi|295676814|ref|YP_003605338.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1002]
 gi|296158893|ref|ZP_06841721.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. Ch1-1]
 gi|307729342|ref|YP_003906566.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1003]
 gi|323526477|ref|YP_004228630.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1001]
 gi|170142583|gb|EDT10748.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia graminis C4D1M]
 gi|209500833|gb|EEA00873.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. H160]
 gi|295436657|gb|ADG15827.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1002]
 gi|295890768|gb|EFG70558.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. Ch1-1]
 gi|307583877|gb|ADN57275.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1003]
 gi|323383479|gb|ADX55570.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia sp. CCGE1001]
          Length = 154

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 92/145 (63%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYP LLVD+V+ ++  +S   +KNV+ NEP+F GHFP RPVMPGVLILE
Sbjct: 9   DIHKILTLLPHRYPILLVDRVLELEPHKSIKALKNVSINEPYFQGHFPTRPVMPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTA  +       D     YL + ID ARF++ V PGD+L  +    R+   +WKF+
Sbjct: 69  ALAQTAALLTFSEEPSDPSNTLYLFVGIDNARFKRVVEPGDQLILNCTFERHMRGIWKFK 128

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             A+V+  V AEA++   V H  K+
Sbjct: 129 ARAEVDGVVAAEADLMCAVRHTDKD 153


>gi|186476085|ref|YP_001857555.1| (3R)-hydroxymyristoyl-ACP dehydratase [Burkholderia phymatum
           STM815]
 gi|184192544|gb|ACC70509.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia phymatum STM815]
          Length = 153

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 93/139 (66%), Gaps = 2/139 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYP LLVD+V+ ++  +S   +KNV+ NEP+FMGHFP RPVMPGVLILE
Sbjct: 9   DIHKILTLLPHRYPILLVDRVLELEPHKSIKALKNVSINEPYFMGHFPKRPVMPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTA  +       D     YL + ID ARF++ V PGD+L  +V   R+   +WKF+
Sbjct: 69  ALAQTAALLTFAEEPHDPDNTLYLFVGIDNARFKRVVEPGDQLILNVTFERHMRGIWKFK 128

Query: 131 CCAKVENTVVAEAEI-CAM 148
             A+V+  V AEA++ CA+
Sbjct: 129 ARAEVDGQVAAEADLMCAV 147


>gi|15605653|ref|NP_213028.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Aquifex
           aeolicus VF5]
 gi|14423691|sp|O66468|FABZ_AQUAE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|2982801|gb|AAC06425.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Aquifex
           aeolicus VF5]
          Length = 150

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 89/138 (64%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  LPHRYP LLVDK++ I+  +  IG+KNV+ NEP F GHFPG P+ PGV ILE
Sbjct: 2   DIQEIMEILPHRYPILLVDKILEIEEGKRIIGLKNVSVNEPVFQGHFPGFPLFPGVYILE 61

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G   I +++    +YA  +   ID ARF+KPV+PGD+L   +  +  +  L K 
Sbjct: 62  AMAQVGGILMIKSLNLEIGKYAVVF-AGIDDARFKKPVYPGDQLILELEVISLKKALSKM 120

Query: 130 QCCAKVENTVVAEAEICA 147
           +  AKV+  VVA+A + A
Sbjct: 121 KGVAKVDGEVVAQATLMA 138


>gi|261344725|ref|ZP_05972369.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Providencia rustigianii DSM 4541]
 gi|282567167|gb|EFB72702.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Providencia rustigianii DSM 4541]
          Length = 150

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD   L+ ++I+EL   LPHRYPFLLVD+V++ +  +S   +KNV+FNEP F GHFP +
Sbjct: 1   MSDNHTLNIEEILEL---LPHRYPFLLVDRVLDFEEGKSLRAVKNVSFNEPFFQGHFPSK 57

Query: 62  PVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           P+ PGVLILE MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  +
Sbjct: 58  PIFPGVLILEAMAQATGILAFKRVGKLEPGELYYFAAIDNARFKRPVLPGDQMILEVEFI 117

Query: 121 RNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           + R  + +F+  AKV+  V  EAE +CA
Sbjct: 118 KERRGVARFKGVAKVDGEVACEAEMMCA 145


>gi|149374426|ref|ZP_01892200.1| (3R)-hydroxymyristoyl ACP dehydratase [Marinobacter algicola DG893]
 gi|149361129|gb|EDM49579.1| (3R)-hydroxymyristoyl ACP dehydratase [Marinobacter algicola DG893]
          Length = 145

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 86/135 (63%), Gaps = 2/135 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+M +LPHRYPFLLVD+V  +++ +S  G KN++ NEP F GHFP  P+MPGVLI+E 
Sbjct: 4   IDEIMEYLPHRYPFLLVDRVTELEKGQSIKGYKNISLNEPFFTGHFPNNPIMPGVLIIEA 63

Query: 73  MAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           MAQ +G +  +  G         YL    KARF++PV PGDRL      +  +  ++KF+
Sbjct: 64  MAQLSGILGFVTVGRKPSDGVVQYLAGSSKARFKRPVVPGDRLCMESQVISGKRGIYKFE 123

Query: 131 CCAKVENTVVAEAEI 145
           C A V++ VV  AEI
Sbjct: 124 CRALVDDEVVCVAEI 138


>gi|302878993|ref|YP_003847557.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Gallionella capsiferriformans ES-2]
 gi|302581782|gb|ADL55793.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Gallionella capsiferriformans ES-2]
          Length = 156

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 92/142 (64%), Gaps = 2/142 (1%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI  ++  LPHRYPFLLVD+V++++  ++ + +KNVT NEP F GH+P  PVMPGVLI
Sbjct: 11  AMDIHAILESLPHRYPFLLVDRVLSVEPGKNIVALKNVTINEPFFPGHYPHHPVMPGVLI 70

Query: 70  LEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           +E MAQ A  +   ++    D+    Y   ID ARF++PV PGD+L + V   R+   ++
Sbjct: 71  IEAMAQVAALLSFQSMEKKPDENTVYYFAGIDGARFKRPVTPGDQLIFKVELTRSMRGVY 130

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF+  A+V+  + AEAE+   V
Sbjct: 131 KFKAIAEVDGQLAAEAELMCTV 152


>gi|160900369|ref|YP_001565951.1| (3R)-hydroxymyristoyl-ACP dehydratase [Delftia acidovorans SPH-1]
 gi|160365953|gb|ABX37566.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Delftia
           acidovorans SPH-1]
          Length = 146

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/140 (53%), Positives = 96/140 (68%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLLVDKV  ++R+     IKNVTFNEP+FMGHFPGRPVMPGVLILE
Sbjct: 3   DIHAILKQLPHRYPFLLVDKVTELERNTRIKAIKNVTFNEPYFMGHFPGRPVMPGVLILE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG +   A+    D+    Y + ID ARF++PV PGD+L   +   R R  +WKF
Sbjct: 63  ALAQAAGLLAFDAMGQVPDENNIYYFVGIDGARFKRPVEPGDQLVLEITIDRVRGGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A+VE+ V  EAE+ C M
Sbjct: 123 KGVARVEDEVACEAELMCTM 142


>gi|212710386|ref|ZP_03318514.1| hypothetical protein PROVALCAL_01446 [Providencia alcalifaciens DSM
           30120]
 gi|212686968|gb|EEB46496.1| hypothetical protein PROVALCAL_01446 [Providencia alcalifaciens DSM
           30120]
          Length = 150

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD   L+ ++I+EL   LPHRYPFLLVD+V++ +  +S   +KNV+FNEP F GHFP +
Sbjct: 1   MSDNHTLNIEEILEL---LPHRYPFLLVDRVLDFEEGKSLRAVKNVSFNEPFFQGHFPSK 57

Query: 62  PVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           P+ PGVLILE MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  +
Sbjct: 58  PIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDNARFKRPVLPGDQMILEVEFI 117

Query: 121 RNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           + R  + +F+  AKV+  V  EAE +CA
Sbjct: 118 KERRGVARFKGVAKVDGEVACEAEMMCA 145


>gi|190571422|ref|YP_001975780.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213018821|ref|ZP_03334629.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|226700825|sp|B3CMM1|FABZ_WOLPP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190357694|emb|CAQ55143.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995772|gb|EEB56412.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 86/136 (63%), Gaps = 1/136 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ LPH YPFLLVD+V+      S   IKNVTFNE  F+GHFPG P+MPGVLI+E
Sbjct: 4   NINDIIKILPHSYPFLLVDRVIECDPGMSIKAIKNVTFNEQFFIGHFPGHPIMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ A AIC +     +    Y MSI+ A+FRKPV PGD L    N    R+ ++KF+C
Sbjct: 64  SLAQ-ASAICVLGKKTVENKVVYFMSIENAKFRKPVTPGDTLILQSNFEGLRLGVYKFKC 122

Query: 132 CAKVENTVVAEAEICA 147
            A V    VA A I A
Sbjct: 123 VASVGKEEVAGATILA 138


>gi|29653952|ref|NP_819644.1| (3R)-hydroxymyristoyl-ACP dehydratase [Coxiella burnetii RSA 493]
 gi|209363848|ref|YP_001424033.2| (3R)-hydroxymyristoyl-ACP dehydratase [Coxiella burnetii Dugway
           5J108-111]
 gi|212212904|ref|YP_002303840.1| (3R)-hydroxymyristoyl-ACP dehydratase [Coxiella burnetii CbuG_Q212]
 gi|212218965|ref|YP_002305752.1| (3R)-hydroxymyristoyl-ACP dehydratase [Coxiella burnetii CbuK_Q154]
 gi|33516883|sp|Q820W7|FABZ_COXBU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700456|sp|B6J8K8|FABZ_COXB1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700457|sp|B6J167|FABZ_COXB2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|29541215|gb|AAO90158.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Coxiella
           burnetii RSA 493]
 gi|207081781|gb|ABS77995.2| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Coxiella
           burnetii Dugway 5J108-111]
 gi|212011314|gb|ACJ18695.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Coxiella
           burnetii CbuG_Q212]
 gi|212013227|gb|ACJ20607.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Coxiella
           burnetii CbuK_Q154]
          Length = 145

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 93/146 (63%), Gaps = 8/146 (5%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  +I ++ +++PHRYPFLL+D+V+ I++D+S + IKNVT NEP F GHFP RPVMPGV
Sbjct: 1   MNVMNITDIKKYIPHRYPFLLIDRVIKIEKDKSLVAIKNVTVNEPFFTGHFPVRPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGF-----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           LI+E +AQ AG +            D Y   +   +D ARF++ V PGD+L   V  ++ 
Sbjct: 61  LIIESLAQAAGILIVKSLNLPEGHKDIY---FFAGVDNARFKRVVEPGDQLTLEVKVLKV 117

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAM 148
              LWKF+  A V++ +  +AE+  +
Sbjct: 118 HRGLWKFEGKATVDDQLACKAELMTI 143


>gi|329889367|ref|ZP_08267710.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ
           [Brevundimonas diminuta ATCC 11568]
 gi|328844668|gb|EGF94232.1| beta-hydroxyacyl-acyl-carrier-protein dehydratase FabZ
           [Brevundimonas diminuta ATCC 11568]
          Length = 154

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 87/142 (61%), Gaps = 5/142 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  E+MR LPHRYPFLLVDK  +     S +G+KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 8   DYAEVMRRLPHRYPFLLVDKAEDFVAATSIVGVKNVTHNEPFFPGHFPIDPVMPGVLIVE 67

Query: 72  GMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQT GA+  +    D          MSID  RFRKP  PGD+L   V  ++ R D +K
Sbjct: 68  AMAQT-GALL-MSKSLDVAVADKVIMFMSIDGVRFRKPARPGDQLRMEVKVIKARGDAYK 125

Query: 129 FQCCAKVENTVVAEAEICAMVM 150
           F+    ++  + AEAE  AMV+
Sbjct: 126 FRGETFIDGKLAAEAEFMAMVV 147


>gi|170727609|ref|YP_001761635.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella woodyi ATCC
           51908]
 gi|226700815|sp|B1KNT2|FABZ_SHEWM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|169812956|gb|ACA87540.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella woodyi ATCC 51908]
          Length = 152

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 88/142 (61%), Gaps = 2/142 (1%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+M FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEIMSFLPHRYPFLLIDRVLDYTPGETLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LILE MAQ  G +         + +  Y   IDKARF++ V PGD+L + V  ++ R  +
Sbjct: 65  LILEAMAQATGLLAYKTMKEASEDSLYYFAGIDKARFKRVVEPGDQLHFEVKMIKERRGI 124

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
             F    KV+  +V  AEI CA
Sbjct: 125 GVFTGEVKVDGELVCSAEIMCA 146


>gi|148653591|ref|YP_001280684.1| (3R)-hydroxymyristoyl-ACP dehydratase [Psychrobacter sp. PRwf-1]
 gi|148572675|gb|ABQ94734.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Psychrobacter sp.
           PRwf-1]
          Length = 185

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 84/135 (62%), Gaps = 2/135 (1%)

Query: 16  LMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQ 75
           L R+LPHRYPF+LVD+V +    +   G KNVT NEP F GHFP +P+MPGVLI+E +AQ
Sbjct: 44  LKRYLPHRYPFMLVDRVTDCSSGQWISGYKNVTINEPFFQGHFPEQPIMPGVLIVEALAQ 103

Query: 76  TAGAICAIHNGFDQYAPPYLM--SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
            +G +  I  G         +   +DK RFR PV PGD+L      +  + D++KF+C A
Sbjct: 104 VSGVLAFISRGISAADGHLFLFAGVDKVRFRCPVVPGDKLILKSRLLTQKRDVYKFECKA 163

Query: 134 KVENTVVAEAEICAM 148
            VE+T+ A AE+  M
Sbjct: 164 YVEDTLAASAELMIM 178


>gi|120599541|ref|YP_964115.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella sp. W3-18-1]
 gi|146292462|ref|YP_001182886.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella putrefaciens
           CN-32]
 gi|158512981|sp|A1RLL6|FABZ_SHESW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233438|sp|A4Y554|FABZ_SHEPC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|120559634|gb|ABM25561.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella sp.
           W3-18-1]
 gi|145564152|gb|ABP75087.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           putrefaciens CN-32]
 gi|319425764|gb|ADV53838.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella putrefaciens 200]
          Length = 154

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNV+ NEP F GHFP +PVMPGV
Sbjct: 5   MNTMDITEILKYLPHRYPFLLIDRVLDYTPGESLHAIKNVSINEPFFQGHFPIQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A     +   PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 65  LILEAMAQATG-LLAFKTMSNDVPPPGVLYYFAGIDNARFRRVVVPGDQIHFEVKMIKER 123

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   A+V+  V   AEI CA
Sbjct: 124 RGIGVFYGEARVDGEVACSAEIMCA 148


>gi|258517185|ref|YP_003193407.1| (3R)-hydroxymyristoyl-ACP dehydratase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257780890|gb|ACV64784.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 141

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 85/135 (62%), Gaps = 3/135 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHRYPFLLVDK+  ++  +  +G KNVT NEP F GHFPG PVMPGVL++E
Sbjct: 3   DINEIMKVLPHRYPFLLVDKIEEMEAGKRVVGYKNVTINEPFFQGHFPGFPVMPGVLVIE 62

Query: 72  GMAQT-AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  A AI ++     + A  +   IDKARFR+ V PGDRL   V     R  + K  
Sbjct: 63  AMAQVGAAAILSMPEYAGKIA--FFAGIDKARFRRQVVPGDRLRIVVEVTNLRKTIGKST 120

Query: 131 CCAKVENTVVAEAEI 145
             A V+  V AEAE+
Sbjct: 121 AVAYVDEAVAAEAEL 135


>gi|310778910|ref|YP_003967243.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Ilyobacter
           polytropus DSM 2926]
 gi|309748233|gb|ADO82895.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Ilyobacter
           polytropus DSM 2926]
          Length = 141

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (63%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDE-SAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           +++E+M  +PHRYPFLLVDK+V + ++E   +GIKNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   NVMEIMERIPHRYPFLLVDKIVELDKEELKIVGIKNVTINEDFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +    NG      PY  +I+  +F+ PV PGD++ Y  N  + R ++ K  
Sbjct: 63  EGMAQCLGVLVMEPNGSQV---PYFAAIENVKFKAPVRPGDQIVYECNVNKLRRNIVKAH 119

Query: 131 CCAKVENTVVAEAEICAMVM 150
             AKV+  VV EA     +M
Sbjct: 120 AVAKVDGKVVTEASFTFTIM 139


>gi|119471156|ref|ZP_01613688.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Alteromonadales bacterium TW-7]
 gi|119445812|gb|EAW27094.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Alteromonadales bacterium TW-7]
          Length = 150

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 92/144 (63%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E++  LPHRYP LL+D+V++    ++   IKNV+ NEP F GHFP +P+ PGV
Sbjct: 5   LNSLDIQEILALLPHRYPMLLIDRVIDFTPGKTLHAIKNVSINEPIFTGHFPNQPIFPGV 64

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +    + N  +     YL  ++D ARF++PV PGD L  HV  ++ R 
Sbjct: 65  LILEAMAQATGLLGFKTVENRSEDEL--YLFAAVDNARFKQPVVPGDTLHLHVEFLKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
           ++WKF   AKV+  VV  AEI CA
Sbjct: 123 NIWKFAAEAKVDGKVVCSAEIMCA 146


>gi|127513552|ref|YP_001094749.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella loihica PV-4]
 gi|158513474|sp|A3QG92|FABZ_SHELP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|126638847|gb|ABO24490.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           loihica PV-4]
          Length = 153

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 89/143 (62%), Gaps = 3/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+++FLPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP  PVMPGV
Sbjct: 5   LNTMDIKEILKFLPHRYPFLLIDRVLDFTPGETLHAIKNVTINEPFFQGHFPVAPVMPGV 64

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE MAQ  G  A   + +     A  Y   ID ARF++ V PGD+L + V  ++ R  
Sbjct: 65  LILEAMAQATGLLAFKTMSDEPSNDALYYFAGIDNARFKRVVEPGDQLHFEVKMIKERRG 124

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  +V  AEI CA
Sbjct: 125 IGVFTGEAKVDGELVCSAEIMCA 147


>gi|59712558|ref|YP_205334.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio fischeri ES114]
 gi|197334912|ref|YP_002156779.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           fischeri MJ11]
 gi|75353548|sp|Q5E3F0|FABZ_VIBF1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700824|sp|B5F9W5|FABZ_VIBFM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|59480659|gb|AAW86446.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Vibrio
           fischeri ES114]
 gi|197316402|gb|ACH65849.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           fischeri MJ11]
          Length = 150

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLLVD+V + + ++    IKNV+ NEP F GHFP  P+ PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLVDRVTDFEEEKYLHAIKNVSVNEPQFTGHFPQMPIFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L   V  +++R  
Sbjct: 69  AMAQATGLL-----AFKSFGAPAENELYYFASIDKAKFRKPVVPGDQLVLEVEFIKDRRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IALFNGVAKVDGEVVCSAELKCA 146


>gi|332532235|ref|ZP_08408116.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038333|gb|EGI74778.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 150

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 92/144 (63%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L++ DI E++  LPHRYP LL+D+V++    +S   IKNV+ NEP F GHFP +P+ PGV
Sbjct: 5   LNSLDIQEILSLLPHRYPMLLIDRVIDFTPGKSLHAIKNVSINEPIFTGHFPNQPIFPGV 64

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +    + N  +     YL  ++D ARF++PV PGD +  HV  ++ R 
Sbjct: 65  LILESMAQATGLLGFKTVENRSENEL--YLFAAVDNARFKQPVIPGDTMHLHVEFLKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
           ++WKF   A+V+  VV  AEI CA
Sbjct: 123 NIWKFAAEARVDGKVVCSAEIMCA 146


>gi|237756077|ref|ZP_04584655.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691770|gb|EEP60800.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 11  KDIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           +DI+++M  LPHRYPFLLVD+++ I  +   I  +KNVT NEP F+GHFPG PVMPGVLI
Sbjct: 2   EDILKIMEVLPHRYPFLLVDRILEIDIENLKIKALKNVTINEPFFIGHFPGNPVMPGVLI 61

Query: 70  LEGMAQTAGAI----CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           +E MAQ    +      I +G   +A     SI++A+FRKPV PGD++ + V  +  +  
Sbjct: 62  IEAMAQVGAYLMLKKAGIEDGIVLFA-----SIEEAKFRKPVVPGDQIIFEVEGINIKKS 116

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
           + K +  AKV++ VV EA + A V
Sbjct: 117 MGKIKAVAKVDDQVVCEAILMAAV 140


>gi|209695840|ref|YP_002263770.1| (3R)-hydroxymyristoyl-ACP dehydratase [Aliivibrio salmonicida
           LFI1238]
 gi|208009793|emb|CAQ80100.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Aliivibrio salmonicida LFI1238]
          Length = 159

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 86/142 (60%), Gaps = 12/142 (8%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+   LPHRYPFLL+D+V++ + ++    IKNV+ NEP F GHFP  P+ PGVLILE 
Sbjct: 19  ITEIQALLPHRYPFLLIDRVIDFEEEKYLHAIKNVSVNEPQFTGHFPQMPIFPGVLILEA 78

Query: 73  MAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L   V  +++R  +
Sbjct: 79  MAQATGLL-----AFKSFGAPAENELYYFASIDKAKFRKPVVPGDQLVLEVEFIKDRRGI 133

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
             F   AKV+  VV  AE+ CA
Sbjct: 134 ALFNGVAKVDGAVVCSAELKCA 155


>gi|85059910|ref|YP_455612.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sodalis glossinidius str.
           'morsitans']
 gi|109828978|sp|Q2NRL8|FABZ_SODGM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|84780430|dbj|BAE75207.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Sodalis
           glossinidius str. 'morsitans']
          Length = 151

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHR+PFLLVD+V++ ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRFPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHV 117
           +P+ PGVLILE MAQ  G +     G  + AP    Y  +ID+ARF++PV PGD++   V
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSAG--KLAPGELYYFAAIDEARFKRPVQPGDQMILEV 115

Query: 118 NKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
             ++ R  + +F+  AKV+  V  EA  +CA
Sbjct: 116 EFIKERRGVARFKGVAKVDGEVACEASMMCA 146


>gi|220903882|ref|YP_002479194.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868181|gb|ACL48516.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 155

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 85/144 (59%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++R LPHRYPFLLVD+VV           KN+TFNEP F GHFPG P+MPGVLILE
Sbjct: 12  DIQRILRLLPHRYPFLLVDRVVECVAGSHIKAYKNITFNEPFFQGHFPGAPIMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT G + A   G           +D  +FR+ V PGDRL+   + +R ++ L K + 
Sbjct: 72  ALAQTGGLLAASGMGDLDDKLFLFTGLDGVKFRRQVVPGDRLDLECSNIRMKLKLCKMEA 131

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  + AEA+I A +    K+
Sbjct: 132 RAFVDGKLAAEAQITAAIGDRPKD 155


>gi|290473668|ref|YP_003466540.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Xenorhabdus
           bovienii SS-2004]
 gi|289172973|emb|CBJ79744.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Xenorhabdus
           bovienii SS-2004]
          Length = 150

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 9/150 (6%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SD   L  ++I++L   LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+
Sbjct: 1   MSDNRTLQIEEILDL---LPHRYPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGK 57

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVN 118
           P+ PGVLILE MAQ  G +     G    AP    Y  +ID ARF++PV PGD++   V 
Sbjct: 58  PIFPGVLILEAMAQATGILAFKSVG--SLAPGELYYFAAIDGARFKRPVLPGDQMVLEVE 115

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            ++ R  + +F+  AKV+  V  EAE +CA
Sbjct: 116 FIKERRGVARFKGVAKVDGEVACEAEMMCA 145


>gi|260775275|ref|ZP_05884172.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608456|gb|EEX34621.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 150

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLIDRVIDFQEEKYLKAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVTPGDQLVIEVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAAFNGVAKVDGEVVCSAELKCA 146


>gi|161831106|ref|YP_001596539.1| (3R)-hydroxymyristoyl-ACP dehydratase [Coxiella burnetii RSA 331]
 gi|164686046|ref|ZP_01947554.2| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165924224|ref|ZP_02220056.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Coxiella
           burnetii RSA 334]
 gi|189038256|sp|A9KC35|FABZ_COXBN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190359381|sp|A9NC99|FABZ_COXBR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|161762973|gb|ABX78615.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Coxiella
           burnetii RSA 331]
 gi|164601602|gb|EAX31823.2| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165916328|gb|EDR34932.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Coxiella
           burnetii RSA 334]
          Length = 142

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 91/142 (64%), Gaps = 8/142 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++ +++PHRYPFLL+D+V+ I++D+S + IKNVT NEP F GHFP RPVMPGVLI+E
Sbjct: 2   NITDIKKYIPHRYPFLLIDRVIKIEKDKSLVAIKNVTVNEPFFTGHFPVRPVMPGVLIIE 61

Query: 72  GMAQTAGAICAIHNGF-----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            +AQ AG +            D Y   +   +D ARF++ V PGD+L   V  ++    L
Sbjct: 62  SLAQAAGILIVKSLNLPEGHKDIY---FFAGVDNARFKRVVEPGDQLTLEVKVLKVHRGL 118

Query: 127 WKFQCCAKVENTVVAEAEICAM 148
           WKF+  A V++ +  +AE+  +
Sbjct: 119 WKFEGKATVDDQLACKAELMTI 140


>gi|300867315|ref|ZP_07111973.1| (3R)-hydroxymyristoyl-ACP dehydratase [Oscillatoria sp. PCC 6506]
 gi|300334669|emb|CBN57139.1| (3R)-hydroxymyristoyl-ACP dehydratase [Oscillatoria sp. PCC 6506]
          Length = 172

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 84/136 (61%), Gaps = 10/136 (7%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPF LVD++V     E A+GIKNVTFNEPHF GHFPGRP+MPGVLI+E MA
Sbjct: 36  EIHKLLPHRYPFALVDRIVEYIPGERAVGIKNVTFNEPHFQGHFPGRPIMPGVLIVEAMA 95

Query: 75  QTAGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV-RNRVDLWKF 129
           Q  G + +    +  G   +A      IDK RFR+PV PGDRL   V  +   R    K 
Sbjct: 96  QVGGVVLSQLPNVEQGLFMFA-----GIDKVRFRRPVVPGDRLVMTVQLLCVKRRRFGKV 150

Query: 130 QCCAKVENTVVAEAEI 145
           +  A+V+   V E E+
Sbjct: 151 EARAEVDGQRVCEGEL 166


>gi|282856203|ref|ZP_06265486.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pyramidobacter piscolens W5455]
 gi|282585962|gb|EFB91247.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pyramidobacter piscolens W5455]
          Length = 147

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 95/148 (64%), Gaps = 3/148 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYPFLLVD++  +   +S + IKNVT NEP F GHFPG PVMPGVLILE
Sbjct: 3   DIREIMSCVPHRYPFLLVDRIQELVPGKSVVAIKNVTINEPFFQGHFPGEPVMPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ AGA+  ++    +    +L ++++A+FR+PV PGD+L  +    R    + K + 
Sbjct: 63  AMAQ-AGAMMVLNIPELRGTIAFLTTVNRAKFRRPVVPGDQLVIYTEMGRIFGKMGKVKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKEKNES 159
            A+VE   VAEAE+  M+   KK + E 
Sbjct: 122 HAEVEGKTVAEAELGFML--TKKPEGEK 147


>gi|153831002|ref|ZP_01983669.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 623-39]
 gi|148873510|gb|EDL71645.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 623-39]
          Length = 153

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 12  NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 72  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVELLKERRG 126

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 127 IALFNGVAKVDGDVVCSAQLKCA 149


>gi|149907542|ref|ZP_01896289.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Moritella
           sp. PE36]
 gi|149809212|gb|EDM69141.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Moritella
           sp. PE36]
          Length = 151

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 87/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+M  LPHRYPFLLVD+V++    +S   IKNV+ NEP F GHFP  P+ PGVLILE
Sbjct: 9   EIQEIMSLLPHRYPFLLVDRVLDYVPGKSIHAIKNVSVNEPQFTGHFPTNPIFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            +AQ +G +     G+     P      Y   IDKARFRKPV PGD +  H+  ++ R  
Sbjct: 69  ALAQASGLL-----GYKTDGGPGDNELYYFAGIDKARFRKPVVPGDVMHLHIELIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV +AEI CA
Sbjct: 124 IGFFTAIAKVDGKVVCDAEIMCA 146


>gi|119774287|ref|YP_927027.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella amazonensis SB2B]
 gi|158513085|sp|A1S4Q1|FABZ_SHEAM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|119766787|gb|ABL99357.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           amazonensis SB2B]
          Length = 153

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 5/144 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++    ES   IKNVT NEP F+GHFP  PVMPGV
Sbjct: 5   MNTMDIKEILKYLPHRYPFLLIDRVLDFTAGESLHAIKNVTINEPFFVGHFPVAPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G + A      + +P    Y   ID ARF++ V PGD+L + V  ++ R 
Sbjct: 65  LILEAMAQATG-LLAFKTMSSEPSPDVLYYFAGIDNARFKRVVEPGDQLHFEVKMIKERR 123

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +  F   AKV+  +V  AEI CA
Sbjct: 124 GIGVFYGEAKVDGELVCSAEIMCA 147


>gi|332970842|gb|EGK09821.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Psychrobacter sp. 1501(2011)]
          Length = 192

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 87/138 (63%), Gaps = 6/138 (4%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ R+LPHRYPF+LVD+V     +    G KNVT NEP F GHFP +P+MPGVLI+E +A
Sbjct: 49  QIKRYLPHRYPFMLVDRVTGCSPNSWITGYKNVTINEPFFQGHFPEQPIMPGVLIIEALA 108

Query: 75  QTAGAICAIHNGF---DQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           Q +G +  I  G    D Y   +L + +DK RFR PV PGD+L      +  + DL+KF 
Sbjct: 109 QVSGILAFITQGVTAEDGYL--FLFAGVDKVRFRNPVLPGDQLVLKSELMLQKRDLYKFD 166

Query: 131 CCAKVENTVVAEAEICAM 148
           C A V++ +VA A++  M
Sbjct: 167 CKAYVDDKLVASAQLMIM 184


>gi|113868023|ref|YP_726512.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ralstonia eutropha H16]
 gi|194289781|ref|YP_002005688.1| (3r)-hydroxymyristoyl-acp dehydratase [Cupriavidus taiwanensis LMG
           19424]
 gi|123329184|sp|Q0KA27|FABZ_RALEH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700458|sp|B3R2A6|FABZ_CUPTR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|113526799|emb|CAJ93144.1| 3-Hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Ralstonia eutropha H16]
 gi|193223616|emb|CAQ69623.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 149

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 92/142 (64%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+V+  +  +    +KNVT NEP+F GHFP +PVMPGV+ILE
Sbjct: 7   DIRKILKLLPHRYPFLLVDRVLEFEAQKRIKTLKNVTINEPYFQGHFPEQPVMPGVMILE 66

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ+AG +     G D    + A  Y + ID ARF++ V+PGD+L  +V   R    +W
Sbjct: 67  ALAQSAGLLTF---GADMERKEGALYYFVGIDGARFKQVVYPGDQLHMNVTVERYIRGIW 123

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF+  A V++ V  EAE+   V
Sbjct: 124 KFKAFATVDDKVACEAELMCTV 145


>gi|297183307|gb|ADI19444.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured bacterium HF0500_16O16]
          Length = 153

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (63%), Gaps = 3/137 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIV + + +PHRYP LLVD+++ +   E  +G+K+VT NEP F GHFP  PVMPGVLI+E
Sbjct: 18  DIVAIKKIIPHRYPLLLVDRIIEMVPGERVVGLKSVTGNEPFFEGHFPDYPVMPGVLIIE 77

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT GA+  +  G  Q   P+   IDKARFR+ V PGD+L   +  +R R    K   
Sbjct: 78  ALAQT-GAVMMLQEGEVQI--PFFAGIDKARFRRQVVPGDQLRLELVVLRARAGTCKMTA 134

Query: 132 CAKVENTVVAEAEICAM 148
            A V+  + AEAEI A+
Sbjct: 135 KAFVDGELAAEAEIMAV 151


>gi|253996526|ref|YP_003048590.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylotenera mobilis JLW8]
 gi|253983205|gb|ACT48063.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylotenera mobilis JLW8]
          Length = 156

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 95/156 (60%), Gaps = 3/156 (1%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++     + DI E++  LPHRYPF+LVD+V++++  +    IKNV+ NEP+F GHFP 
Sbjct: 1   MTNNATATTSMDIHEILEHLPHRYPFVLVDRVLSLELGKEITAIKNVSVNEPYFPGHFPY 60

Query: 61  RPVMPGVLILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN 118
            PVMPGVLI+E MAQ A  +    +       +  Y   ID ARF+KPV PGD++  +V 
Sbjct: 61  HPVMPGVLIVEAMAQAAAILSFKTMDTKPTDDSVYYFAGIDSARFKKPVSPGDQIVLNVK 120

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAE-ICAMVMHEK 153
             R    +WK+   A V+ TVVAEA+ +C +   EK
Sbjct: 121 IDRILKGIWKYSGVATVDGTVVAEAQMMCILKAIEK 156


>gi|94310388|ref|YP_583598.1| (3R)-hydroxymyristoyl-ACP dehydratase [Cupriavidus metallidurans
           CH34]
 gi|158564226|sp|Q1LNE7|FABZ_RALME RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|93354240|gb|ABF08329.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Cupriavidus
           metallidurans CH34]
          Length = 150

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 91/142 (64%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+V+  +  +    +KNVT NEP+FMGHFP +PVMPGV+ILE
Sbjct: 7   DIRKILKLLPHRYPILLVDRVLEFEPQKRIKTLKNVTINEPYFMGHFPDQPVMPGVMILE 66

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ+AG +     G D    + A  Y + ID ARF++ V+PGD+L  +V   R    +W
Sbjct: 67  ALAQSAGLLTF---GADMERKEGALYYFVGIDGARFKRVVYPGDQLHLNVTVERYIRGIW 123

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF+  A V+  V  EAE+   V
Sbjct: 124 KFKASATVDGEVACEAELMCTV 145


>gi|157376282|ref|YP_001474882.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella sediminis HAW-EB3]
 gi|189044401|sp|A8FY31|FABZ_SHESH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157318656|gb|ABV37754.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella sediminis HAW-EB3]
          Length = 153

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 87/143 (60%), Gaps = 3/143 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+M  LPHRYPFLL+D+V++    E+   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEIMNSLPHRYPFLLIDRVLDYTPGETLHAIKNVTINEPFFQGHFPIQPVMPGV 64

Query: 68  LILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LILE MAQ  G +    +       +  Y   IDKARF++ V PGD+L + V  V+ R  
Sbjct: 65  LILEAMAQATGLLAYKTMEAAVTDDSLYYFAGIDKARFKRVVEPGDQLHFEVKMVKERRG 124

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F    KV+  +V  AEI CA
Sbjct: 125 IGVFTGVVKVDGELVCSAEIMCA 147


>gi|253999109|ref|YP_003051172.1| (3R)-hydroxymyristoyl-ACP dehydratase [Methylovorus sp. SIP3-4]
 gi|313201210|ref|YP_004039868.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Methylovorus sp. MP688]
 gi|253985788|gb|ACT50645.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylovorus sp. SIP3-4]
 gi|312440526|gb|ADQ84632.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Methylovorus sp. MP688]
          Length = 153

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 93/145 (64%), Gaps = 2/145 (1%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            + + DI E++  LPHRYPFLLVDKV++++  +  + +KNV+ NEP F GHFP  PVMPG
Sbjct: 5   AVTSMDIHEILEHLPHRYPFLLVDKVLSLELGKEIVAVKNVSMNEPFFPGHFPYHPVMPG 64

Query: 67  VLILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           VLI+E MAQ A  +    +    +  +  Y   ID ARF+KPV PGD+L   V+  R   
Sbjct: 65  VLIVEAMAQAAAILSFKTMDTKPNDESVYYFAGIDSARFKKPVSPGDQLILKVSIDRILR 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WK++  A V++ VVAEAE+  ++
Sbjct: 125 GIWKYKGQALVDDVVVAEAEMMCIL 149


>gi|88607258|ref|YP_505739.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma phagocytophilum
           HZ]
 gi|123494347|sp|Q2GIR2|FABZ_ANAPZ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|88598321|gb|ABD43791.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Anaplasma
           phagocytophilum HZ]
          Length = 145

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 86/138 (62%), Gaps = 4/138 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++MR LPH YPFLLVDKV      E  + +KNVTFNEP F+GHFPG P+MPGVLI+E +A
Sbjct: 7   QVMRALPHSYPFLLVDKVTECIPGECIVAVKNVTFNEPFFVGHFPGNPIMPGVLIVEALA 66

Query: 75  QTAGAICAIHNGFDQY---APPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           Q A  +C + +   +         MSID ARFRK V PGD L    +    R +  +F C
Sbjct: 67  Q-ASMLCVVCDADGESTGDTSVLFMSIDSARFRKVVVPGDVLVLKSSVCHRRGNSCRFDC 125

Query: 132 CAKVENTVVAEAEICAMV 149
            A VE+ +V EA+I AM+
Sbjct: 126 RAYVEDVLVTEAQILAMM 143


>gi|91784108|ref|YP_559314.1| (3R)-hydroxymyristoyl-ACP dehydratase [Burkholderia xenovorans
           LB400]
 gi|91688062|gb|ABE31262.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Burkholderia
           xenovorans LB400]
          Length = 154

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 92/145 (63%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYP LLVD+V+ ++  ++   +KNV+ NEP+F GHFP RPVMPGVLILE
Sbjct: 9   DIHKILTLLPHRYPILLVDRVLELEPHKNIKALKNVSINEPYFQGHFPTRPVMPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTA  +       D     YL + ID ARF++ V PGD+L  +    R+   +WKF+
Sbjct: 69  ALAQTAALLTFSEEPSDPSNTLYLFVGIDNARFKRVVEPGDQLILNCTFERHMRGIWKFK 128

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             A+V+  V AEA++   V H  K+
Sbjct: 129 ARAEVDGVVAAEADLMCAVRHTDKD 153


>gi|103487434|ref|YP_616995.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingopyxis alaskensis RB2256]
 gi|122984928|sp|Q1GRR0|FABZ_SPHAL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|98977511|gb|ABF53662.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Sphingopyxis
           alaskensis RB2256]
          Length = 153

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 1/144 (0%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            + A DI  ++  LPHRYP LLVD+VV++ +D+S   +K VT NEP F GHFPGRP+MPG
Sbjct: 4   AMGAADIRRVLSLLPHRYPMLLVDRVVSMVKDQSIHAVKAVTMNEPFFQGHFPGRPIMPG 63

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           VLI+E +AQ  G +     G        Y M ID  +FRKPV PG  L+ HV  ++ + +
Sbjct: 64  VLIVEALAQAGGVLAIESLGLAGSGKLVYFMGIDGVKFRKPVEPGHLLDLHVTILQAKRN 123

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
           + KF+  A +   +  E +  AM+
Sbjct: 124 ICKFEGRAMLGGQLATECQFTAMI 147


>gi|315179356|gb|ADT86270.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Vibrio
           furnissii NCTC 11218]
          Length = 150

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQELLPHRYPFLLIDRVTDFEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPKENELYYFASIDNAKFRKPVGPGDQLIIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IALFNGVAKVDGDVVCSAELKCA 146


>gi|37680730|ref|NP_935339.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio vulnificus YJ016]
 gi|326423900|ref|NP_760746.2| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           vulnificus CMCP6]
 gi|31340091|sp|Q8DBF0|FABZ_VIBVU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|47605630|sp|Q7M7J1|FABZ_VIBVY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|37199479|dbj|BAC95310.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Vibrio vulnificus YJ016]
 gi|319999276|gb|AAO10273.2| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           vulnificus CMCP6]
          Length = 150

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+VV+ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NISEIQELLPHRYPFLLIDRVVDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVVPGDQLIIEVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAAFTGVAKVDGDVVCSAELKCA 146


>gi|329912025|ref|ZP_08275636.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545748|gb|EGF30882.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 156

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (64%), Gaps = 3/144 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +++ DI ++  +LPHRYP LLVD+V+  +  ++   IKNVT NE  F GHFP +PVMPGV
Sbjct: 1   MNSLDINQIKLYLPHRYPMLLVDRVLTWESGKTITAIKNVTANEEFFNGHFPHKPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L++E +AQTA  +  +  G   D+ +  Y + ID ARF++PV PGD++   V  VR+   
Sbjct: 61  LMIEALAQTAALLSFLSLGQKPDENSIVYFLGIDGARFKRPVIPGDQIRMDVEIVRHTRG 120

Query: 126 LWKFQCCAKVENTVVAEAEI-CAM 148
           +WK++  A V+  +  EAE+ C M
Sbjct: 121 IWKYKARATVDGQLAVEAELMCTM 144


>gi|258621007|ref|ZP_05716041.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           mimicus VM573]
 gi|258586395|gb|EEW11110.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           mimicus VM573]
          Length = 152

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 11  NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 71  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 125

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 126 IALFNGVAKVDGDVVCSAQLKCA 148


>gi|121586255|ref|ZP_01676045.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 2740-80]
 gi|147674767|ref|YP_001217764.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio cholerae O395]
 gi|153213814|ref|ZP_01949022.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 1587]
 gi|153817079|ref|ZP_01969746.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae NCTC 8457]
 gi|153825348|ref|ZP_01978015.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MZO-2]
 gi|183179451|ref|ZP_02957662.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MZO-3]
 gi|227082373|ref|YP_002810924.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae M66-2]
 gi|229507677|ref|ZP_04397182.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae BX 330286]
 gi|229513891|ref|ZP_04403353.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae TMA 21]
 gi|229522195|ref|ZP_04411612.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae TM 11079-80]
 gi|229524251|ref|ZP_04413656.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae bv. albensis VL426]
 gi|229528748|ref|ZP_04418138.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae 12129(1)]
 gi|254225762|ref|ZP_04919367.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae V51]
 gi|258627361|ref|ZP_05722145.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           mimicus VM603]
 gi|297580892|ref|ZP_06942817.1| 3R-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae RC385]
 gi|298500376|ref|ZP_07010181.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           cholerae MAK 757]
 gi|172047616|sp|A5F629|FABZ_VIBC3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788539|sp|C3LQ21|FABZ_VIBCM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|121549521|gb|EAX59547.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 2740-80]
 gi|124115738|gb|EAY34558.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae 1587]
 gi|125621668|gb|EAZ49997.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae V51]
 gi|126512347|gb|EAZ74941.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae NCTC 8457]
 gi|146316650|gb|ABQ21189.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae O395]
 gi|149741032|gb|EDM55101.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MZO-2]
 gi|183012862|gb|EDT88162.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MZO-3]
 gi|227010261|gb|ACP06473.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae M66-2]
 gi|227014145|gb|ACP10355.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae O395]
 gi|229332522|gb|EEN98008.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae 12129(1)]
 gi|229337832|gb|EEO02849.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae bv. albensis VL426]
 gi|229341120|gb|EEO06125.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae TM 11079-80]
 gi|229349072|gb|EEO14029.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae TMA 21]
 gi|229355182|gb|EEO20103.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae BX 330286]
 gi|258580399|gb|EEW05364.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           mimicus VM603]
 gi|297534718|gb|EFH73554.1| 3R-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae RC385]
 gi|297541069|gb|EFH77123.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           cholerae MAK 757]
          Length = 153

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 12  NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 72  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 126

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 127 IALFNGVAKVDGDVVCSAQLKCA 149


>gi|323704845|ref|ZP_08116422.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323706576|ref|ZP_08118129.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534083|gb|EGB23881.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535771|gb|EGB25545.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 143

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 95/145 (65%), Gaps = 4/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D K+I E+   +PHRYPFL++DKV+ I+  + A+GIKNV+ NEP F GHFPG P+MPGV
Sbjct: 2   IDNKEIREV---IPHRYPFLMIDKVLEIEDGKKAVGIKNVSANEPFFQGHFPGNPIMPGV 58

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQ  G I  +H   +         I+K +F++ V PGD+L+  V  + ++++L 
Sbjct: 59  LIVEAMAQL-GGITVMHGKDNNNMIGLFTGINKCKFKRVVGPGDQLKIEVEIISSKLNLI 117

Query: 128 KFQCCAKVENTVVAEAEICAMVMHE 152
           K +  A V+  + AEAEI  M++ +
Sbjct: 118 KAKGVATVDGDLAAEAEISFMLVEK 142


>gi|15642247|ref|NP_231880.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|153823584|ref|ZP_01976251.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae B33]
 gi|229512128|ref|ZP_04401607.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae B33]
 gi|229519263|ref|ZP_04408706.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae RC9]
 gi|229607181|ref|YP_002877829.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio cholerae MJ-1236]
 gi|254849379|ref|ZP_05238729.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MO10]
 gi|14423707|sp|Q9KPW3|FABZ_VIBCH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|9656809|gb|AAF95393.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|126518900|gb|EAZ76123.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae B33]
 gi|229343952|gb|EEO08927.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae RC9]
 gi|229352093|gb|EEO17034.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae B33]
 gi|229369836|gb|ACQ60259.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae MJ-1236]
 gi|254845084|gb|EET23498.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae MO10]
          Length = 153

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 12  NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 72  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMVEVEFLKERRG 126

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 127 IALFNGVAKVDGDVVCSAQLKCA 149


>gi|261493567|ref|ZP_05990087.1| FabA protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495405|ref|ZP_05991853.1| FabA protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308910|gb|EEY10165.1| FabA protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310749|gb|EEY11932.1| FabA protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 155

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    IKNVTFNEP F GHFPG P+ PGVLILE
Sbjct: 15  EVTEIMDMLPHRYPFLLVDRVTDYEEGKWLKAIKNVTFNEPCFTGHFPGAPIFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A +    +    Y  +ID ARF++PV PGD+L+  V  ++    + KF 
Sbjct: 75  AMAQATGVLAVATYGKLSEDELYYFAAIDNARFKRPVVPGDQLQLEVEFLKEVRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +V EA++ CA
Sbjct: 135 GKAYVDGKLVCEADLMCA 152


>gi|32034713|ref|ZP_00134844.1| COG0764: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
           protein) dehydratases [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126207892|ref|YP_001053117.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus
           pleuropneumoniae L20]
 gi|165975868|ref|YP_001651461.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149701|ref|YP_001968226.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein]dehydratase
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|303249771|ref|ZP_07335975.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303252651|ref|ZP_07338814.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307245240|ref|ZP_07527331.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307247411|ref|ZP_07529458.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|307249631|ref|ZP_07531617.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307251959|ref|ZP_07533860.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307254187|ref|ZP_07536032.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307256454|ref|ZP_07538236.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|307258652|ref|ZP_07540387.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307260883|ref|ZP_07542569.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307263010|ref|ZP_07544632.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|158513503|sp|A3MZC6|FABZ_ACTP2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700436|sp|B3H0S2|FABZ_ACTP7 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700437|sp|B0BTR2|FABZ_ACTPJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|126096684|gb|ABN73512.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|165875969|gb|ABY69017.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|189914832|gb|ACE61084.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein]dehydratase
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|302648619|gb|EFL78812.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302651338|gb|EFL81490.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306853884|gb|EFM86098.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306856108|gb|EFM88264.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306858329|gb|EFM90399.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306860651|gb|EFM92663.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306862887|gb|EFM94836.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865084|gb|EFM96985.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306867309|gb|EFM99162.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306869450|gb|EFN01241.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306871636|gb|EFN03358.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 154

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M+ LPHRYPFLLVD+V++ +  +    IKNVT NEP F GHFP  P+ PGVLILE
Sbjct: 15  EVTEIMKMLPHRYPFLLVDRVIDFEEGKWLKAIKNVTVNEPCFTGHFPESPIFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A H    Q    Y  +ID ARF++PV PGD+L + V  ++    + KF 
Sbjct: 75  AMAQATGVLAVATHGKMAQDELYYFAAIDNARFKRPVVPGDQLTFEVEFLKEMRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +V EA++ CA
Sbjct: 135 GKAFVDGKLVCEADLMCA 152


>gi|315633615|ref|ZP_07888905.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Aggregatibacter segnis ATCC 33393]
 gi|315477657|gb|EFU68399.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Aggregatibacter segnis ATCC 33393]
          Length = 150

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M+ LPHRYPFLLVD+V+N +  +    IKN++ NEP F GHFPG P++PGVLILE MA
Sbjct: 13  EIMQLLPHRYPFLLVDRVINFEEGKWLTAIKNISVNEPCFTGHFPGNPILPGVLILEAMA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +    +        Y   +D+ARF++P+ PGD++  HV  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTHELAGGEIFYFAGVDEARFKRPIVPGDQMVLHVEVIKERRGITAFTATAT 132

Query: 135 VENTVVAEAEI-CA 147
           V+  V  EA++ CA
Sbjct: 133 VDGEVACEAKLMCA 146


>gi|317051791|ref|YP_004112907.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfurispirillum indicum S5]
 gi|316946875|gb|ADU66351.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfurispirillum indicum S5]
          Length = 150

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 93/143 (65%), Gaps = 5/143 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           ++ E+M++LPHRYPFLL+D+V++I  +   I  +KNVTFNEP F GHFPG P+MPGV+I+
Sbjct: 2   NVTEIMQYLPHRYPFLLIDRVLDIDLEGQKITAMKNVTFNEPFFQGHFPGHPIMPGVMIV 61

Query: 71  EGMAQTAGAI---CAIHNGFDQ-YAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           E MAQ  G +      H G        Y M++DK +FR PV PGD L + ++  R +  +
Sbjct: 62  EAMAQVGGVLGLKLLQHEGHSTDNCLIYFMTVDKTKFRVPVVPGDTLTFKIHMTRRKGAI 121

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
            + +  A V++ +V E+++ AM+
Sbjct: 122 CQLEAQAFVDDEMVCESQLKAMI 144


>gi|262166326|ref|ZP_06034063.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           mimicus VM223]
 gi|262026042|gb|EEY44710.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           mimicus VM223]
          Length = 150

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 124 IALFNGVAKVDGDVVCSAQLKCA 146


>gi|118594903|ref|ZP_01552250.1| (3R)-hydroxyacyl-[acyl carrier protein] dehydratase
           [Methylophilales bacterium HTCC2181]
 gi|118440681|gb|EAV47308.1| (3R)-hydroxyacyl-[acyl carrier protein] dehydratase
           [Methylophilales bacterium HTCC2181]
          Length = 151

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 91/145 (62%), Gaps = 2/145 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPF+LVDKV +++  +    IKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 7   NIHEILDHLPHRYPFILVDKVTHLELGKEITAIKNVTINEPFFPGHFPYHPVMPGVLIVE 66

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +    ++   ++ +  Y   ID ARF+KPV PGD++  HV   R    +WK+
Sbjct: 67  AMAQAAALLSFKTMNTKPNEESVYYFAGIDSARFKKPVGPGDQIVLHVIIERILKGIWKY 126

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
           +  A VE  +VAEA +  ++   KK
Sbjct: 127 KGVATVEGDIVAEANMMCILKEIKK 151


>gi|289208660|ref|YP_003460726.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thioalkalivibrio sp. K90mix]
 gi|288944291|gb|ADC71990.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thioalkalivibrio sp. K90mix]
          Length = 152

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (62%), Gaps = 5/143 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           +D  ++ E+MR+LPHRYPFL+VD+V+  +      GIKNV+ NEP+F GHFP +PVMPGV
Sbjct: 1   MDDFNVQEIMRYLPHRYPFLMVDRVLEWEPGGYLTGIKNVSINEPYFQGHFPIKPVMPGV 60

Query: 68  LILEGMAQTAGAIC-----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           LILE +AQ  G +      A +   D+      + ID+ARFR+ V PGD+L   V+  R 
Sbjct: 61  LILEALAQATGLLAFKTEEARNENQDKQQLYLFVGIDEARFRRQVVPGDQLHLRVDLKRT 120

Query: 123 RVDLWKFQCCAKVENTVVAEAEI 145
              +W+F   A+V + + A A++
Sbjct: 121 MRGIWRFDAVARVGDDICATAQL 143


>gi|300724783|ref|YP_003714108.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631325|emb|CBJ92020.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 150

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 88/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHRYPFLLVD+V++ +  +    +KNVTFNEP F GHFPG+P+ PGVLILE
Sbjct: 8   QIEEILNLLPHRYPFLLVDRVLDFEEGKFLRAVKNVTFNEPFFQGHFPGKPIFPGVLILE 67

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  ++ R  + +F+
Sbjct: 68  AMAQATGILAFKSVGSLEPGELYYFAAIDGARFKRPVLPGDQMVMEVEFIKERRGVARFR 127

Query: 131 CCAKVENTVVAEAE-ICA 147
             AKV+  +  EAE +CA
Sbjct: 128 GVAKVDGELACEAEMMCA 145


>gi|91223484|ref|ZP_01258749.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio alginolyticus 12G01]
 gi|91191570|gb|EAS77834.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio alginolyticus 12G01]
          Length = 150

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NISEIQELLPHRYPFLLIDRVIDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQLVIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAAFSGVAKVDGEVVCSAELKCA 146


>gi|271499506|ref|YP_003332531.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Dickeya
           dadantii Ech586]
 gi|270343061|gb|ACZ75826.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Dickeya
           dadantii Ech586]
          Length = 151

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 90/137 (65%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ ++ +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 10  IEEILDLLPHRYPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 69

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y  +ID+ARF++PV PGD++   V  ++ R  + +F+ 
Sbjct: 70  MAQATGILAFKSMGKLEPGELYYFAAIDEARFKRPVEPGDQMILEVEFIKERRGIARFKG 129

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  V  EAE +CA
Sbjct: 130 VAKVDGEVACEAEMMCA 146


>gi|254361108|ref|ZP_04977253.1| 3-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Mannheimia
           haemolytica PHL213]
 gi|153092594|gb|EDN73649.1| 3-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Mannheimia
           haemolytica PHL213]
          Length = 152

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    IKNVTFNEP F GHFPG P+ PGVLILE
Sbjct: 12  EVTEIMDMLPHRYPFLLVDRVTDYEEGKWLKAIKNVTFNEPCFTGHFPGAPIFPGVLILE 71

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A +    +    Y  +ID ARF++PV PGD+L+  V  ++    + KF 
Sbjct: 72  AMAQATGVLAVATYGKLSEDELYYFAAIDNARFKRPVVPGDQLQLEVEFLKEVRGITKFT 131

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +V EA++ CA
Sbjct: 132 GKAYVDGKLVCEADLMCA 149


>gi|146296386|ref|YP_001180157.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|190359374|sp|A4XJ81|FABZ_CALS8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145409962|gb|ABP66966.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 140

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 83/135 (61%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +++ LPHRYPFLLVD+++ I+  + A GIKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DVTSILQILPHRYPFLLVDRIIEIEEGKKAKGIKNVTINEPFFQGHFPGNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +     +   P+   IDK RF+K V PGD L      +  +  + K + 
Sbjct: 63  AMAQV-GAVAILSKEEFKGKTPFFAGIDKVRFKKVVRPGDVLLIETELISLKGYIGKAKA 121

Query: 132 CAKVENTVVAEAEIC 146
            A VE  VV E E+ 
Sbjct: 122 TAYVEGEVVCEGELL 136


>gi|254286443|ref|ZP_04961400.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae AM-19226]
 gi|150423392|gb|EDN15336.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           cholerae AM-19226]
          Length = 153

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 12  NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 72  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 126

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AK++  VV  A++ CA
Sbjct: 127 IALFNGVAKIDGDVVCSAQLKCA 149


>gi|71892064|ref|YP_277794.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|91206623|sp|Q493C1|FABZ_BLOPB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|71796170|gb|AAZ40921.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 151

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 95/151 (62%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           MI+D   L  ++++EL   LPHR+PFLLVD+V+N ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MITDTCVLHIEEVLEL---LPHRFPFLLVDRVLNFEKGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHV 117
           +P+ PGVLILE MAQ  G +     G  + AP    Y  +ID ARF++PV PGD++   V
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSTG--KLAPGELYYFAAIDAARFKRPVQPGDQMILDV 115

Query: 118 NKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
             ++ R  + +F+  A V   +  EA  +CA
Sbjct: 116 EFIKERRGIARFKGIATVNEEMACEASMMCA 146


>gi|254419264|ref|ZP_05032988.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Brevundimonas sp. BAL3]
 gi|196185441|gb|EDX80417.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Brevundimonas sp. BAL3]
          Length = 158

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 86/145 (59%), Gaps = 11/145 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  E+MR LPHRYPFLLVDK        S +GIKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 8   DYAEVMRRLPHRYPFLLVDKAEAFVPRTSIVGIKNVSHNEPFFQGHFPIDPVMPGVLIVE 67

Query: 72  GMAQTAGAI------CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQT   +       A+ +    +     MSID  RFRKP  PGD+L   V  ++ R D
Sbjct: 68  AMAQTGALLMSKTLDVAVADKVIMF-----MSIDGVRFRKPARPGDQLRMEVKVIKARGD 122

Query: 126 LWKFQCCAKVENTVVAEAEICAMVM 150
            +KF+    ++  + AEAE  AMV+
Sbjct: 123 AYKFRGETFIDGKLAAEAEFMAMVV 147


>gi|89075409|ref|ZP_01161826.1| (3R)-hydroxymyristoyl ACP dehydratase [Photobacterium sp. SKA34]
 gi|89048825|gb|EAR54395.1| (3R)-hydroxymyristoyl ACP dehydratase [Photobacterium sp. SKA34]
          Length = 151

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL++D+V N    ++   IKNV+ NEP F GHFP  PV PGV+ILE
Sbjct: 9   NITEIQELLPHRYPFLMIDRVTNYDEGKTLTAIKNVSVNEPQFTGHFPNMPVFPGVMILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L  +V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPAENELYYFASIDKAKFRKPVGPGDQLILNVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   A V+  VV  AE+ CA
Sbjct: 124 IALFNGVATVDGEVVCSAELKCA 146


>gi|33519747|ref|NP_878579.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Blochmannia
           floridanus]
 gi|47605653|sp|Q7VRD5|FABZ_BLOFL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|33504092|emb|CAD83353.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Candidatus
           Blochmannia floridanus]
          Length = 151

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 97/151 (64%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           MI+D   L  ++++EL   LPHR+PFLLVD+V+N ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MITDTCILHIEEVLEL---LPHRFPFLLVDRVLNFEKGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHV 117
           +P+ PGVLILE MAQ  G +     G  + AP    Y  +ID+ARF++PV PGD++  +V
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSMG--KLAPGEFYYFAAIDEARFKRPVQPGDQMILNV 115

Query: 118 NKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
             ++ R  + +F+  A V   +  EA  +CA
Sbjct: 116 EFIKERCGVARFKGIATVNEEMACEASMMCA 146


>gi|260767814|ref|ZP_05876749.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           furnissii CIP 102972]
 gi|260617323|gb|EEX42507.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           furnissii CIP 102972]
          Length = 143

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NITEIQELLPHRYPFLLIDRVTDFEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKTFGAPKENELYYFASIDNAKFRKPVGPGDQLIIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 117 IALFNGVAKVDGDVVCSAELKCA 139


>gi|90413540|ref|ZP_01221531.1| (3R)-hydroxymyristoyl ACP dehydratase [Photobacterium profundum
           3TCK]
 gi|90325472|gb|EAS41955.1| (3R)-hydroxymyristoyl ACP dehydratase [Photobacterium profundum
           3TCK]
          Length = 150

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL++D+V N +  ++    KNV+ NEP F GHFP  P+ PGV+ILE
Sbjct: 9   NITEIQALLPHRYPFLMIDRVTNYEEGQTLTAYKNVSINEPLFTGHFPKMPIFPGVMILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASIDKAKFRKPVVPGDQLVLEVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IALFNGTAKVDGEVVCSAELKCA 146


>gi|114562459|ref|YP_749972.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella frigidimarina NCIMB 400]
 gi|122300311|sp|Q085D1|FABZ_SHEFN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|114333752|gb|ABI71134.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           frigidimarina NCIMB 400]
          Length = 153

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 5/144 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E++++LPHRYPFLL+D+V++    E    IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEILKYLPHRYPFLLIDRVLDFTVGEHLHAIKNVTINEPFFQGHFPIQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G + A      + +P    Y   IDKARF++ V PGD++ +HV  ++ R 
Sbjct: 65  LILEAMAQATG-LLAFKTMSTEPSPEVLYYFAGIDKARFKRVVEPGDQIHFHVKMIKERR 123

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +  F   A V+  +V  AEI CA
Sbjct: 124 GIGVFVGEALVDGELVCSAEIMCA 147


>gi|114778070|ref|ZP_01452970.1| (3R)-hydroxyacyl-[acyl carrier protein] dehydratase [Mariprofundus
           ferrooxydans PV-1]
 gi|114551676|gb|EAU54229.1| (3R)-hydroxyacyl-[acyl carrier protein] dehydratase [Mariprofundus
           ferrooxydans PV-1]
          Length = 148

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 89/139 (64%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++M+ LPHRYPFLL+D+V+  ++++S   +KNV+ NEP F GHFPG PVMPGVL++E
Sbjct: 5   NIDDIMQHLPHRYPFLLIDRVLGFEKEKSIRALKNVSINEPQFAGHFPGHPVMPGVLLVE 64

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +       D+    Y   ID  RFR+PV PGD++ + +  +R R  LWK + 
Sbjct: 65  AMAQAGGILAFQSVEDDREYLVYFTGIDGVRFRRPVRPGDQVIFEMTCLRRRGFLWKLKG 124

Query: 132 CAKVENTVVAEAEICAMVM 150
            A V+  +V E  + A ++
Sbjct: 125 EAFVDGKLVCEGTLTATLV 143


>gi|319789597|ref|YP_004151230.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermovibrio ammonificans HB-1]
 gi|317114099|gb|ADU96589.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermovibrio ammonificans HB-1]
          Length = 145

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 91/142 (64%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DIVE+M  +PHRYPFLLVDK+V  +  +  +GIKNVT NEP F GHFPG P+ PG L++E
Sbjct: 4   DIVEIMETIPHRYPFLLVDKIVEFEPKKRIVGIKNVTMNEPFFQGHFPGHPIFPGALLVE 63

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            MAQ  G I  +   FD    +Y   Y M IDKARFRKPV PGD +++ +     +  L 
Sbjct: 64  AMAQV-GCIL-MFKSFDISPKEYV-VYFMGIDKARFRKPVRPGDTVKFVLEPTVIKSRLS 120

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K +  A V + +V +A+I AM+
Sbjct: 121 KMKGEAYVGDELVCDAQIMAMI 142


>gi|119491434|ref|ZP_01623453.1| (3R)-hydroxymyristoyl ACP dehydratase [Lyngbya sp. PCC 8106]
 gi|119453429|gb|EAW34592.1| (3R)-hydroxymyristoyl ACP dehydratase [Lyngbya sp. PCC 8106]
          Length = 169

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 84/133 (63%), Gaps = 4/133 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPF LVD+++  +    A+GIKNVTFNEPHF GHFPG+P+MPGVLI+E MA
Sbjct: 33  EIQKLLPHRYPFALVDRIIEYEPGTRAVGIKNVTFNEPHFQGHFPGKPIMPGVLIVEAMA 92

Query: 75  QTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKFQCC 132
           Q AG I       D     +L + IDK RFR+PV PGD+L   VN +   R    K Q  
Sbjct: 93  QVAGVILTQIPDVDGNL--FLFAGIDKVRFRRPVVPGDQLIMTVNILSLKRRRFAKVQAK 150

Query: 133 AKVENTVVAEAEI 145
           A+V+     E E+
Sbjct: 151 AEVDGKRTCEGEL 163


>gi|146329070|ref|YP_001209593.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dichelobacter nodosus VCS1703A]
 gi|146232540|gb|ABQ13518.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dichelobacter nodosus VCS1703A]
          Length = 165

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+ R+LPHRYPFLL+D+++ ++       +KNVT NEP F GHFP + VMPGVL++E 
Sbjct: 15  IEEIRRYLPHRYPFLLIDRIIALETQNYIHALKNVTANEPFFQGHFPNKAVMPGVLVVEA 74

Query: 73  MAQTAGAICAIHNGFDQYAPP---------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           MAQ AG I  + +       P         + + IDKARFRK V PGD+L   V  +R+R
Sbjct: 75  MAQAAG-ILGVKSAKAAAGLPDEPEEDGIYFFVGIDKARFRKTVVPGDQLILEVKLLRSR 133

Query: 124 VDLWKFQCCAKVENTVVAEAEI 145
             +W F   A V++ VV  AEI
Sbjct: 134 RGIWSFDARATVDDAVVCTAEI 155


>gi|319760419|ref|YP_004124357.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Candidatus Blochmannia vafer str. BVAF]
 gi|318039133|gb|ADV33683.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Candidatus Blochmannia vafer str. BVAF]
          Length = 155

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 91/144 (63%), Gaps = 4/144 (2%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M+ D + L    I E++R LPHR+PFLLVD+V+N ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MVIDASMLS---IEEVLRLLPHRFPFLLVDRVLNFEKGKFLKALKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  +ID+ARF+KPV PGD++  +V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSTGKLEPGELYYFAAIDEARFKKPVQPGDQMILNVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEA 143
           ++ R  + +F+  A V   +  EA
Sbjct: 118 IKERCGIARFKGVATVNEEMACEA 141


>gi|262167728|ref|ZP_06035430.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae RC27]
 gi|262190013|ref|ZP_06048316.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae CT 5369-93]
 gi|262404583|ref|ZP_06081138.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. RC586]
 gi|262023793|gb|EEY42492.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae RC27]
 gi|262034109|gb|EEY52546.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae CT 5369-93]
 gi|262349615|gb|EEY98753.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. RC586]
 gi|327484765|gb|AEA79172.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Vibrio
           cholerae LMA3894-4]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 117 IALFNGVAKVDGDVVCSAQLKCA 139


>gi|320155603|ref|YP_004187982.1| (3R)-hydroxymyristoyl-(acyl carrier protein)dehydratase [Vibrio
           vulnificus MO6-24/O]
 gi|319930915|gb|ADV85779.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           vulnificus MO6-24/O]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+VV+ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NISEIQELLPHRYPFLLIDRVVDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVVPGDQLIIEVEFIKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 117 IAAFTGVAKVDGDVVCSAELKCA 139


>gi|327399442|ref|YP_004340311.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase [Hippea
           maritima DSM 10411]
 gi|327182071|gb|AEA34252.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase [Hippea
           maritima DSM 10411]
          Length = 152

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 94/147 (63%), Gaps = 7/147 (4%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++ + LPHRYPFLLVD+V+  +  +    +KNVT+NEP F GHFP   VMPGVL++E 
Sbjct: 4   IEDIKKMLPHRYPFLLVDRVLEYKEGDWIKTLKNVTYNEPFFTGHFPQVSVMPGVLMVEA 63

Query: 73  MAQTAGAICAIHNGFDQYAPP-------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           MAQ+ G +  +    +++          Y + I++ARFR+PV PGD++   V  +++++D
Sbjct: 64  MAQSGGILAFLSMNKEEFERSIGGKRMVYFVEIERARFRRPVIPGDQVIMEVKILKHKLD 123

Query: 126 LWKFQCCAKVENTVVAEAEICAMVMHE 152
           +WK +  A V+  +VAEA++ A +  E
Sbjct: 124 IWKMEGKATVDGKIVAEAKMAAKIDRE 150


>gi|255747054|ref|ZP_05420999.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholera CIRS 101]
 gi|262161401|ref|ZP_06030511.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae INDRE 91/1]
 gi|255735456|gb|EET90856.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholera CIRS 101]
 gi|262028712|gb|EEY47366.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           cholerae INDRE 91/1]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMVEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 117 IALFNGVAKVDGDVVCSAQLKCA 139


>gi|297181309|gb|ADI17500.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [uncultured bacterium HF0130_06E03]
          Length = 153

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 89/139 (64%), Gaps = 2/139 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+   LPHRYPFLL+D++V +   +  + +KNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 10  ELSEIQEVLPHRYPFLLIDRIVEVVSGQRIVALKNVTANEPFFQGHFPGFPVMPGVLIVE 69

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ AG + A+ +  D+    P+   ID  RFRKPV PGD+L   ++ +R R    K  
Sbjct: 70  ALAQ-AGCVLALKDLKDRANKIPFFAGIDSCRFRKPVVPGDQLRLELSVLRQRGISTKMD 128

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V   +VAEAEI A++
Sbjct: 129 GKAYVGTDLVAEAEILAVL 147


>gi|50119982|ref|YP_049149.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pectobacterium atrosepticum
           SCRI1043]
 gi|62286801|sp|Q6D8D2|FABZ_ERWCT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|49610508|emb|CAG73953.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 151

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 96/149 (64%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L+ ++I+EL   LPHR+PFLLVD+V++ ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLNIEEILEL---LPHRFPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAVDEARFKRPVQPGDQMILEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F+  AKV+  V  EA  +CA
Sbjct: 118 IKERRGVARFKGVAKVDGEVACEASMMCA 146


>gi|322831599|ref|YP_004211626.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Rahnella
           sp. Y9602]
 gi|321166800|gb|ADW72499.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Rahnella
           sp. Y9602]
          Length = 151

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 94/149 (63%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHRYPFLLVD+V++ ++ +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRYPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAIDDARFKRPVLPGDQMVLEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F+  AKV+  +  EA  +CA
Sbjct: 118 IKERRGVARFKGVAKVDGEIACEASMMCA 146


>gi|303258066|ref|ZP_07344074.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderiales bacterium 1_1_47]
 gi|330998721|ref|ZP_08322450.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Parasutterella excrementihominis YIT 11859]
 gi|302859085|gb|EFL82168.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderiales bacterium 1_1_47]
 gi|329576460|gb|EGG57972.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Parasutterella excrementihominis YIT 11859]
          Length = 146

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 85/137 (62%), Gaps = 2/137 (1%)

Query: 11  KDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           +DI ++MR LPHRYPFLLVD+V+     +  I IKNVT NEP F GHFPG PVMPGVLI+
Sbjct: 2   QDINDIMRLLPHRYPFLLVDRVLETNGVDKLIAIKNVTVNEPQFTGHFPGVPVMPGVLII 61

Query: 71  EGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ    +     G ++      Y  SID ARF++ V PGD+L +    +R ++ + K
Sbjct: 62  EAMAQACAMLAFARMGGERDPEKLFYFASIDNARFKRVVIPGDQLRFECTFLREKLGMIK 121

Query: 129 FQCCAKVENTVVAEAEI 145
             C A V+  + A A++
Sbjct: 122 MHCDATVDGQLAACADM 138


>gi|262170782|ref|ZP_06038460.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           mimicus MB-451]
 gi|261891858|gb|EEY37844.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           mimicus MB-451]
          Length = 143

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KN++ NEP F GHFP  PV PGVLILE
Sbjct: 2   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNISVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A++ CA
Sbjct: 117 IALFNGVAKVDGDVVCSAQLKCA 139


>gi|257094434|ref|YP_003168075.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046958|gb|ACV36146.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 145

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/139 (48%), Positives = 88/139 (63%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+VV+ +  ++    KNVT NEP F+GHFP  PVMPGVLI+E
Sbjct: 2   DIHEVLEHLPHRYPFLLVDRVVDCEPGKAIHAYKNVTINEPFFVGHFPHHPVMPGVLIME 61

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G  A   +    D  +  Y + IDKARF+K V  GD+L  HV   R   ++WKF
Sbjct: 62  ALAQACGILAFRTLGEKPDPTSLFYFVGIDKARFKKTVTAGDQLHLHVRIQRQFRNIWKF 121

Query: 130 QCCAKVENTVVAEAE-ICA 147
              A V+   VAEA+ +CA
Sbjct: 122 ATVASVDGETVAEADMMCA 140


>gi|262393531|ref|YP_003285385.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. Ex25]
 gi|269966262|ref|ZP_06180351.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           alginolyticus 40B]
 gi|262337125|gb|ACY50920.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. Ex25]
 gi|269829177|gb|EEZ83422.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           alginolyticus 40B]
          Length = 143

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NISEIQELLPHRYPFLLIDRVIDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQLVIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 117 IAAFSGVAKVDGEVVCSAELKCA 139


>gi|187924422|ref|YP_001896064.1| (3R)-hydroxymyristoyl-ACP dehydratase [Burkholderia phytofirmans
           PsJN]
 gi|187715616|gb|ACD16840.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia phytofirmans PsJN]
          Length = 154

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 91/145 (62%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYP LLVD+V+ ++  +    +KNV+ NEP+F GHFP RPVMPGVLILE
Sbjct: 9   DIHKILTLLPHRYPILLVDRVLELEPHKCIKALKNVSINEPYFQGHFPTRPVMPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYL-MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTA  +       D     YL + ID ARF++ V PGD+L  +    R+   +WKF+
Sbjct: 69  ALAQTAALLTFSEEPSDPSNTLYLFVGIDNARFKRVVEPGDQLILNCTFERHMRGIWKFK 128

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             A+V+  V AEA++   V H  K+
Sbjct: 129 ARAEVDGVVAAEADLMCAVRHTDKD 153


>gi|73541559|ref|YP_296079.1| (3R)-hydroxymyristoyl-ACP dehydratase [Ralstonia eutropha JMP134]
 gi|91206645|sp|Q470E8|FABZ_RALEJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|72118972|gb|AAZ61235.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Ralstonia
           eutropha JMP134]
          Length = 150

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 90/142 (63%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+V+  +  +    +KNVT NEP F GHFPG+PVMPGV+ILE
Sbjct: 7   DIRQILKLLPHRYPMLLVDRVLEFEPQKRIKTLKNVTINEPFFQGHFPGQPVMPGVMILE 66

Query: 72  GMAQTAGAICAIHNGFD----QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ+AG +     G D    + A  Y + ID ARF++ V+PGD+L  +V   R    +W
Sbjct: 67  ALAQSAGLLTF---GADMERKEGALYYFVGIDGARFKQVVYPGDQLHMNVTVERYIRGIW 123

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF+  A V+  V  EAE+   V
Sbjct: 124 KFKAFATVDEKVACEAELMCTV 145


>gi|291297134|ref|YP_003508532.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Meiothermus ruber DSM 1279]
 gi|290472093|gb|ADD29512.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Meiothermus ruber DSM 1279]
          Length = 147

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 88/136 (64%), Gaps = 3/136 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+++FLPHRYPFLL+D+V  ++ DE     +KNV+FNEPHF GHFPG P+MPGVL++
Sbjct: 2   DIYEILKFLPHRYPFLLIDRV--LEADEKRFRALKNVSFNEPHFQGHFPGYPIMPGVLLI 59

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E MAQ + A+      F      +L+ +++ARF+KPV PGD L      +  R  L K +
Sbjct: 60  EAMAQGSVAVVTKQPEFKPGGLVFLVGVEEARFKKPVVPGDTLILEGELLAYRRGLGKVK 119

Query: 131 CCAKVENTVVAEAEIC 146
             A+VE  + AEA + 
Sbjct: 120 VEARVEGELRAEATLS 135


>gi|190359395|sp|A5EV60|FABZ_DICNV RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 153

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+ R+LPHRYPFLL+D+++ ++       +KNVT NEP F GHFP + VMPGVL++E 
Sbjct: 3   IEEIRRYLPHRYPFLLIDRIIALETQNYIHALKNVTANEPFFQGHFPNKAVMPGVLVVEA 62

Query: 73  MAQTAGAICAIHNGFDQYAPP---------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           MAQ AG I  + +       P         + + IDKARFRK V PGD+L   V  +R+R
Sbjct: 63  MAQAAG-ILGVKSAKAAAGLPDEPEEDGIYFFVGIDKARFRKTVVPGDQLILEVKLLRSR 121

Query: 124 VDLWKFQCCAKVENTVVAEAEI 145
             +W F   A V++ VV  AEI
Sbjct: 122 RGIWSFDARATVDDAVVCTAEI 143


>gi|163801790|ref|ZP_02195687.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio sp. AND4]
 gi|190359488|sp|A7MY04|FABZ_VIBHB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|159174298|gb|EDP59102.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio sp. AND4]
          Length = 150

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NISEIQELLPHRYPFLLIDRVIDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD++   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQMIIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F+  AKV+  VV  AE+ CA
Sbjct: 124 IAAFKGVAKVDGEVVCSAELKCA 146


>gi|126173699|ref|YP_001049848.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella baltica OS155]
 gi|152999988|ref|YP_001365669.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella baltica OS185]
 gi|160874609|ref|YP_001553925.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella baltica OS195]
 gi|217974049|ref|YP_002358800.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shewanella baltica OS223]
 gi|304409573|ref|ZP_07391193.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS183]
 gi|307303931|ref|ZP_07583684.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica BA175]
 gi|166233436|sp|A3D2L6|FABZ_SHEB5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233437|sp|A6WLB7|FABZ_SHEB8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044399|sp|A9KUL6|FABZ_SHEB9 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788937|sp|B8E7Q5|FABZ_SHEB2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|125996904|gb|ABN60979.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Shewanella
           baltica OS155]
 gi|151364606|gb|ABS07606.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS185]
 gi|160860131|gb|ABX48665.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS195]
 gi|217499184|gb|ACK47377.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS223]
 gi|304352091|gb|EFM16489.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS183]
 gi|306912829|gb|EFN43252.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica BA175]
 gi|315266850|gb|ADT93703.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Shewanella baltica OS678]
          Length = 154

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 89/145 (61%), Gaps = 6/145 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  DI E++++LPHRYPFLL+D+V++     S   IKNV+ NEP F GHFP +PVMPGV
Sbjct: 5   MNTMDIKEILKYLPHRYPFLLIDRVLDYTPGVSLQAIKNVSINEPFFQGHFPIQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LILE MAQ  G + A         PP    Y   ID ARFR+ V PGD++ + V  ++ R
Sbjct: 65  LILEAMAQATG-LLAFKTMSSDVPPPGVLYYFAGIDNARFRRVVEPGDQIHFDVKMIKER 123

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F   AKV+  VV  AEI CA
Sbjct: 124 RGIGVFYGEAKVDGEVVCSAEIMCA 148


>gi|171059520|ref|YP_001791869.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptothrix cholodnii SP-6]
 gi|170776965|gb|ACB35104.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptothrix cholodnii SP-6]
          Length = 148

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (62%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+VV ++ ++    +KNVT NEP FMGHFP RPVMPGVLILE
Sbjct: 5   DIHQILKKLPHRYPILLVDRVVELELNKRIQALKNVTINEPFFMGHFPHRPVMPGVLILE 64

Query: 72  GMAQTAGAICAIHNGFD--QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ +  +     G D       Y + ID ARF++PV PGD+L      VR +  ++K+
Sbjct: 65  ALAQASALLSFASMGEDPGDDTVVYFVGIDGARFKRPVEPGDQLILESTLVRAKGGIFKY 124

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           Q  A V   +  EAE+ C M
Sbjct: 125 QTRATVNGELATEAELMCTM 144


>gi|197286120|ref|YP_002151992.1| (3R)-hydroxymyristoyl-ACP dehydratase [Proteus mirabilis HI4320]
 gi|227357239|ref|ZP_03841596.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Proteus
           mirabilis ATCC 29906]
 gi|226700249|sp|B4F259|FABZ_PROMH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|194683607|emb|CAR44498.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Proteus
           mirabilis HI4320]
 gi|227162502|gb|EEI47491.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Proteus
           mirabilis ATCC 29906]
          Length = 150

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 9   IEEILDLLPHRYPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 68

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  ++ R  + +F+ 
Sbjct: 69  MAQATGILAFKSVGKLEPGELYYFAAIDGARFKRPVLPGDQMVLEVEFIKERRGVARFKG 128

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  +  EAE +CA
Sbjct: 129 VAKVDGEIACEAEMMCA 145


>gi|317493177|ref|ZP_07951600.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918837|gb|EFV40173.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 151

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L+  +I+EL   LPHR+PFLLVD+V++ +  +    +KNVTFNEP F GHFPG
Sbjct: 1   MTTDTHTLNISEILEL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVTFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVQPGDQMILEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F   AKV+  +V EA  +CA
Sbjct: 118 LKERRGVARFNGVAKVDGKIVCEASMMCA 146


>gi|118602563|ref|YP_903778.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567502|gb|ABL02307.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 147

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (64%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I ++  +LPHRYPFLL+D+V+ ++  +S + +KNVTFNEP F GHFP +P+MPGV+I+E
Sbjct: 4   SIQDVKNYLPHRYPFLLIDRVLELEIGKSIVALKNVTFNEPQFTGHFPEQPIMPGVMIVE 63

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPY-LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G +      G       Y L+ IDK RF++ V PGD+L   V  +  +  +WKF
Sbjct: 64  ALAQATGILAFKSEAGKPIDGQIYMLVGIDKVRFKRMVEPGDQLRLEVEVITIKRGIWKF 123

Query: 130 QCCAKVENTVVAEAEI 145
           +C A V+N ++  AE+
Sbjct: 124 KCKATVDNQIITSAEL 139


>gi|226327038|ref|ZP_03802556.1| hypothetical protein PROPEN_00899 [Proteus penneri ATCC 35198]
 gi|225204256|gb|EEG86610.1| hypothetical protein PROPEN_00899 [Proteus penneri ATCC 35198]
          Length = 150

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 88/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+P+ PGVLILE
Sbjct: 8   QIEEILDLLPHRYPFLLVDRVLDFEEKKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILE 67

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  ++ R  + +F+
Sbjct: 68  AMAQATGILAFKSVGKLEPGELYYFAAIDGARFKRPVLPGDQMILEVEFIKERRGVARFK 127

Query: 131 CCAKVENTVVAEAE-ICA 147
             AKV+  +  EAE +CA
Sbjct: 128 GVAKVDGEIACEAEMMCA 145


>gi|291614103|ref|YP_003524260.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sideroxydans lithotrophicus ES-1]
 gi|291584215|gb|ADE11873.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sideroxydans lithotrophicus ES-1]
          Length = 148

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (63%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLL+D+V+ +  +E  + +KNVT NEP F GH+P  PVMPGVL++E
Sbjct: 6   DIHEVLEHLPHRYPFLLIDRVLEVVPNERIVALKNVTMNEPFFPGHYPHHPVMPGVLVIE 65

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G      +  Y + I+ ARF++PV PGD+L   V+   NR  +WKF
Sbjct: 66  AMAQAAAILSFKTMGTLPSDDSVYYFVGIENARFKRPVSPGDQLILKVSIGMNRRGMWKF 125

Query: 130 QCCAKVENTVVAEAE-ICAM 148
              A+V+  V AEAE IC +
Sbjct: 126 NGKAEVDGQVAAEAELICTL 145


>gi|90580982|ref|ZP_01236783.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio angustum S14]
 gi|90437860|gb|EAS63050.1| (3R)-hydroxymyristoyl ACP dehydratase [Vibrio angustum S14]
          Length = 151

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 83/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL++D+V N    ++   IKNV+ NEP F GHFP  PV PGV+ILE
Sbjct: 9   NITEIQELLPHRYPFLMIDRVTNYDEGKTLTAIKNVSVNEPQFTGHFPNMPVFPGVMILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPAENELYYFASIDKAKFRKPVGPGDQLILDVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   A V+  VV  AE+ CA
Sbjct: 124 IALFNGVATVDGEVVCSAELKCA 146


>gi|251790734|ref|YP_003005455.1| (3R)-hydroxymyristoyl-ACP dehydratase [Dickeya zeae Ech1591]
 gi|247539355|gb|ACT07976.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Dickeya
           zeae Ech1591]
          Length = 151

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (65%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ ++ +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 10  IEEILDLLPHRYPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 69

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  ++ R  + +F+ 
Sbjct: 70  MAQATGILAFKSLGKLEPGELYYFAAVDEARFKRPVEPGDQMILEVEFIKERRGIARFKG 129

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  V  EAE +CA
Sbjct: 130 VAKVDGEVACEAEMMCA 146


>gi|251793246|ref|YP_003007974.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aggregatibacter aphrophilus NJ8700]
 gi|247534641|gb|ACS97887.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aggregatibacter aphrophilus NJ8700]
          Length = 150

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M+ LPHRYPFLLVD+V+N +  +    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 13  EIMQLLPHRYPFLLVDRVINFEEGKWLTAIKNISVNEPCFTGHFPGNPILPGVLILEALA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +    +        Y   +D+ARF++P+ PGD++  HV  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTHELAGGEIFYFAGVDEARFKRPIVPGDQMVLHVEVIKERRGITAFTATAS 132

Query: 135 VENTVVAEAEI-CA 147
           V+  V  EA++ CA
Sbjct: 133 VDGEVACEAKLMCA 146


>gi|190359489|sp|A1AWK0|FABZ_RUTMC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (64%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I ++  +LPHRYPFLL+D+V+ ++  +S + +KNVTFNEP F GHFP +P+MPGV+I+E
Sbjct: 2   SIQDVKNYLPHRYPFLLIDRVLELEIGKSIVALKNVTFNEPQFTGHFPEQPIMPGVMIVE 61

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPY-LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G +      G       Y L+ IDK RF++ V PGD+L   V  +  +  +WKF
Sbjct: 62  ALAQATGILAFKSEAGKPIDGQIYMLVGIDKVRFKRMVEPGDQLRLEVEVITIKRGIWKF 121

Query: 130 QCCAKVENTVVAEAEI 145
           +C A V+N ++  AE+
Sbjct: 122 KCKATVDNQIITSAEL 137


>gi|145640739|ref|ZP_01796322.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae R3021]
 gi|145274665|gb|EDK14528.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae 22.4-21]
          Length = 148

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 13  EIMTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +    + F      Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTHEFKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITSFTGVAT 132

Query: 135 VENTVVAEAEI-CA 147
           V   +  EA++ CA
Sbjct: 133 VNGEIACEAKLMCA 146


>gi|311694068|gb|ADP96941.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [marine
           bacterium HP15]
          Length = 145

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 86/136 (63%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++ +LPHRYPFLLVD+V  +++ +S  G KN++FNE  F GHFP  P+MPGVLI+E
Sbjct: 3   NIDEILEYLPHRYPFLLVDRVTEVEKGKSIKGYKNISFNESFFQGHFPNNPIMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ +G +  +  G         YL    KARF++PV PGD+L      +  +  ++KF
Sbjct: 63  AMAQLSGILGFVTVGRKPSDGVVQYLAGSSKARFKRPVLPGDQLCMESELISGKRGIYKF 122

Query: 130 QCCAKVENTVVAEAEI 145
           +C A V+  VV  AEI
Sbjct: 123 ECRALVDGEVVCVAEI 138


>gi|269138104|ref|YP_003294804.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Edwardsiella tarda EIB202]
 gi|294635131|ref|ZP_06713642.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Edwardsiella tarda ATCC 23685]
 gi|267983764|gb|ACY83593.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Edwardsiella tarda EIB202]
 gi|291091508|gb|EFE24069.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Edwardsiella tarda ATCC 23685]
          Length = 151

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L+  +I+EL   LPHR+PFLLVD+V++ Q  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLNISEILEL---LPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVHPGDQMILEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F   AKV+  +V EA  +CA
Sbjct: 118 LKERRGVARFNGVAKVDGKIVCEASMMCA 146


>gi|153835394|ref|ZP_01988061.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           harveyi HY01]
 gi|148868080|gb|EDL67252.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           harveyi HY01]
          Length = 150

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NISEIQELLPHRYPFLLIDRVIDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD++   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQMIIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAAFSGVAKVDGEVVCSAELKCA 146


>gi|227326547|ref|ZP_03830571.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|261822588|ref|YP_003260694.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pectobacterium wasabiae
           WPP163]
 gi|261606601|gb|ACX89087.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pectobacterium wasabiae WPP163]
          Length = 151

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 95/149 (63%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L+ ++I+EL   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLNIEEILEL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAVDEARFKRPVQPGDQMILEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F+  AKV+  V  EA  +CA
Sbjct: 118 IKERRGVARFKGVAKVDGEVACEASMMCA 146


>gi|14424448|sp|P32205|FABZ_YEREN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 178

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|261211367|ref|ZP_05925655.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. RC341]
 gi|260839322|gb|EEX65948.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           sp. RC341]
          Length = 143

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  IG+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID+A+FRKPV PGD+L   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   A+V+  VV  A++ CA
Sbjct: 117 IALFNGVARVDGDVVCSAQLKCA 139


>gi|320540042|ref|ZP_08039698.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Serratia
           symbiotica str. Tucson]
 gi|320029891|gb|EFW11914.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Serratia
           symbiotica str. Tucson]
          Length = 174

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           +I+D   LD  +I+EL   LPHRYPFLLVD+V++ +  +    +KNV+ NEP F GHFPG
Sbjct: 24  LITDTHTLDIAEILEL---LPHRYPFLLVDRVLDFEEHKFLRAVKNVSVNEPFFQGHFPG 80

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 81  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 140

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 141 EKTRRGLTRFKGVAMVDGKIVCEATMMCA 169


>gi|156975495|ref|YP_001446402.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio harveyi ATCC
           BAA-1116]
 gi|269960602|ref|ZP_06174974.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           harveyi 1DA3]
 gi|156527089|gb|ABU72175.1| hypothetical protein VIBHAR_03226 [Vibrio harveyi ATCC BAA-1116]
 gi|269834679|gb|EEZ88766.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Vibrio
           harveyi 1DA3]
          Length = 143

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 2   NISEIQELLPHRYPFLLIDRVIDFQEEKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD++   V  ++ R  
Sbjct: 62  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQMIIEVEFLKERRG 116

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F+  AKV+  VV  AE+ CA
Sbjct: 117 IAAFKGVAKVDGEVVCSAELKCA 139


>gi|88812388|ref|ZP_01127638.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrococcus mobilis Nb-231]
 gi|88790395|gb|EAR21512.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrococcus mobilis Nb-231]
          Length = 149

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 92/145 (63%), Gaps = 8/145 (5%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++ +LPHR+PFL++D+V+     E  +G+KNV+ NEP+F GHFP RPVMPGVLILE
Sbjct: 2   DIHGILNYLPHRFPFLMIDRVLECIPGEMLVGVKNVSINEPYFSGHFPQRPVMPGVLILE 61

Query: 72  GMAQTAG--AICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            MAQ  G  A        D+  P      YL+ I+KA+F++PV PGD+L   V   R+  
Sbjct: 62  AMAQACGLLAFKTREQQPDEQQPDATKIFYLVGIEKAKFKRPVEPGDQLRLSVRFSRSMR 121

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            +W F+  + V+  +VA+A+I C M
Sbjct: 122 GIWMFEAESYVQQILVAQAQIRCTM 146


>gi|260913169|ref|ZP_05919651.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pasteurella dagmatis ATCC 43325]
 gi|260632756|gb|EEX50925.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pasteurella dagmatis ATCC 43325]
          Length = 157

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 87/135 (64%), Gaps = 3/135 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M+ LPHRYPFLLVD+VV+ +  +    +KN++ NEP F GHFP +P+ PGVLILE MA
Sbjct: 20  EIMKLLPHRYPFLLVDRVVDYEAGKWLKAVKNISVNEPCFTGHFPEQPIFPGVLILEAMA 79

Query: 75  QTAGAI-CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q  G + C  H   +     Y  +ID ARF++PV PGD++   V+ V+ R  + +F   A
Sbjct: 80  QATGVLACKTHRQLENEL-YYFAAIDNARFKRPVLPGDQMMLEVHFVKERRGVTRFTGVA 138

Query: 134 KVENTVVAEAEI-CA 147
            V+  VV EAE+ CA
Sbjct: 139 TVDGQVVCEAELMCA 153


>gi|238918785|ref|YP_002932299.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ,
           [Edwardsiella ictaluri 93-146]
 gi|238868353|gb|ACR68064.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ, putative
           [Edwardsiella ictaluri 93-146]
          Length = 163

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           + +D   L+  +I+EL   LPHR+PFLLVD+V++ Q  +    +KNV+FNEP F GHFPG
Sbjct: 13  LTTDTHTLNISEILEL---LPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNEPFFQGHFPG 69

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 70  KPIFPGVLILEAMAQATGILAFKSAGKLEPGELYYFAGIDDARFKRPVHPGDQMILEVEF 129

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F   AKV+  +V EA  +CA
Sbjct: 130 LKERRGVARFNGVAKVDGKIVCEASMMCA 158


>gi|307129831|ref|YP_003881847.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Dickeya
           dadantii 3937]
 gi|306527360|gb|ADM97290.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Dickeya
           dadantii 3937]
          Length = 151

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 90/137 (65%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ ++ +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 10  IEEILDLLPHRYPFLLVDRVLDFEKGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 69

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  ++ R  + +F+ 
Sbjct: 70  MAQATGILAFKSLGKLEPGELYYFAAVDEARFKRPVAPGDQMILEVEFLKERRGIARFKG 129

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  +  EAE +CA
Sbjct: 130 VAKVDGEIACEAEMMCA 146


>gi|269468218|gb|EEZ79908.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [uncultured SUP05 cluster bacterium]
          Length = 147

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 92/140 (65%), Gaps = 10/140 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++  FLPHRYPFLL+D+V+ ++  +S + IKNV+FNEP F GHFP +P+MPGV+I+E
Sbjct: 4   NINDVKNFLPHRYPFLLIDRVLELEVGKSLVAIKNVSFNEPQFTGHFPDQPIMPGVMIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            +AQ  G I A  +   +   P       L+ IDK RF++ V PGD+L   V  +  +  
Sbjct: 64  ALAQATG-ILAFKS---EVGKPIDGQIYMLVGIDKVRFKRMVEPGDQLRLEVEVMTVKRG 119

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           +WKF+C A V+++VV  AE+
Sbjct: 120 IWKFKCRALVDDSVVTTAEL 139


>gi|113476834|ref|YP_722895.1| (3R)-hydroxymyristoyl-ACP dehydratase [Trichodesmium erythraeum
           IMS101]
 gi|110167882|gb|ABG52422.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Trichodesmium
           erythraeum IMS101]
          Length = 174

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 89/143 (62%), Gaps = 10/143 (6%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+ + LPHRYPF LVD+++     E A+GIKNVTFNEPHF GHFPGRP+MPGVLI+E 
Sbjct: 36  IEEIHKILPHRYPFALVDRIIEYVPGEKAVGIKNVTFNEPHFQGHFPGRPIMPGVLIIEA 95

Query: 73  MAQTAGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW- 127
           +AQ  G I A    I  G   +A     ++DK +FR+PV PGD+L      +  + + + 
Sbjct: 96  LAQVGGIISAQMPNIKEGLFVFA-----AMDKVKFRRPVLPGDQLILTTELLSFKSNKFA 150

Query: 128 KFQCCAKVENTVVAEAEICAMVM 150
           K +  A+V+    AE ++   +M
Sbjct: 151 KMRGVAEVDGQKAAEGDLMFSMM 173


>gi|331005961|ref|ZP_08329306.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [gamma
           proteobacterium IMCC1989]
 gi|330420206|gb|EGG94527.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [gamma
           proteobacterium IMCC1989]
          Length = 144

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+ ++LPHRYPFLLVD+VV +   ES +  KN+T NE  F GHFP  P+ PGV+I+E
Sbjct: 2   DVTEIKKWLPHRYPFLLVDRVVELNAGESIVAYKNITVNEEVFNGHFPQAPIFPGVMIIE 61

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ +G +     +   Q    YL +  DK RFR+ V PGDRL+     +  +  +WKF
Sbjct: 62  AMAQASGILGFKTMDKTPQDGSVYLFAGADKVRFRRQVIPGDRLQLEAKVISKKRGIWKF 121

Query: 130 QCCAKVENTVVAEAEI-CA 147
            C A V+  + A A I CA
Sbjct: 122 DCTASVDGELAASATILCA 140


>gi|161508108|ref|YP_001578075.1| carrier protein [Lactobacillus helveticus DPC 4571]
 gi|260102042|ref|ZP_05752279.1| 3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Lactobacillus helveticus DSM 20075]
 gi|172048392|sp|A8YXS1|FABZ_LACH4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|160349097|gb|ABX27771.1| Carrier protein [Lactobacillus helveticus DPC 4571]
 gi|260084144|gb|EEW68264.1| 3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Lactobacillus helveticus DSM 20075]
 gi|323467388|gb|ADX71075.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Lactobacillus helveticus H10]
 gi|328464256|gb|EGF35696.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Lactobacillus helveticus MTCC 5463]
          Length = 148

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 88/144 (61%), Gaps = 1/144 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D  E+M  +P+RYP L +DKV  +   ES +  KNVT NE  F GHFPG PVMPGVLI+E
Sbjct: 5   DAAEIMDLIPNRYPILFMDKVDELNPGESIVCTKNVTINEEFFQGHFPGNPVMPGVLIIE 64

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ A +I  +     Q    YL +ID A+FRK V PGD L+ HV   + R ++ K +C
Sbjct: 65  SLAQ-AASILILKTEKYQGKTAYLGAIDSAKFRKVVRPGDVLKLHVTMEKQRDNMGKVKC 123

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            AKVE+ V   AE+  +V   KK+
Sbjct: 124 EAKVEDKVACSAELTFIVPDPKKK 147


>gi|162451131|ref|YP_001613498.1| (3R)-hydroxymyristoyl [Sorangium cellulosum 'So ce 56']
 gi|189044402|sp|A9GEI9|FABZ_SORC5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|161161713|emb|CAN93018.1| (3R)-hydroxymyristoyl- [Sorangium cellulosum 'So ce 56']
          Length = 155

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (62%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYP ++VD+V  I  ++   G K V +NEP F GHFP RP+MPGVLILE
Sbjct: 12  DIHQILSILPHRYPLVMVDRVTEITANKCIRGYKCVAYNEPWFQGHFPQRPIMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            + Q  G +    + FD  +   + + IDKA+FR  V PGDRL+ +   + +R ++WK +
Sbjct: 72  SLTQLGGILAYASDPFDATSNLMFFLGIDKAKFRHTVTPGDRLDLYAEVLHHRSNVWKLR 131

Query: 131 CCAKVENTVVAEAEICAMVM 150
             A V+ T+ AE E+ A ++
Sbjct: 132 GEASVDGTLCAEGEMLASIV 151


>gi|54310073|ref|YP_131093.1| (3R)-hydroxymyristoyl-ACP dehydratase [Photobacterium profundum
           SS9]
 gi|62286819|sp|Q6LN35|FABZ_PHOPR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|46914512|emb|CAG21291.1| 3R-hydroxymyristoyl-acyl-carrier-protein dehydratase
           [Photobacterium profundum SS9]
          Length = 150

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 85/143 (59%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFL++D+V + +  ++    KNV+ NEP F GHFP  P+ PGV+ILE
Sbjct: 9   NITEIQALLPHRYPFLMIDRVTDYEEGQTLTAYKNVSINEPLFTGHFPKMPIFPGVMILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SIDKA+FRKPV PGD+L  +V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASIDKAKFRKPVVPGDQLVLNVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IALFNGTAKVDGEVVCSAELKCA 146


>gi|123443474|ref|YP_001007447.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|158512885|sp|A1JP70|FABZ_YERE8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|122090435|emb|CAL13303.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase (EC
           4.2.1.-) [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 168

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|307546383|ref|YP_003898862.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Halomonas
           elongata DSM 2581]
 gi|307218407|emb|CBV43677.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Halomonas
           elongata DSM 2581]
          Length = 163

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 92/156 (58%), Gaps = 16/156 (10%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           ++S++A +   DI E+  +LPHRYPFLLVD+V  I   ES +  KNV+ NEP F GHFP 
Sbjct: 10  VMSEVATM-VMDINEIREYLPHRYPFLLVDRVTEIALGESIVAYKNVSINEPFFNGHFPH 68

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGF--------DQYAPPYLMSIDKARFRKPVFPGDR 112
            P+MPGVL++E +AQ  G +     GF        D Y   YL+  D  RF++PV PGD+
Sbjct: 69  HPIMPGVLVIEALAQACGIL-----GFKTVNKLPADGYV-YYLVGSDNVRFKRPVMPGDQ 122

Query: 113 LEYHVNKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           L       R +  +WKF C A V+  V  EAE ICA
Sbjct: 123 LRLEALVEREKRGIWKFACKATVDGDVACEAEIICA 158


>gi|294789616|ref|ZP_06754850.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Simonsiella muelleri ATCC 29453]
 gi|294482417|gb|EFG30110.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Simonsiella muelleri ATCC 29453]
          Length = 151

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 92/142 (64%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPF+L+D+++  +  +S   IKN++ NEP FMGHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFMLLDRIMAFESGKSLTAIKNISMNEPQFMGHFPDFPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  GA+  +  G   +   Y  + ID ARF++ V PGD+L + +  ++++  +
Sbjct: 64  LIIEAMAQACGALAILTEGGRNHDEIYFFAGIDNARFKRQVIPGDQLTFQIQLLQSKRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   A V + +  EAEI CA
Sbjct: 124 GKFAAQAFVGDELAVEAEIMCA 145


>gi|148244658|ref|YP_001219352.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326485|dbj|BAF61628.1| 3R-hydroxymyristoyl ACP dehydrase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 147

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 89/136 (65%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++  +LPHRYPFLL+D+V+ ++  +S + +KNVTFNEP F+GHFP +P+MPGV+I+E
Sbjct: 4   NIQDVKNYLPHRYPFLLIDRVLELEVGKSIVALKNVTFNEPQFIGHFPDQPIMPGVMIVE 63

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G  A  A  +         L+ IDK RF++ V PGD+L   V  V  +  +WKF
Sbjct: 64  ALAQATGILAFKAEVSKPTNGQIYMLVGIDKVRFKRMVEPGDQLRLEVGIVTVKRGIWKF 123

Query: 130 QCCAKVENTVVAEAEI 145
           +C A V++  +  AE+
Sbjct: 124 KCKATVDSQTITSAEL 139


>gi|319779555|ref|YP_004130468.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Taylorella equigenitalis MCE9]
 gi|317109579|gb|ADU92325.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Taylorella equigenitalis MCE9]
          Length = 156

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 91/145 (62%), Gaps = 11/145 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M  +PHRYP LLVD+V+ ++  +  + IKNVT NEP F GHFP  PVMPGV I+E
Sbjct: 10  DIKEIMERIPHRYPMLLVDRVLEMEPAKRIVAIKNVTVNEPFFTGHFPEMPVMPGVFIIE 69

Query: 72  GMAQTAGAI-------CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            MAQ A           A+    + Y   YL+ +D ARFR+PV PGD+L + V+ +R   
Sbjct: 70  AMAQCAAIFSFAKPNSSAVDTQEEIY---YLVGVDDARFRRPVVPGDQLRFEVDAIRISK 126

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAM 148
            + K+   A V+N +VAEA++ CA+
Sbjct: 127 VMCKYDAKAYVDNQLVAEAKLMCAV 151


>gi|295400720|ref|ZP_06810697.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112588|ref|YP_003990904.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. Y4.1MC1]
 gi|294977301|gb|EFG52902.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217689|gb|ADP76293.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. Y4.1MC1]
          Length = 145

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 95/148 (64%), Gaps = 4/148 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           LD++ I E+   +PHRYPFLLVD+++ I+  + A+GIKNV+ NEP F+GHFPG PVMPGV
Sbjct: 2   LDSQQIQEI---IPHRYPFLLVDRILEIEDGKRAVGIKNVSVNEPFFVGHFPGYPVMPGV 58

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E +AQ  GA+  +    ++    +   ID  RF+K V PGD+L   V  +R +  + 
Sbjct: 59  LIVEALAQV-GAVAMLKKEENRGRLAFFAGIDSCRFKKQVKPGDQLRLEVEIIRAKGAVG 117

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEKKE 155
           K +  A V+  +V EAEI   +  +K+E
Sbjct: 118 KGKGVATVDGELVCEAEIMFALGDKKEE 145


>gi|312796255|ref|YP_004029177.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Burkholderia rhizoxinica HKI 454]
 gi|312168030|emb|CBW75033.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (EC
           4.2.1.-) [Burkholderia rhizoxinica HKI 454]
          Length = 154

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 89/139 (64%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYP LLVD+V+ ++  +    +KNVT NEP+F+GHFP RPVMPGVLILE
Sbjct: 9   DIHKIFTLLPHRYPILLVDRVLELEPHKRIKALKNVTINEPYFIGHFPTRPVMPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQTAG +       D      Y + ID ARF++ V PGD+L  +++  R    +WKF+
Sbjct: 69  ALAQTAGLLTFSEEPHDPDTTLYYFVGIDNARFKRVVEPGDQLILNISFERYMRGIWKFK 128

Query: 131 CCAKVENTVVAEAEICAMV 149
             A+VE ++  EA++   V
Sbjct: 129 GRAEVEGSLAVEADLMCTV 147


>gi|28868751|ref|NP_791370.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969129|ref|ZP_03397268.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. tomato T1]
 gi|301383976|ref|ZP_07232394.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302064138|ref|ZP_07255679.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           tomato K40]
 gi|302134065|ref|ZP_07260055.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|33516887|sp|Q886N2|FABZ_PSESM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|28851990|gb|AAO55065.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926127|gb|EEB59683.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. tomato T1]
 gi|330872716|gb|EGH06865.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964154|gb|EGH64414.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016378|gb|EGH96434.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 146

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 85/140 (60%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPQHPIMPGVLII 62

Query: 71  EGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG  A   + +        Y +  DK RFR+PVFPGD+L      + ++  +WK
Sbjct: 63  EAMAQAAGILAFKMLDSKPSDGTLYYFVGSDKLRFRQPVFPGDKLVLEATFLSSKRQIWK 122

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F+C A V+   V  AE ICA
Sbjct: 123 FECKATVDGKAVCSAEIICA 142


>gi|291616356|ref|YP_003519098.1| FabZ [Pantoea ananatis LMG 20103]
 gi|291151386|gb|ADD75970.1| FabZ [Pantoea ananatis LMG 20103]
 gi|327392808|dbj|BAK10230.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase FabZ
           [Pantoea ananatis AJ13355]
          Length = 151

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 91/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V++ + ++    +KNV+FNEP F GHFPG
Sbjct: 1   MTTETHTLQIEEILEL---LPHRYPFLLVDRVLDFEENKYLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDNARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F   A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFNGVATVDGKIVCEATMMCA 146


>gi|190359487|sp|A5CWN9|FABZ_VESOH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 89/136 (65%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++  +LPHRYPFLL+D+V+ ++  +S + +KNVTFNEP F+GHFP +P+MPGV+I+E
Sbjct: 2   NIQDVKNYLPHRYPFLLIDRVLELEVGKSIVALKNVTFNEPQFIGHFPDQPIMPGVMIVE 61

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G  A  A  +         L+ IDK RF++ V PGD+L   V  V  +  +WKF
Sbjct: 62  ALAQATGILAFKAEVSKPTNGQIYMLVGIDKVRFKRMVEPGDQLRLEVGIVTVKRGIWKF 121

Query: 130 QCCAKVENTVVAEAEI 145
           +C A V++  +  AE+
Sbjct: 122 KCKATVDSQTITSAEL 137


>gi|23100401|ref|NP_693868.1| hydroxymyristoyl-[acyl carrier protein] dehydratase [Oceanobacillus
           iheyensis HTE831]
 gi|33516897|sp|Q8EMB1|FABZ_OCEIH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|22778634|dbj|BAC14902.1| hydroxymyristoyl-[acyl carrier protein] dehydratase [Oceanobacillus
           iheyensis HTE831]
          Length = 140

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (62%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   +PHRYPFLLVDKVV IQ  E    +KNV+ NEP F GHFP  PVMPGVLILE
Sbjct: 3   DVEQVKEIIPHRYPFLLVDKVVEIQEGEKVTALKNVSVNEPFFQGHFPEYPVMPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT GAI  ++   ++    +L  +DK RF++ V PGD+L   V  +R +  + K + 
Sbjct: 63  ALAQT-GAIAVLNIEENKGKIGFLAGVDKCRFKRQVKPGDQLNLQVEIIRMKGPIGKGKG 121

Query: 132 CAKVENTVVAEAEIC 146
            A V+  V  EAEI 
Sbjct: 122 IATVDGEVACEAEIT 136


>gi|220934344|ref|YP_002513243.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|254788538|sp|B8GQ61|FABZ_THISH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|219995654|gb|ACL72256.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 149

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 6/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I ++MR+LPHRYPFLLVD+V + +  E    IKNV+ NEP+F GHFP RPVMPGVLI+E
Sbjct: 2   SIHQVMRYLPHRYPFLLVDRVTDFKPGEYLEAIKNVSINEPYFQGHFPIRPVMPGVLIME 61

Query: 72  GMAQTAGAIC-----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            +AQ  G +      A +   D+      + ID+ARFR+ V PGD+L   V  +R    +
Sbjct: 62  ALAQATGLLAFKTEEARNENQDKQQLYLFVGIDEARFRRQVEPGDQLHLRVELLRVVRGI 121

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
           W+F+  A+V   +VA A + CA
Sbjct: 122 WRFKAEARVNGDLVASATLMCA 143


>gi|28899081|ref|NP_798686.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153839484|ref|ZP_01992151.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AQ3810]
 gi|260362396|ref|ZP_05775351.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus K5030]
 gi|260876837|ref|ZP_05889192.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AN-5034]
 gi|260897269|ref|ZP_05905765.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus Peru-466]
 gi|308126536|ref|ZP_05910769.2| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AQ4037]
 gi|31340074|sp|Q87ME8|FABZ_VIBPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|28807305|dbj|BAC60570.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149746989|gb|EDM57977.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AQ3810]
 gi|308085345|gb|EFO35040.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus Peru-466]
 gi|308091485|gb|EFO41180.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AN-5034]
 gi|308110183|gb|EFO47723.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus AQ4037]
 gi|308113976|gb|EFO51516.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Vibrio
           parahaemolyticus K5030]
 gi|328474382|gb|EGF45187.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio parahaemolyticus
           10329]
          Length = 150

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V++ Q  +    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NISEIQELLPHRYPFLLIDRVIDFQEAKYLHAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD++   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPTENELYYFASVDGAKFRKPVVPGDQMVIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  AE+ CA
Sbjct: 124 IAAFSGVAKVDGEVVCSAELKCA 146


>gi|332186085|ref|ZP_08387831.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingomonas sp. S17]
 gi|332013900|gb|EGI55959.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingomonas sp. S17]
          Length = 146

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 81/139 (58%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +M  LPHRYP LLVD+V  I  D S   +K VT NE  F GHFPGRP+MPGVLI+E
Sbjct: 2   DVTRVMAALPHRYPMLLVDRVEEIILDTSIRAVKAVTMNEGFFQGHFPGRPIMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ AG +     G        Y M+I+ A+FRKPV PG  L   V  V+ R  + KF 
Sbjct: 62  ALAQAAGVLAVESLGLAGSGKLVYFMAIEGAKFRKPVEPGVLLHLEVEFVQKRSSVCKFA 121

Query: 131 CCAKVENTVVAEAEICAMV 149
             A ++   VAEA   AM+
Sbjct: 122 GVAMIDGVAVAEANFTAMI 140


>gi|332160603|ref|YP_004297180.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|397538|emb|CAA80952.1| unknown [Yersinia enterocolitica]
 gi|318606919|emb|CBY28417.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664833|gb|ADZ41477.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859610|emb|CBX69950.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein]dehydratase [Yersinia
           enterocolitica W22703]
          Length = 201

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (7%)

Query: 1   MISDLACLDAKDIV----------ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFN 50
           ++  ++ LD K I+          E++  LPHR+PFLLVD+V++ +  +    +KNV+FN
Sbjct: 11  VVDSISFLDRKSILTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFN 70

Query: 51  EPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFP 109
           EP F GHFPG+P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV P
Sbjct: 71  EPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVP 130

Query: 110 GDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           GD++   V  V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 131 GDQMIMEVEFVKERRGLTRFTGVAKVDGEIVCTATMMCA 169


>gi|46199765|ref|YP_005432.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Thermus
           thermophilus HB27]
 gi|55981784|ref|YP_145081.1| (3R)-hydroxymyristoyl-ACP dehydratase [Thermus thermophilus HB8]
 gi|62286834|sp|Q72HM3|FABZ_THET2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|81363759|sp|Q5SHB5|FABZ_THET8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|46197392|gb|AAS81805.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Thermus
           thermophilus HB27]
 gi|55773197|dbj|BAD71638.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase [Thermus
           thermophilus HB8]
          Length = 142

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 82/136 (60%), Gaps = 3/136 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+++ LPHRYPFLLVD+V  ++ DE     +KNVTFNEPHF GHFPG PVMPGVLIL
Sbjct: 2   DIREILKVLPHRYPFLLVDRV--LEADERRFKALKNVTFNEPHFQGHFPGHPVMPGVLIL 59

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E MAQ A        GF Q    +L  ++ ARFR+PV+PGD L      +  R  + K  
Sbjct: 60  EAMAQAAVGALVRQPGFPQGGLAFLAGVEGARFRRPVYPGDTLILEGELLAFRRGVGKVA 119

Query: 131 CCAKVENTVVAEAEIC 146
             A VE    A A + 
Sbjct: 120 VRALVEGEERASATLT 135


>gi|52424515|ref|YP_087652.1| FabA protein [Mannheimia succiniciproducens MBEL55E]
 gi|62286782|sp|Q65VE3|FABZ_MANSM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|52306567|gb|AAU37067.1| FabA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 150

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 83/134 (61%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+VV+ +  +     KN++ NEP F GHFPG+P++PGVLILE +A
Sbjct: 15  EIMTLLPHRYPFLLVDRVVDFEEGQWLKAYKNISVNEPCFTGHFPGQPILPGVLILEALA 74

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q+ G +    +        Y   ID ARF++PV PGDRLE  V  ++ R  +  F   A 
Sbjct: 75  QSMGLLAFKTHEIKGGELFYFAGIDDARFKRPVLPGDRLELFVEVIKERRGITSFTGVAS 134

Query: 135 VENTVVAEAEI-CA 147
           V+  V  EA++ CA
Sbjct: 135 VDGEVACEAKLMCA 148


>gi|294102486|ref|YP_003554344.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aminobacterium colombiense DSM 12261]
 gi|293617466|gb|ADE57620.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aminobacterium colombiense DSM 12261]
          Length = 152

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 91/148 (61%), Gaps = 3/148 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M+ LPHRYPFLLVD+++ +  +   +G+KNV+ NEP F GHFP  PVMPGVLILE
Sbjct: 3   DIDKIMKALPHRYPFLLVDRILEVGENR-VVGLKNVSINEPFFTGHFPDEPVMPGVLILE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            M Q A  +        Q    YL  +DKARFR+PV PGD+L      V++R  + K + 
Sbjct: 62  AMGQVAAMMIVCRPNM-QNMVTYLTGVDKARFRRPVRPGDQLITTAEMVKSRGLMGKVKA 120

Query: 132 CAKVENTVVAEAEICAMVMHEKKEKNES 159
            + V+  + AEAE  +  M E+  K E+
Sbjct: 121 RSGVDGELAAEAE-YSFFMAERLSKKEA 147


>gi|149366944|ref|ZP_01888977.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Yersinia
           pestis CA88-4125]
 gi|165927057|ref|ZP_02222889.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165939810|ref|ZP_02228350.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|167419745|ref|ZP_02311498.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|218928223|ref|YP_002346098.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis CO92]
 gi|229840984|ref|ZP_04461143.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229843085|ref|ZP_04463235.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|294503072|ref|YP_003567134.1| (3R)-hydroxymyristoyl ACP dehydratase [Yersinia pestis Z176003]
 gi|21362555|sp|Q8ZH57|FABZ_YERPE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|115346834|emb|CAL19720.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase (EC
           4.2.1.-) [Yersinia pestis CO92]
 gi|149290558|gb|EDM40634.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Yersinia
           pestis CA88-4125]
 gi|165912213|gb|EDR30850.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165920953|gb|EDR38177.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|166962486|gb|EDR58507.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|229689961|gb|EEO82020.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229697350|gb|EEO87397.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|294353531|gb|ADE63872.1| (3R)-hydroxymyristoyl ACP dehydratase [Yersinia pestis Z176003]
          Length = 181

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|22127000|ref|NP_670423.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis KIM 10]
 gi|45442563|ref|NP_994102.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597307|ref|YP_071498.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pseudotuberculosis
           IP 32953]
 gi|108806528|ref|YP_650444.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis Antiqua]
 gi|108813105|ref|YP_648872.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis Nepal516]
 gi|145598939|ref|YP_001163015.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis Pestoides F]
 gi|153949276|ref|YP_001400008.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pseudotuberculosis
           IP 31758]
 gi|162419992|ref|YP_001607761.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pestis Angola]
 gi|166011911|ref|ZP_02232809.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166211354|ref|ZP_02237389.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167399930|ref|ZP_02305448.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167425336|ref|ZP_02317089.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|167470462|ref|ZP_02335166.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis FV-1]
 gi|170023326|ref|YP_001719831.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pseudotuberculosis
           YPIII]
 gi|186896412|ref|YP_001873524.1| (3R)-hydroxymyristoyl-ACP dehydratase [Yersinia pseudotuberculosis
           PB1/+]
 gi|229837762|ref|ZP_04457922.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis Pestoides A]
 gi|229903548|ref|ZP_04518661.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis Nepal516]
 gi|270487329|ref|ZP_06204403.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis KIM D27]
 gi|62286787|sp|Q667K0|FABZ_YERPS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|123245972|sp|Q1CAM3|FABZ_YERPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|123372994|sp|Q1CFF8|FABZ_YERPN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|158514078|sp|A4TL80|FABZ_YERPP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166971622|sp|A7FFI0|FABZ_YERP3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700830|sp|B2JZ23|FABZ_YERPB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700831|sp|A9R385|FABZ_YERPG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700832|sp|B1JQH1|FABZ_YERPY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|21960046|gb|AAM86674.1|AE013913_4 (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis KIM 10]
 gi|45437428|gb|AAS62979.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51590589|emb|CAH22230.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776753|gb|ABG19272.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Yersinia pestis
           Nepal516]
 gi|108778441|gb|ABG12499.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Yersinia pestis
           Antiqua]
 gi|145210635|gb|ABP40042.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Yersinia pestis
           Pestoides F]
 gi|152960771|gb|ABS48232.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352807|gb|ABX86755.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis Angola]
 gi|165989177|gb|EDR41478.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166207125|gb|EDR51605.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167050638|gb|EDR62046.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167055736|gb|EDR65520.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169749860|gb|ACA67378.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pseudotuberculosis YPIII]
 gi|186699438|gb|ACC90067.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679318|gb|EEO75421.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis Nepal516]
 gi|229704139|gb|EEO91151.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis Pestoides A]
 gi|262361110|gb|ACY57831.1| (3R)-hydroxymyristoyl ACP dehydratase [Yersinia pestis D106004]
 gi|262365350|gb|ACY61907.1| (3R)-hydroxymyristoyl ACP dehydratase [Yersinia pestis D182038]
 gi|270335833|gb|EFA46610.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Yersinia
           pestis KIM D27]
 gi|320014189|gb|ADV97760.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 176

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|256831138|ref|YP_003159866.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfomicrobium baculatum DSM 4028]
 gi|256580314|gb|ACU91450.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfomicrobium baculatum DSM 4028]
          Length = 155

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 95/144 (65%), Gaps = 7/144 (4%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           ++DI++L   LPHRYPFL+VD+V++ +  +S   IK+V+ NEP F GHFP  PVMPGVLI
Sbjct: 12  SRDILDL---LPHRYPFLMVDRVLSFEPMKSVHAIKSVSINEPFFQGHFPSYPVMPGVLI 68

Query: 70  LEGMAQTAGAICAIHN--GFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LE +AQT G I  I +    D     +L + ++K RFR+PVFPGD+L  HV   R+++ +
Sbjct: 69  LEALAQT-GGIMVIKSLPPADTVGKIFLFTGMEKVRFRRPVFPGDQLHLHVTYERHKMMM 127

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
           WK    A V+  VVAE  + A ++
Sbjct: 128 WKTNGKAMVDGKVVAEGILTASIV 151


>gi|312883819|ref|ZP_07743538.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368568|gb|EFP96101.1| (3R)-hydroxymyristoyl-ACP dehydratase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 150

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+   LPHRYPFL++D+V++ Q ++    IKNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   DITEIQELLPHRYPFLMIDRVLDFQEEKFLKAIKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  S+D A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKSFGAPSENELYYFASVDGAKFRKPVVPGDQLVIEVEFLKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   A V+  VV  AE+ CA
Sbjct: 124 IAAFSGKALVDGEVVCSAELKCA 146


>gi|304558148|gb|ADM40812.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Edwardsiella tarda FL6-60]
          Length = 163

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           + +D   L+  +I+EL   LPHR+PFLLVD+V++ Q  +    +KNV+FNEP F GHFPG
Sbjct: 13  LTTDTHTLNISEILEL---LPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNEPFFQGHFPG 69

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 70  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVHPGDQMILEVEF 129

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F   AKV+  +V EA  +CA
Sbjct: 130 LKERRGVARFNGVAKVDGKIVCEASMMCA 158


>gi|238796620|ref|ZP_04640127.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           mollaretii ATCC 43969]
 gi|238719598|gb|EEQ11407.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           mollaretii ATCC 43969]
          Length = 163

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|332284290|ref|YP_004416201.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pusillimonas sp. T7-7]
 gi|330428243|gb|AEC19577.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pusillimonas sp. T7-7]
          Length = 150

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M  LPHR+P LLVD+V+ +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKQIMDRLPHRHPMLLVDRVLEMVPGKSIVAIKNVSMNEPFFTGHFPHHPVMPGVLIIE 63

Query: 72  GMAQTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ A        +  N  D+    YL+ +D ARFR+PV PGD+L   V   R    + 
Sbjct: 64  ALAQAAALFSFEDDSGVNPSDKKIAYYLVGVDGARFRRPVVPGDQLRLEVTADRISRSIC 123

Query: 128 KFQCCAKVENTVVAEAEI-CAM 148
           K+  CA V+  V AEA+I CA+
Sbjct: 124 KYTACATVDGQVAAEAKIMCAI 145


>gi|260772233|ref|ZP_05881149.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           metschnikovii CIP 69.14]
 gi|260611372|gb|EEX36575.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Vibrio
           metschnikovii CIP 69.14]
          Length = 150

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (58%), Gaps = 12/143 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+   LPHRYPFLL+D+V + +  +  +G+KNV+ NEP F GHFP  PV PGVLILE
Sbjct: 9   NITEIQSLLPHRYPFLLIDRVTDYEEGKYLVGLKNVSVNEPQFTGHFPQLPVFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
            MAQ  G +      F  +  P      Y  SID A+FRKPV PGD+L   V  ++ R  
Sbjct: 69  AMAQATGLLA-----FKTFGAPKENELYYFASIDNAKFRKPVGPGDQLMIEVEFIKERRG 123

Query: 126 LWKFQCCAKVENTVVAEAEI-CA 147
           +  F   AKV+  VV  A + CA
Sbjct: 124 IALFNGVAKVDGDVVCSAVLKCA 146


>gi|294140015|ref|YP_003555993.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella violacea DSS12]
 gi|293326484|dbj|BAJ01215.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella violacea DSS12]
          Length = 152

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 88/144 (61%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+M  LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEIMNSLPHRYPFLLIDRVLDYTPGESLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +   +   +  A     Y   IDKARF++ V PGD+L + V  V+ R 
Sbjct: 65  LILEAMAQATGLLA--YKSMEAAAEESLYYFAGIDKARFKRVVEPGDQLHFEVKLVKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +  F    +V+  +V  A+I CA
Sbjct: 123 GIGVFTGEVRVDGELVCSAQIMCA 146


>gi|325579120|ref|ZP_08149076.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325159355|gb|EGC71489.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 149

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 14  EIMTLLPHRYPFLLVDRVLDYKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 73

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q+ G +    +        Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 74  QSMGILAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITAFTGIAT 133

Query: 135 VENTVVAEAEI-CA 147
           V   V  EA++ CA
Sbjct: 134 VNGEVACEAKLMCA 147


>gi|269958463|ref|YP_003328250.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma centrale str.
           Israel]
 gi|269848292|gb|ACZ48936.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma centrale str.
           Israel]
          Length = 147

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++MR LPH YPFLLVD+V+     +S + +KNVTFNEP F+GHF   PVMPGVLI+E MA
Sbjct: 9   QIMRMLPHSYPFLLVDRVLECTPGKSIVALKNVTFNEPFFVGHFRDNPVMPGVLIIESMA 68

Query: 75  QTAGAICAIHN----GFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           Q++  +C + +    G       Y MSID A+FR+ V PGD L      +  R    KFQ
Sbjct: 69  QSS-MLCVVDDRGEGGARGDQSVYFMSIDAAKFRRMVVPGDALTIKSTVIHMRGATCKFQ 127

Query: 131 CCAKVENTVVAEAEICAMV 149
           C A V + + +EA+I AM+
Sbjct: 128 CHAYVGDELASEAQILAMM 146


>gi|293394714|ref|ZP_06639006.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Serratia
           odorifera DSM 4582]
 gi|291422840|gb|EFE96077.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Serratia
           odorifera DSM 4582]
          Length = 175

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 33  DIAEILELLPHRYPFLLVDRVLEFEEHKYLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 92

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 93  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 152

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  +V EA  +CA
Sbjct: 153 GVATVDGKIVCEATMMCA 170


>gi|237745606|ref|ZP_04576086.1| 3R-hydroxymyristoyl ACP dehydrase [Oxalobacter formigenes HOxBLS]
 gi|229376957|gb|EEO27048.1| 3R-hydroxymyristoyl ACP dehydrase [Oxalobacter formigenes HOxBLS]
          Length = 155

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 90/151 (59%), Gaps = 3/151 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++   LPHRYP LLVD+V++ +  +    IKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 5   NIHQIRELLPHRYPMLLVDRVLDWEAGKKITAIKNVTANEEFFNGHFPDHPVMPGVLIIE 64

Query: 72  GMAQTAGAICAIH--NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQTA     I   +  D+ A  Y  +ID ARF++PV PGD+L      +RN   +WKF
Sbjct: 65  ALAQTAAIFAFISHDSKLDKDALVYFATIDSARFKRPVEPGDQLVMEAELIRNSRGMWKF 124

Query: 130 QCCAKVENTVVAEAEI-CAMVMHEKKEKNES 159
           +    V+  +  EAE+ CA+      +K ES
Sbjct: 125 KTRGLVDGQLAVEAELMCAIRGGVVAQKAES 155


>gi|163782199|ref|ZP_02177198.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882731|gb|EDP76236.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Hydrogenivirga sp. 128-5-R1-1]
          Length = 154

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D++E+M  LPHRYP LLVD++V  +  +  +GIKNV+ NEP F GHFPG P+ PGV +LE
Sbjct: 8   DVLEIMNILPHRYPILLVDRIVEYEEGKRIVGIKNVSVNEPVFQGHFPGFPLFPGVYVLE 67

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G   I +++    +YA  +   ID ARF++PVFPGD++   +  +  +  L K 
Sbjct: 68  AMAQVGGILMIKSLNLEIGKYAIVF-AGIDGARFKRPVFPGDQIRMELEAISLKKTLSKM 126

Query: 130 QCCAKVENTVVAEAEICA 147
           +  A V+  VV EA + A
Sbjct: 127 KGVATVDGQVVTEAVLLA 144


>gi|227114698|ref|ZP_03828354.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 151

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 94/149 (63%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAVDEARFKRPVQPGDQMILEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F+  AKV+  V  EA  +CA
Sbjct: 118 IKERRGVARFKGVAKVDGEVACEASMMCA 146


>gi|238792744|ref|ZP_04636375.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           intermedia ATCC 29909]
 gi|238727852|gb|EEQ19375.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           intermedia ATCC 29909]
          Length = 195

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (7%)

Query: 1   MISDLACLDAKDIV----------ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFN 50
           ++  ++ LD K I+          E++  LPHR+PFLLVD+V++ +  +    +KNV+FN
Sbjct: 11  VVDSISFLDRKSILTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFN 70

Query: 51  EPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFP 109
           EP F GHFPG+P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV P
Sbjct: 71  EPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVP 130

Query: 110 GDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           GD++   V  V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 131 GDQMIMEVQFVKERRGLTRFTGVAKVDGEIVCTATMMCA 169


>gi|238754796|ref|ZP_04616147.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           ruckeri ATCC 29473]
 gi|238706956|gb|EEP99322.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           ruckeri ATCC 29473]
          Length = 161

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 91/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I++L   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILDL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDDARFKRPVVPGDQMIMEVEF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 118 VKERRGLTRFTGVAKVDGEIVCTATMMCA 146


>gi|238759937|ref|ZP_04621091.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           aldovae ATCC 35236]
 gi|238701844|gb|EEP94407.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           aldovae ATCC 35236]
          Length = 151

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (62%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHR+PFLLVD+V++ +  +    +KNVTFNEP F GHFPG+P+ PGVLILE 
Sbjct: 10  IAEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVTFNEPFFQGHFPGKPIFPGVLILEA 69

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+ 
Sbjct: 70  MAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKG 129

Query: 132 CAKVENTVVAEAE-ICA 147
            A V+  +V EA  +CA
Sbjct: 130 VATVDGKIVCEATMMCA 146


>gi|157372014|ref|YP_001480003.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Serratia
           proteamaculans 568]
 gi|157323778|gb|ABV42875.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Serratia
           proteamaculans 568]
          Length = 176

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 34  DIAEILELLPHRYPFLLVDRVLEFEEHKFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 93

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 94  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 153

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  +V EA  +CA
Sbjct: 154 GVATVDGKIVCEATMMCA 171


>gi|146308063|ref|YP_001188528.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas mendocina ymp]
 gi|166233430|sp|A4XWT0|FABZ_PSEMY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145576264|gb|ABP85796.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Pseudomonas
           mendocina ymp]
          Length = 146

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/140 (47%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVDLDVEGKQIRAYKNVSINEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG +     G         Y +  DK RFR PV PGD+L      + +R  +WK
Sbjct: 63  EAMAQAAGILGFKMMGVKPADGTLYYFVGSDKLRFRSPVLPGDQLTLEAKYLSDRRSIWK 122

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F+C A V+   V  AE ICA
Sbjct: 123 FECRATVDGKEVCSAEIICA 142


>gi|301155657|emb|CBW15125.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           parainfluenzae T3T1]
          Length = 149

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 14  EIMTLLPHRYPFLLVDRVLDYKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 73

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q+ G +    +        Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 74  QSMGILAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITAFTGIAT 133

Query: 135 VENTVVAEAEI-CA 147
           V   V  EA++ CA
Sbjct: 134 VNGEVACEAKLMCA 147


>gi|237747796|ref|ZP_04578276.1| 3R-hydroxymyristoyl ACP dehydrase [Oxalobacter formigenes OXCC13]
 gi|229379158|gb|EEO29249.1| 3R-hydroxymyristoyl ACP dehydrase [Oxalobacter formigenes OXCC13]
          Length = 155

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 89/144 (61%), Gaps = 3/144 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  +I ++   LPHRYP LLVD+V++ +  +    IKNVT NE  F GHFP  PVMPGV
Sbjct: 1   MNTLNIHQIRELLPHRYPMLLVDRVLDWEAGKKITAIKNVTANEEFFNGHFPNHPVMPGV 60

Query: 68  LILEGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           LI+E +AQTA   A  +  +  D+ A  Y  +ID ARF++PV PGD+L      VR+   
Sbjct: 61  LIIEALAQTAAIFAFMSADSKLDKDAVVYFATIDSARFKRPVEPGDQLVMEAELVRSSRG 120

Query: 126 LWKFQCCAKVENTVVAEAEI-CAM 148
           +WKF+    V+  +  EAE+ CA+
Sbjct: 121 MWKFRTKGMVDGQLAVEAELMCAI 144


>gi|239908491|ref|YP_002955233.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Desulfovibrio magneticus RS-1]
 gi|239798358|dbj|BAH77347.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Desulfovibrio magneticus RS-1]
          Length = 155

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 85/144 (59%), Gaps = 11/144 (7%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+ + LPHRYPFLLVD+VV     +S   IKNVT NEP F GHFPG PVMPG+LILE 
Sbjct: 11  ITEIQKLLPHRYPFLLVDRVVEHVPGQSITAIKNVTINEPFFQGHFPGLPVMPGMLILEA 70

Query: 73  MAQTAGAICAIHNGFDQYAPPY------LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           +AQ  G + +          P          ++KA+FRKPV PGD+L      ++ R+ L
Sbjct: 71  LAQAGGVLVS-----KSLEGPLGDRIFMFTGVEKAKFRKPVVPGDQLVLRCFDLKRRMTL 125

Query: 127 WKFQCCAKVENTVVAEAEICAMVM 150
            K +  A V   VVAEA++ A V+
Sbjct: 126 CKMRAEASVAGVVVAEADLSAAVV 149


>gi|325267067|ref|ZP_08133736.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Kingella
           denitrificans ATCC 33394]
 gi|324981420|gb|EGC17063.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Kingella
           denitrificans ATCC 33394]
          Length = 152

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 92/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +    ++AKDI +L   +PHRYPF+L+D++   +  ++   IKNV+ NEP F GHFP 
Sbjct: 1   MTTPALPIEAKDIQKL---IPHRYPFMLIDRITAFESGKALTAIKNVSMNEPQFTGHFPE 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNK 119
            PVMPGVLI+E MAQ  GA+  +  G       Y  + ID ARF++ V PGD+LE+ +  
Sbjct: 58  FPVMPGVLIIEAMAQACGALAILTEGGRNPDEIYFFAGIDNARFKRQVIPGDQLEFKIEL 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEI-CA 147
           ++++  + KFQ  A V   +  EAEI CA
Sbjct: 118 LQSKRGIGKFQAQAFVAGELAVEAEIMCA 146


>gi|237808845|ref|YP_002893285.1| (3R)-hydroxymyristoyl-ACP dehydratase [Tolumonas auensis DSM 9187]
 gi|259646362|sp|C4L853|FABZ_TOLAT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|237501106|gb|ACQ93699.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Tolumonas
           auensis DSM 9187]
          Length = 151

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 93/157 (59%), Gaps = 18/157 (11%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAI---GIKNVTFNEPHFMGH 57
           M ++L  LD +DI++L   LPHRYPFL+VD+VV+ +  E       IKNV+FNEP F GH
Sbjct: 1   MNNELNQLDIQDILQL---LPHRYPFLMVDRVVHYEMSEERKVLRAIKNVSFNEPFFQGH 57

Query: 58  FPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGD 111
           FP RPV PGVLILE MAQ  G +      F     P      Y  SID ARF++PV PGD
Sbjct: 58  FPERPVFPGVLILEAMAQATGILA-----FRMVGKPNPGELYYFASIDNARFKRPVVPGD 112

Query: 112 RLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEI-CA 147
           +L   V  ++ R  + KF   A V+  +V  AE+ CA
Sbjct: 113 QLVLDVEYLKERRGIAKFTGVATVDGELVCSAELMCA 149


>gi|229827442|ref|ZP_04453511.1| hypothetical protein GCWU000182_02831 [Abiotrophia defectiva ATCC
           49176]
 gi|229788380|gb|EEP24494.1| hypothetical protein GCWU000182_02831 [Abiotrophia defectiva ATCC
           49176]
          Length = 142

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVDK+  +++   A+G KNV+ NE HF+GHFPG P+MPGVLILE +A
Sbjct: 7   EIMEILPHRYPFLLVDKITELEKGVRAVGQKNVSANEMHFLGHFPGNPIMPGVLILEALA 66

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           QT GA+  +    ++    +   +  ARFRK V PGD LE     ++ +  +      A 
Sbjct: 67  QT-GAVALLSEEENKGKLVFFGGVKSARFRKQVVPGDVLELRCEIIKRKGSVGIGSATAL 125

Query: 135 VENTVVAEAEIC 146
           V+  V AEAE+ 
Sbjct: 126 VDGKVAAEAELT 137


>gi|121604671|ref|YP_982000.1| (3R)-hydroxymyristoyl-ACP dehydratase [Polaromonas
           naphthalenivorans CJ2]
 gi|120593640|gb|ABM37079.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Polaromonas
           naphthalenivorans CJ2]
          Length = 146

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+V+ I+  +    +KNVT NEP FMGHFP  PVMPGVL++E
Sbjct: 3   DIHQILKLLPHRYPILLVDRVLEIETGKRIKALKNVTINEPFFMGHFPKHPVMPGVLMIE 62

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G   D     Y   ID ARF++PV PGD+L   V  +R +  ++KF
Sbjct: 63  AMAQAAALLSFSTLGVTPDDKTVYYFAGIDGARFKRPVGPGDQLIMDVELLRMKAGIFKF 122

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +   +V+  +  EAE+ C M
Sbjct: 123 KGVCRVDENLACEAELMCTM 142


>gi|307293411|ref|ZP_07573257.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingobium chlorophenolicum L-1]
 gi|306881477|gb|EFN12693.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingobium chlorophenolicum L-1]
          Length = 160

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 1/145 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LLVD+VV+I  + S   IK V+ NEP F GHFPGRP+MPGVLI+E
Sbjct: 16  DIRGVMASLPHRYPMLLVDRVVSIVPNTSIHAIKAVSINEPFFQGHFPGRPIMPGVLIVE 75

Query: 72  GMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +     N        Y MSID  +FR PV PG  L+ HV+ V+ R  + KF 
Sbjct: 76  AMAQAAGVLTVQSLNLAGSGKLVYFMSIDGVKFRNPVEPGCLLDLHVDVVQMRGAVCKFS 135

Query: 131 CCAKVENTVVAEAEICAMVMHEKKE 155
             A ++  + AEA   AM+    K+
Sbjct: 136 GKALIDGKLHAEANFVAMIADPPKD 160


>gi|295698554|ref|YP_003603209.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Candidatus Riesia pediculicola USDA]
 gi|291157224|gb|ADD79669.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Candidatus Riesia pediculicola USDA]
          Length = 150

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 7/145 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPFLLVD++++ ++ E    IKNV+FNEP F GHFP +PV PGVLILE
Sbjct: 8   NIEEILNLLPHRYPFLLVDRILDFKKGEYLRAIKNVSFNEPFFQGHFPKKPVFPGVLILE 67

Query: 72  GMAQTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ+AG +     +  N  + Y   YL+ ID+ARF+ PV PGD++ + V  ++ +  L 
Sbjct: 68  AIAQSAGILAFKSISKVNSRELY---YLVGIDEARFKYPVQPGDQMIFQVKLIKTKRSLT 124

Query: 128 KFQCCAKVENTVVAEAEICAMVMHE 152
           +F+    V+  +V +A +    + E
Sbjct: 125 RFEGTVMVDKKMVCKATMMCSRIQE 149


>gi|319793972|ref|YP_004155612.1| beta-hydroxyacyL-(acyL-carrier-protein) dehydratase fabz
           [Variovorax paradoxus EPS]
 gi|315596435|gb|ADU37501.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Variovorax paradoxus EPS]
          Length = 149

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 92/141 (65%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+V+++++ +    +KNVT NEP F GHFP RPVMPGVL+LE
Sbjct: 6   DIHQILKLLPHRYPFLLVDRVLDMEKGKRITALKNVTMNEPFFNGHFPHRPVMPGVLMLE 65

Query: 72  GMAQTAGAICAIHNGF---DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ A A+ + H+     D     Y  +ID ARF++PV PGD+L   V   R +  + K
Sbjct: 66  AMAQ-AAALLSFHSLDIVPDDNTVYYFAAIDGARFKRPVEPGDQLTLEVEIERMKAGISK 124

Query: 129 FQCCAKVENTVVAEAEI-CAM 148
           F+  A V + +  EA + CAM
Sbjct: 125 FKGRALVGSELACEATLMCAM 145


>gi|239815591|ref|YP_002944501.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Variovorax paradoxus S110]
 gi|259646363|sp|C5CKT1|FABZ_VARPS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|239802168|gb|ACS19235.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Variovorax paradoxus S110]
          Length = 150

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 92/141 (65%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYPFLLVD+V+++++ +    +KNVT NEP F GHFP RPVMPGVL+LE
Sbjct: 7   DIHQILKLLPHRYPFLLVDRVLDMEKGKRITALKNVTMNEPFFNGHFPHRPVMPGVLMLE 66

Query: 72  GMAQTAGAICAIHNGF---DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ A A+ + H+     D     Y  +ID ARF++PV PGD+L   V   R +  + K
Sbjct: 67  AMAQ-AAALLSFHSLDIVPDDNTVYYFAAIDGARFKRPVEPGDQLTLEVEIERMKAGISK 125

Query: 129 FQCCAKVENTVVAEAEI-CAM 148
           F+  A V + +  EA + CAM
Sbjct: 126 FKGRALVGSELACEATLMCAM 146


>gi|190359492|sp|A1VN51|FABZ_POLNA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+V+ I+  +    +KNVT NEP FMGHFP  PVMPGVL++E
Sbjct: 2   DIHQILKLLPHRYPILLVDRVLEIETGKRIKALKNVTINEPFFMGHFPKHPVMPGVLMIE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ A  +     G   D     Y   ID ARF++PV PGD+L   V  +R +  ++KF
Sbjct: 62  AMAQAAALLSFSTLGVTPDDKTVYYFAGIDGARFKRPVGPGDQLIMDVELLRMKAGIFKF 121

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +   +V+  +  EAE+ C M
Sbjct: 122 KGVCRVDENLACEAELMCTM 141


>gi|284008509|emb|CBA75023.1| (3R)-hydroxymyristoyl-ACP dehydratase [Arsenophonus nasoniae]
          Length = 136

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 2/130 (1%)

Query: 20  LPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGA 79
           LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+P+ PGVLILE MAQ AG 
Sbjct: 2   LPHRYPFLLVDRVLDFEESKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEAMAQAAGI 61

Query: 80  ICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENT 138
           +     G  +     Y   ID+ARF+ PV PGD++ + V  V+ +  L +F+  AKV + 
Sbjct: 62  LAFKSVGKLEPGELYYFAGIDEARFKHPVQPGDQMIFEVTFVKTKRGLTRFEGIAKVGDK 121

Query: 139 VVAEAE-ICA 147
           VV EA  +CA
Sbjct: 122 VVCEATMMCA 131


>gi|270264809|ref|ZP_06193073.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Serratia
           odorifera 4Rx13]
 gi|270041107|gb|EFA14207.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Serratia
           odorifera 4Rx13]
          Length = 165

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 23  DIAEILELLPHRYPFLLVDRVLEFEEHKFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 82

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 83  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 142

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  +V EA  +CA
Sbjct: 143 GVATVDGKIVCEATMMCA 160


>gi|56417135|ref|YP_154209.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma marginale str. St.
           Maries]
 gi|222475500|ref|YP_002563917.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (fabZ)
           [Anaplasma marginale str. Florida]
 gi|254995306|ref|ZP_05277496.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma marginale str.
           Mississippi]
 gi|255003485|ref|ZP_05278449.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma marginale str.
           Puerto Rico]
 gi|255004610|ref|ZP_05279411.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaplasma marginale str.
           Virginia]
 gi|62286726|sp|Q5P9S6|FABZ_ANAMM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788911|sp|B9KGV7|FABZ_ANAMF RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56388367|gb|AAV86954.1| (3R)-hydroxymyristoyl-[acyl carrier protein dehydratase [Anaplasma
           marginale str. St. Maries]
 gi|222419638|gb|ACM49661.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (fabZ)
           [Anaplasma marginale str. Florida]
          Length = 147

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 89/144 (61%), Gaps = 5/144 (3%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A D  ++MR LPH YPFLLVD+V+     +S + +KNVTFNEP F+GHF   PVMPGVLI
Sbjct: 4   ALDHKQIMRMLPHSYPFLLVDRVLECIPGKSIVALKNVTFNEPFFVGHFRDNPVMPGVLI 63

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           +E MAQ++  +C + +     A      Y MSID A+FR+ V PGD L      +  R  
Sbjct: 64  IESMAQSS-MLCVVSDREGDEASGNRSVYFMSIDGAKFRRVVVPGDTLTIKSAVIHMRGT 122

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
             KFQC A V + + +EA+I AM+
Sbjct: 123 TCKFQCHAYVGDELASEAQILAMM 146


>gi|238784891|ref|ZP_04628891.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           bercovieri ATCC 43970]
 gi|238714208|gb|EEQ06220.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           bercovieri ATCC 43970]
          Length = 186

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (7%)

Query: 1   MISDLACLDAKDIV----------ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFN 50
           ++  ++ LD K I+          E++  LPHR+PFLLVD+V++ +  +    +KNV+FN
Sbjct: 11  VVDSISFLDRKSILTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFN 70

Query: 51  EPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFP 109
           EP F GHFPG+P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV P
Sbjct: 71  EPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVP 130

Query: 110 GDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           GD++   V  V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 131 GDQMIMEVEFVKERRGLTRFTGVAKVDGEIVCTATMMCA 169


>gi|241764768|ref|ZP_04762777.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidovorax delafieldii 2AN]
 gi|241365758|gb|EER60430.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidovorax delafieldii 2AN]
          Length = 146

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (69%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLLVDKV+ ++ +     IKNVTFNEP+FMGHFPGRPVMPGVLILE
Sbjct: 3   DIHAILKQLPHRYPFLLVDKVIELESNARIRAIKNVTFNEPYFMGHFPGRPVMPGVLILE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDR--LEYHVNKVRNRVDLW 127
            +AQ AG +   A+    D+    Y + ID ARF++PV PGD+  L+ H+++VR    +W
Sbjct: 63  ALAQAAGLLAFDAMGKVPDENNIYYFVGIDGARFKRPVEPGDQLILDIHIDRVRG--GIW 120

Query: 128 KFQCCAKVENTVVAEAEI-CAM 148
           KF+  A+V + V  EAE+ C M
Sbjct: 121 KFKGVARVGDDVACEAELMCTM 142


>gi|254424450|ref|ZP_05038168.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. PCC 7335]
 gi|196191939|gb|EDX86903.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. PCC 7335]
          Length = 182

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 83/132 (62%), Gaps = 2/132 (1%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPF L+D++++    ESA+G+KNVTFNEPHF GHFP RP+MPGVLI+E MA
Sbjct: 46  EIQQLLPHRYPFALIDRIIDYTPGESAVGLKNVTFNEPHFQGHFPNRPLMPGVLIVEAMA 105

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW-KFQCCA 133
           Q  G + +   G D     +   IDK +FR+PV PGD+L      +  +   + K +  A
Sbjct: 106 QVGGIVLSQMPGVDDRLCVF-AGIDKVKFRRPVVPGDQLIITTTLLALKAKRFGKMKSVA 164

Query: 134 KVENTVVAEAEI 145
           KV+  +  E  +
Sbjct: 165 KVDGQLACEGTL 176


>gi|16272993|ref|NP_439220.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus influenzae Rd
           KW20]
 gi|145630152|ref|ZP_01785934.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae R3021]
 gi|145634218|ref|ZP_01789929.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae PittAA]
 gi|229843901|ref|ZP_04464042.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae 6P18H1]
 gi|229846093|ref|ZP_04466205.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae 7P49H1]
 gi|260580148|ref|ZP_05847978.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae RdAW]
 gi|329124202|ref|ZP_08252749.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Haemophilus aegyptius ATCC 11116]
 gi|1169597|sp|P45012|FABZ_HAEIN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|1574613|gb|AAC22717.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase (fabZ)
           [Haemophilus influenzae Rd KW20]
 gi|144984433|gb|EDJ91856.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae R3021]
 gi|145268662|gb|EDK08655.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae PittAA]
 gi|229811097|gb|EEP46814.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae 7P49H1]
 gi|229812895|gb|EEP48583.1| (3R)-hydroxymyristol (acyl carrier protein) dehydrase [Haemophilus
           influenzae 6P18H1]
 gi|260093432|gb|EEW77365.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae RdAW]
 gi|327467627|gb|EGF13125.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Haemophilus aegyptius ATCC 11116]
          Length = 148

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (61%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 13  EIMTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +    +        Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKKRRGITAFTGVAT 132

Query: 135 VENTVVAEAEI-CA 147
           V   +  EA++ CA
Sbjct: 133 VNGEIACEAKLMCA 146


>gi|291333731|gb|ADD93417.1| beta hydroxyacyl acyl carrier protein dehydratase FabZ [uncultured
           marine bacterium MedDCM-OCT-S04-C103]
          Length = 448

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (61%), Gaps = 6/146 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  ++  LPHR+PF+++DKV +I+  E  +GIKNV+ NEP F GHFPG PVMPGVL LE
Sbjct: 304 DVRRVLDVLPHRFPFVMIDKVASIEGGEKLVGIKNVSINEPFFTGHFPGHPVMPGVLQLE 363

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRL--EYHVNKVR-NRVDLWK 128
            MAQ AG I  +  G  +    + MS DK +FRKPV PGD+L     + KVR N++    
Sbjct: 364 AMAQAAG-ILLLRRGSAEGKVAFFMSADKVKFRKPVVPGDQLIITAKLEKVRGNKLATAC 422

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
            +C  KV    V+ A +   +M  K+
Sbjct: 423 VEC--KVGEQTVSSASLMFSIMDGKE 446


>gi|253687348|ref|YP_003016538.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753926|gb|ACT12002.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 162

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           + +D   L  ++I+EL   LPHR+PFLLVD+V++ +  +    +KNV+FNEP F GHFPG
Sbjct: 12  LTTDTHTLHIEEILEL---LPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPG 68

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y  ++D+ARF++PV PGD++   V  
Sbjct: 69  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAVDEARFKRPVQPGDQMILEVEF 128

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           ++ R  + +F+  AKV+  V  EA  +CA
Sbjct: 129 IKERRGVARFKGVAKVDGEVACEASMMCA 157


>gi|146310382|ref|YP_001175456.1| (3R)-hydroxymyristoyl-ACP dehydratase [Enterobacter sp. 638]
 gi|166971619|sp|A4W6S5|FABZ_ENT38 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145317258|gb|ABP59405.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Enterobacter sp.
           638]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVASVDGKVVCEATMMCA 146


>gi|91775872|ref|YP_545628.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Methylobacillus
           flagellatus KT]
 gi|91709859|gb|ABE49787.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Methylobacillus
           flagellatus KT]
          Length = 153

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 2/145 (1%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            + + DI E++ +LPHRYPF+LVD+V++++ ++  + +KNVT NEP F GHFP  PVMPG
Sbjct: 5   AITSMDIHEILNYLPHRYPFVLVDRVLSLELNKEIVAVKNVTINEPFFPGHFPYHPVMPG 64

Query: 67  VLILEGMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           VLI+E +AQ A  +     G   +  +  Y   +D  RF+KPV PGD+L   V+  R   
Sbjct: 65  VLIVEALAQAAAILSFKTMGTKPNDKSVYYFAGMDNVRFKKPVSPGDQLILKVSIDRILR 124

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +W+++  A V+  VVAEAE+  ++
Sbjct: 125 GIWRYKGEALVDGAVVAEAEMMCIL 149


>gi|254480210|ref|ZP_05093458.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [marine
           gamma proteobacterium HTCC2148]
 gi|214039772|gb|EEB80431.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [marine
           gamma proteobacterium HTCC2148]
          Length = 143

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++ + LPHRYPFLLVD+VV +   ES +  KN+T NEP F GHFPG+PV PGVL++E
Sbjct: 3   DIEQIRQHLPHRYPFLLVDRVVELNLGESIVAYKNLTINEPFFDGHFPGQPVFPGVLLVE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG +    ++      +  Y +  DK RF++P  PGDR+    + + +R  +WKF
Sbjct: 63  AMAQAAGILGFKTMNKTPADGSIYYFVGADKLRFKRPCVPGDRVMLRASIISDRRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
              A V+  + A A I CA
Sbjct: 123 AVSADVDGELAASATILCA 141


>gi|238751440|ref|ZP_04612932.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           rohdei ATCC 43380]
 gi|238710307|gb|EEQ02533.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Yersinia
           rohdei ATCC 43380]
          Length = 190

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 93/159 (58%), Gaps = 12/159 (7%)

Query: 1   MISDLACLDAKDIV----------ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFN 50
           ++  ++ LD K I+          E++  LPHR+PFLLVD+V++ +  +    +KNV+FN
Sbjct: 11  VVDSISFLDRKSILTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFN 70

Query: 51  EPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFP 109
           EP F GHFPG+P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV P
Sbjct: 71  EPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDDARFKRPVVP 130

Query: 110 GDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
           GD++   V  V+ R  L +F   AKV+  +V  A  +CA
Sbjct: 131 GDQMIMEVEFVKERRGLTRFTGVAKVDGEIVCTATMMCA 169


>gi|152968774|ref|YP_001333883.1| (3R)-hydroxymyristoyl-ACP dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206576644|ref|YP_002240332.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella pneumoniae 342]
 gi|262044749|ref|ZP_06017796.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288937038|ref|YP_003441097.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella variicola At-22]
 gi|290512459|ref|ZP_06551825.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella sp. 1_1_55]
 gi|330001659|ref|ZP_08304085.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella sp. MS 92-3]
 gi|166233425|sp|A6T4Y2|FABZ_KLEP7 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700245|sp|B5Y1J1|FABZ_KLEP3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|150953623|gb|ABR75653.1| (3R)-hydroxymyristoyl ACP dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206565702|gb|ACI07478.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella pneumoniae 342]
 gi|259037899|gb|EEW39123.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288891747|gb|ADC60065.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella variicola At-22]
 gi|289774800|gb|EFD82802.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella sp. 1_1_55]
 gi|328537601|gb|EGF63821.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Klebsiella sp. MS 92-3]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P++PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|121608421|ref|YP_996228.1| (3R)-hydroxymyristoyl-ACP dehydratase [Verminephrobacter eiseniae
           EF01-2]
 gi|121553061|gb|ABM57210.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Verminephrobacter
           eiseniae EF01-2]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLLVDKV+ ++R+     IKNVT NEP+FMGHFPGRPVMPGVLILE
Sbjct: 3   DIHAIVKQLPHRYPFLLVDKVIELERNTRIKAIKNVTCNEPYFMGHFPGRPVMPGVLILE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG +   A+    D+    YL+ ID ARF++PV PGD+L   +   R R  +WKF
Sbjct: 63  ALAQAAGLLAFDAMGKVPDENNLYYLVGIDGARFKRPVEPGDQLILAITIDRVRGGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A V + V  EAE+ C M
Sbjct: 123 KGLASVGDEVACEAELMCTM 142


>gi|284052760|ref|ZP_06382970.1| (3R)-hydroxymyristoyl-ACP dehydratase [Arthrospira platensis str.
           Paraca]
 gi|291570341|dbj|BAI92613.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Arthrospira platensis NIES-39]
          Length = 164

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 85/145 (58%), Gaps = 4/145 (2%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           S LA  +   I E+ + LPHRYPF LVD+++     E A GIKNVT NEPHF GHFPGRP
Sbjct: 16  SQLAPENTLAIAEIQKLLPHRYPFALVDRIIEYIPGERATGIKNVTINEPHFQGHFPGRP 75

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVR 121
           +MPGVLI+E MAQ  G +  +    D     +L + IDK RFR+PV PGD+L   V  + 
Sbjct: 76  IMPGVLIVEAMAQVGGIV--LTQLPDMEGKLFLFAGIDKVRFRRPVVPGDQLIMRVQLLS 133

Query: 122 -NRVDLWKFQCCAKVENTVVAEAEI 145
             R      Q  A+V+     E E+
Sbjct: 134 VKRRRFAYMQAAAEVDGLRTCEGEL 158


>gi|261338822|ref|ZP_05966680.1| hypothetical protein ENTCAN_05017 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318645|gb|EFC57583.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enterobacter cancerogenus ATCC 35316]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGKVVCEATMMCA 146


>gi|332293180|ref|YP_004431789.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171266|gb|AEE20521.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 468

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL     KD+ ++M  LPHR PFLLVDK++ + + E  IG+KNVT NEP F+GHFPG PV
Sbjct: 317 DLHATPVKDVNQIMEMLPHRPPFLLVDKILELTK-EHVIGVKNVTMNEPFFVGHFPGSPV 375

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN- 122
           MPGVL +E MAQT G +        +    YL+ IDK R++  V PGD L + ++ +   
Sbjct: 376 MPGVLQIEAMAQTGGILVLSTVPDPENYLTYLLKIDKVRYKHQVVPGDTLIFKLDLMSPI 435

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
           R  + + Q  A     +V+EAEI A ++  K
Sbjct: 436 RRGICQMQARAYANGKLVSEAEIMAQIVKVK 466


>gi|238022863|ref|ZP_04603289.1| hypothetical protein GCWU000324_02783 [Kingella oralis ATCC 51147]
 gi|237865671|gb|EEP66809.1| hypothetical protein GCWU000324_02783 [Kingella oralis ATCC 51147]
          Length = 166

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 5/148 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHR+PF+L+D++   +  +S   IKNVT NEP F+GHFP  PVMPGV
Sbjct: 22  IEAKDIQKL---IPHRFPFMLIDRITAFESGKSLTAIKNVTMNEPQFVGHFPEYPVMPGV 78

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  GA+  +  G       Y  + ID ARF++ V P D+L + +  ++++  +
Sbjct: 79  LIIEAMAQACGALAILTEGGRNPDEIYFFAGIDNARFKRQVIPADQLVFEIELLQSKRGI 138

Query: 127 WKFQCCAKVENTVVAEAEI-CAMVMHEK 153
            KF+  AKV   +  EAEI CA    EK
Sbjct: 139 GKFKAVAKVNGELAVEAEIMCAKRKVEK 166


>gi|269792900|ref|YP_003317804.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100535|gb|ACZ19522.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 146

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 83/132 (62%), Gaps = 2/132 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+++M FLPHRYPFLLVD+++ +  D   +G+KNVT NEP F GHFP  PVMPGVLILE
Sbjct: 2   DILKIMEFLPHRYPFLLVDRILEVGEDR-VVGLKNVTVNEPFFQGHFPSEPVMPGVLILE 60

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            M Q A  + +   G +     +L S++ A+FR+PV PGD+L      ++ R  + K   
Sbjct: 61  AMGQVAACLVSRVPGLEGMT-AFLTSVEDAKFRRPVRPGDQLITEARMLKFRGRMGKVSV 119

Query: 132 CAKVENTVVAEA 143
              V+  + A+A
Sbjct: 120 TGTVDGELAAQA 131


>gi|209525080|ref|ZP_03273624.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Arthrospira maxima CS-328]
 gi|209494489|gb|EDZ94800.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Arthrospira maxima CS-328]
          Length = 164

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 85/145 (58%), Gaps = 4/145 (2%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           S LA  +   I E+ + LPHRYPF LVD+++     E A GIKNVT NEPHF GHFPGRP
Sbjct: 16  SQLAPENTLAIAEIQKLLPHRYPFALVDRIIEYIPGERATGIKNVTINEPHFQGHFPGRP 75

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVR 121
           +MPGVLI+E MAQ  G +  +    D     +L + IDK RFR+PV PGD+L   V  + 
Sbjct: 76  IMPGVLIVEAMAQVGGIV--LTQLPDMEGKLFLFAGIDKVRFRRPVVPGDQLIMRVQLLS 133

Query: 122 -NRVDLWKFQCCAKVENTVVAEAEI 145
             R      Q  A+V+     E E+
Sbjct: 134 VKRRRFAYMQAAAEVDGLRTCEGEL 158


>gi|218294703|ref|ZP_03495557.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thermus
           aquaticus Y51MC23]
 gi|218244611|gb|EED11135.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thermus
           aquaticus Y51MC23]
          Length = 143

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/136 (48%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           +I E++RFLPHRYPFLL+D+V  ++ DE     +KNVTFNEPHF GHFPG P+MPGVLIL
Sbjct: 2   EIGEILRFLPHRYPFLLIDRV--LEADEKRFRALKNVTFNEPHFQGHFPGYPIMPGVLIL 59

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E MAQ A    A   G    +  +L+ +++ARF+KPV PGD L      +  R  L K  
Sbjct: 60  EAMAQAAVGTLARQPGMAPGSLVFLVGVEEARFKKPVVPGDTLVLEGELLFFRRGLGKVA 119

Query: 131 CCAKVENTVVAEAEIC 146
             A VE    A A + 
Sbjct: 120 VRALVEGEERASATLS 135


>gi|190359486|sp|A1WHV3|FABZ_VEREI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 150

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +++ LPHRYPFLLVDKV+ ++R+     IKNVT NEP+FMGHFPGRPVMPGVLILE
Sbjct: 2   DIHAIVKQLPHRYPFLLVDKVIELERNTRIKAIKNVTCNEPYFMGHFPGRPVMPGVLILE 61

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG +   A+    D+    YL+ ID ARF++PV PGD+L   +   R R  +WKF
Sbjct: 62  ALAQAAGLLAFDAMGKVPDENNLYYLVGIDGARFKRPVEPGDQLILAITIDRVRGGIWKF 121

Query: 130 QCCAKVENTVVAEAEI-CAM 148
           +  A V + V  EAE+ C M
Sbjct: 122 KGLASVGDEVACEAELMCTM 141


>gi|94500633|ref|ZP_01307163.1| (3R)-hydroxymyristoyl ACP dehydratase [Oceanobacter sp. RED65]
 gi|94427188|gb|EAT12168.1| (3R)-hydroxymyristoyl ACP dehydratase [Oceanobacter sp. RED65]
          Length = 149

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 92/146 (63%), Gaps = 6/146 (4%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           +  +D + I +L   LPHRYPFLLVD+V  ++  +  +G KNV+ NEP F GHFP  P+M
Sbjct: 1   MTTMDYQRITDL---LPHRYPFLLVDRVTELETKQRIVGYKNVSSNEPFFQGHFPKHPIM 57

Query: 65  PGVLILEGMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           PGVLILE +AQ AG +   AI     +    Y   +D ARF+KPV PGDRL+     V +
Sbjct: 58  PGVLILESLAQLAGLLGLDAIDREKAENTVYYFAGVDTARFKKPVIPGDRLDMEARYVND 117

Query: 123 RVDLWKFQCCAKVENTVVAEAEI-CA 147
           +  +W+F+C AKV+  +  +AEI CA
Sbjct: 118 KRGIWRFECEAKVDGKLACQAEILCA 143


>gi|188533048|ref|YP_001906845.1| (3R)-hydroxymyristoyl-ACP dehydratase [Erwinia tasmaniensis Et1/99]
 gi|226700468|sp|B2VHX7|FABZ_ERWT9 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|188028090|emb|CAO95947.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           tasmaniensis Et1/99]
          Length = 151

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLKIEEIIEL---LPHRYPFLLVDRVLEFEESKYLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGKIVCEATMMCA 146


>gi|225848740|ref|YP_002728904.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643686|gb|ACN98736.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 141

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 11  KDIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           ++++++M+ LPHRYPFLLVD+++ +  +   I  +KNVT+NEP F+GHFP  PVMPGVLI
Sbjct: 2   ENVMDIMKVLPHRYPFLLVDRILELDVENMKIKALKNVTYNEPFFVGHFPDNPVMPGVLI 61

Query: 70  LEGMAQTAGAI----CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           +E MAQ    +      I NG   +A     SI++A+FRKPV PGD++ + V  +  +  
Sbjct: 62  IEAMAQVGAYLMLKKANITNGTVLFA-----SIEEAKFRKPVVPGDQIIFEVEGINIKRS 116

Query: 126 LWKFQCCAKVENTVVAEAEICAMV 149
           + K +  AKV+  VV EA + A V
Sbjct: 117 MGKIKAVAKVDGQVVCEAILMAAV 140


>gi|292489216|ref|YP_003532103.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           amylovora CFBP1430]
 gi|292898550|ref|YP_003537919.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Erwinia
           amylovora ATCC 49946]
 gi|291198398|emb|CBJ45505.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Erwinia
           amylovora ATCC 49946]
 gi|291554650|emb|CBA22336.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           amylovora CFBP1430]
 gi|312173376|emb|CBX81630.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           amylovora ATCC BAA-2158]
          Length = 151

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLKIEEIIEL---LPHRYPFLLVDRVLEFEESKYLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGNIVCEATMMCA 146


>gi|15598841|ref|NP_252335.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas aeruginosa PAO1]
 gi|107103159|ref|ZP_01367077.1| hypothetical protein PaerPA_01004228 [Pseudomonas aeruginosa PACS2]
 gi|116051642|ref|YP_789519.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152985453|ref|YP_001346878.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas aeruginosa PA7]
 gi|218890130|ref|YP_002438994.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas aeruginosa
           LESB58]
 gi|254236559|ref|ZP_04929882.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa C3719]
 gi|254242343|ref|ZP_04935665.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa 2192]
 gi|296387849|ref|ZP_06877324.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas aeruginosa PAb1]
 gi|313109050|ref|ZP_07795022.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa 39016]
 gi|14423704|sp|Q9HXY7|FABZ_PSEAE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|122260785|sp|Q02RB7|FABZ_PSEAB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233429|sp|A6V1E3|FABZ_PSEA7 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700250|sp|B7V7U3|FABZ_PSEA8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|9949805|gb|AAG07033.1|AE004784_6 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa PAO1]
 gi|115586863|gb|ABJ12878.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168490|gb|EAZ54001.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa C3719]
 gi|126195721|gb|EAZ59784.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa 2192]
 gi|150960611|gb|ABR82636.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas aeruginosa PA7]
 gi|218770353|emb|CAW26118.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa LESB58]
 gi|310881524|gb|EFQ40118.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas aeruginosa 39016]
          Length = 146

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L+ H   +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF C A V++  V  AE ICA
Sbjct: 118 RSIWKFDCHATVDDKPVCSAEIICA 142


>gi|257126041|ref|YP_003164155.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptotrichia buccalis C-1013-b]
 gi|257049980|gb|ACV39164.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptotrichia buccalis C-1013-b]
          Length = 141

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 86/134 (64%), Gaps = 5/134 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++M+ LPHRYPFLLVDKV+     +S + IKN+T NE  F GHFPG+PVMPGVL +E
Sbjct: 6   NIEDIMKILPHRYPFLLVDKVIEKNGTDSLVAIKNITMNEEFFQGHFPGKPVMPGVLQIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  G +       +    P  MSIDK +FR+ V PGD+L   V K++ + ++   + 
Sbjct: 66  ALAQAVGLLM-----LEPGKIPLFMSIDKCKFRRAVVPGDQLRLEVEKIKVKSNVIVARG 120

Query: 132 CAKVENTVVAEAEI 145
              V+ TVV+EA++
Sbjct: 121 KCIVDGTVVSEADL 134


>gi|49075978|gb|AAT49514.1| PA3645 [synthetic construct]
          Length = 147

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L+ H   +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF C A V++  V  AE ICA
Sbjct: 118 RSIWKFDCHATVDDKPVCSAEIICA 142


>gi|94496932|ref|ZP_01303506.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingomonas sp. SKA58]
 gi|94423608|gb|EAT08635.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sphingomonas sp. SKA58]
          Length = 140

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M  LPHRYP LL+D+VV++  ++S   IK V+ NEP F GHFP RP+MPGVLI+E MAQ 
Sbjct: 1   MAALPHRYPMLLIDRVVSLVPNQSIHAIKAVSVNEPFFQGHFPTRPIMPGVLIVEAMAQA 60

Query: 77  AGAICAIHNGF-DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV 135
           AG +        D     Y MSID A+FR PV PG  L+ HV   +NR  + KF   A +
Sbjct: 61  AGVLAVESMDLADSGKLVYFMSIDGAKFRSPVEPGCLLDLHVEVTQNRGAICKFSGKATI 120

Query: 136 ENTVVAEAEICAMV 149
           +  + +EA   AM+
Sbjct: 121 DGKLASEANFVAMI 134


>gi|94987462|ref|YP_595395.1| (3R)-hydroxymyristoyl-ACP dehydratase [Lawsonia intracellularis
           PHE/MN1-00]
 gi|190359386|sp|Q1MPK3|FABZ_LAWIP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|94731711|emb|CAJ55074.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 153

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+++ LPHRYPFLLVD+V+     +     KNV+ NEP F GHFPG PVMPGVLILE
Sbjct: 8   NIQEILQLLPHRYPFLLVDRVIEFNAGKYIKAYKNVSINEPFFQGHFPGFPVMPGVLILE 67

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLM--SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ+ G         ++      +   I+  +FR+ V PGD+L      +R+++ LWK 
Sbjct: 68  AMAQSGGITVLQSFPINELQGKVFLFAGIENVKFRQQVIPGDQLILECEIIRHKLQLWKM 127

Query: 130 QCCAKVENTVVAEAEICAMVMHEK 153
            C A V N +VAEA + A + +++
Sbjct: 128 SCQAFVNNKLVAEAILTAAMTNKE 151


>gi|253988136|ref|YP_003039492.1| (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779586|emb|CAQ82747.1| (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Photorhabdus asymbiotica]
          Length = 150

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 87/137 (63%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 9   IEEILDLLPHRYPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 68

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G        Y  +ID ARF++PV PGD++   V  ++ R  + + + 
Sbjct: 69  MAQATGILAFKSVGKLKSDELYYFAAIDGARFKRPVVPGDQMVLEVEFLKERRGVARCRG 128

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  VV EAE +CA
Sbjct: 129 VAKVDGEVVCEAEMMCA 145


>gi|68249621|ref|YP_248733.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus influenzae
           86-028NP]
 gi|81335950|sp|Q4QLM4|FABZ_HAEI8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|68057820|gb|AAX88073.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Haemophilus influenzae 86-028NP]
 gi|309973465|gb|ADO96666.1| (3R)-hydroxymyristol-ACP dehydratase [Haemophilus influenzae R2846]
          Length = 148

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 13  EIMTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +             Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTLELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITSFTGVAT 132

Query: 135 VENTVVAEAEI-CA 147
           V   +  EA++ CA
Sbjct: 133 VNGEIACEAKLMCA 146


>gi|224825024|ref|ZP_03698130.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Lutiella
           nitroferrum 2002]
 gi|224602695|gb|EEG08872.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Lutiella
           nitroferrum 2002]
          Length = 150

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+M++LPHRYPFLLVD+VV  +  +    +KNVT NEP F+GHF   PVMPGVLI+E
Sbjct: 9   DVREIMKYLPHRYPFLLVDRVVEFEAGKRVKALKNVTINEPFFVGHFEQYPVMPGVLIIE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPY-LMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ AG +     G       Y  + ID ARF++ V PGD+L   V ++ ++  + K++
Sbjct: 69  ALAQAAGILSIKSQGERAENELYFFVGIDNARFKRQVVPGDQLVMEVEEITSKRGIAKYK 128

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  V  EAEI CA
Sbjct: 129 ARALVDGQVACEAEIMCA 146


>gi|332703882|ref|ZP_08423970.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332554031|gb|EGJ51075.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 157

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++M FLPHRYPFLL+D+V+ + +      +KNVT NEP+F GHFPG PVMPGVL LE
Sbjct: 13  DVRKIMEFLPHRYPFLLIDRVLELVKGNYVTALKNVTINEPYFQGHFPGLPVMPGVLQLE 72

Query: 72  GMAQTAGA-ICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ+AG  I     G  +        ++K +FRKPV PGD+L       R +++L+K  
Sbjct: 73  ALAQSAGMYIMNTFEGKFEGKVFVFTGMEKIKFRKPVVPGDQLILRCENFRQKLNLFKMS 132

Query: 131 CCAKVENTVVAEAEICAMVM 150
               V+  +  E E+ A ++
Sbjct: 133 GNGTVDGKITVEGEMTAALI 152


>gi|225164317|ref|ZP_03726585.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Opitutaceae bacterium TAV2]
 gi|224801079|gb|EEG19407.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Opitutaceae bacterium TAV2]
          Length = 445

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 3   SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRP 62
           S L    + +I  ++  LPHRYPF++VD+VV    ++  + IKNVT NEP+F GHFPG P
Sbjct: 291 SPLPTETSLNIRRILDMLPHRYPFVMVDRVVEFIGEDELVAIKNVTINEPYFQGHFPGNP 350

Query: 63  VMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           VMPGVL LE MAQ +G +     G  +      MS DK +FR+PV PGD+   +    + 
Sbjct: 351 VMPGVLQLEAMAQASGILMLRRTGSAEGKATLFMSADKVKFRRPVRPGDQFIINAKITKY 410

Query: 123 RVD-LWKFQCCAKVENTVVAEAEICAMVMHE 152
           R + L   +C   V+  VV+ AE+   ++ E
Sbjct: 411 RANKLAAAECTCTVDGQVVSSAELMFALIDE 441


>gi|85712984|ref|ZP_01044023.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
           protein)dehydratase [Idiomarina baltica OS145]
 gi|85693222|gb|EAQ31181.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
           protein)dehydratase [Idiomarina baltica OS145]
          Length = 152

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 88/139 (63%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  LPHRYPFLL+D+V++   ++    IKNV+FNEP F GHFPG P+ PGVL+LE
Sbjct: 10  DIQGVLDLLPHRYPFLLIDRVISCDCEKEIHAIKNVSFNEPMFNGHFPGNPIFPGVLLLE 69

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           G+AQ AG +   I          YL + ID ARF++ V PGD + +HV   + R  +WKF
Sbjct: 70  GLAQAAGLLGFRITEQKSTANDLYLFAGIDNARFKRQVIPGDTIHFHVTFEKERRGIWKF 129

Query: 130 QCCAKVENTVVAEAE-ICA 147
              A+VE  + A A+ ICA
Sbjct: 130 SGRAEVEGELAACADIICA 148


>gi|312135733|ref|YP_004003071.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Caldicellulosiruptor owensensis OL]
 gi|311775784|gb|ADQ05271.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor owensensis OL]
          Length = 140

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I +++  LPHRYPFLLVDK+V ++  + A GIKNVT NEP F GHFPG PVMPGVLI+E 
Sbjct: 4   IEKILEVLPHRYPFLLVDKIVEVEEGKRAKGIKNVTINEPFFQGHFPGNPVMPGVLIVEA 63

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ  GA+  +     +   P+   IDK RF++ V PGD L      +  +  + K +  
Sbjct: 64  MAQV-GAVAMLFKEEFKGKTPFFAGIDKVRFKRVVKPGDVLVIETELISLKGSIGKAKAS 122

Query: 133 AKVENTVVAEAEIC 146
           A V+  VV E E+ 
Sbjct: 123 AYVDGEVVCEGELL 136


>gi|296101349|ref|YP_003611495.1| putative (3R)-hydroxymyristoyl-ACP dehydratase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055808|gb|ADF60546.1| putative (3R)-hydroxymyristoyl-ACP dehydratase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 151

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|86143287|ref|ZP_01061689.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Leeuwenhoekiella blandensis MED217]
 gi|85830192|gb|EAQ48652.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Leeuwenhoekiella blandensis MED217]
          Length = 469

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL+    KD+ E+M  LPHR PFLLVDK++ I  D   IG+KNVT NEP F+GHFP  PV
Sbjct: 318 DLSKPPVKDVNEIMAMLPHRPPFLLVDKILEI-TDTGVIGLKNVTMNEPFFVGHFPCSPV 376

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN- 122
           MPGVL +E MAQT G +        +    Y M ID  RF++ V PGD L + ++ +   
Sbjct: 377 MPGVLQVEAMAQTGGILVLSTVPDPENYLTYFMKIDNVRFKQQVLPGDTLIFKLDLLSPI 436

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           R  +   Q  A V   +V+EAE+ A ++  KK+
Sbjct: 437 RRGICHMQGSAYVNGKLVSEAELMAQIVKVKKD 469


>gi|17229763|ref|NP_486311.1| (3R)-hydroxymyristoyl-ACP dehydratase [Nostoc sp. PCC 7120]
 gi|25452960|sp|Q8YUR4|FABZ_ANASP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|17131362|dbj|BAB73970.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Nostoc
           sp. PCC 7120]
          Length = 171

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 84/137 (61%), Gaps = 12/137 (8%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPFLLVDK+++    + A+GIKNVT NEPHF GHFP RP+MPGVLI+E MA
Sbjct: 35  EIQKLLPHRYPFLLVDKIIDYTPGKQAVGIKNVTINEPHFTGHFPDRPLMPGVLIVEAMA 94

Query: 75  QTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK--VRNRVDLWK 128
           Q  G +      +  G   +A      IDK RFR+ V PGD+L   V    ++ R    K
Sbjct: 95  QVGGIVMTQLPGLEGGLFVFA-----GIDKVRFRRQVVPGDQLVMTVELLWIKQR-RFGK 148

Query: 129 FQCCAKVENTVVAEAEI 145
            Q  A+V+  + AE E+
Sbjct: 149 MQARAEVDGQLAAEGEL 165


>gi|251799749|ref|YP_003014480.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. JDR-2]
 gi|247547375|gb|ACT04394.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. JDR-2]
          Length = 142

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHR PFLLVD++  ++    A+GIKNVT NEPHF+GHFPG PVMPGVLI+E
Sbjct: 3   DINQIQEIIPHRPPFLLVDRITEVEPGVRAVGIKNVTMNEPHFVGHFPGYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  G++  +    ++    +   ID  RFR  V PGD LE  V   R +  + K + 
Sbjct: 63  ALAQV-GSVAMLMVEANRGKLGFFAGIDGFRFRGQVKPGDTLELEVEITRLKGPIGKGKA 121

Query: 132 CAKVENTVVAEAEIC 146
            AKV+  VVAE E+ 
Sbjct: 122 TAKVDGQVVAEGELM 136


>gi|145627982|ref|ZP_01783783.1| uridylate kinase [Haemophilus influenzae 22.1-21]
 gi|145632426|ref|ZP_01788161.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Haemophilus influenzae 3655]
 gi|145636488|ref|ZP_01792156.1| uridylate kinase [Haemophilus influenzae PittHH]
 gi|145638126|ref|ZP_01793736.1| uridylate kinase [Haemophilus influenzae PittII]
 gi|148826323|ref|YP_001291076.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus influenzae
           PittEE]
 gi|148828225|ref|YP_001292978.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus influenzae
           PittGG]
 gi|260581884|ref|ZP_05849680.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae NT127]
 gi|166233423|sp|A5UD42|FABZ_HAEIE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233424|sp|A5UII9|FABZ_HAEIG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|144979757|gb|EDJ89416.1| uridylate kinase [Haemophilus influenzae 22.1-21]
 gi|144987333|gb|EDJ93863.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Haemophilus influenzae 3655]
 gi|145270313|gb|EDK10248.1| uridylate kinase [Haemophilus influenzae PittHH]
 gi|145272455|gb|EDK12362.1| uridylate kinase [Haemophilus influenzae PittII]
 gi|148716483|gb|ABQ98693.1| uridylate kinase [Haemophilus influenzae PittEE]
 gi|148719467|gb|ABR00595.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Haemophilus influenzae PittGG]
 gi|260095077|gb|EEW78969.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae NT127]
 gi|301169804|emb|CBW29408.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           influenzae 10810]
 gi|309751291|gb|ADO81275.1| (3R)-hydroxymyristol-ACP dehydratase [Haemophilus influenzae R2866]
          Length = 148

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +A
Sbjct: 13  EIMTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALA 72

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +             Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 73  QAMGILAFKTLELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITAFTGVAT 132

Query: 135 VENTVVAEAEI-CA 147
           V   +  EA++ CA
Sbjct: 133 VNGEIACEAKLMCA 146


>gi|212704556|ref|ZP_03312684.1| hypothetical protein DESPIG_02616 [Desulfovibrio piger ATCC 29098]
 gi|212671955|gb|EEB32438.1| hypothetical protein DESPIG_02616 [Desulfovibrio piger ATCC 29098]
          Length = 154

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 85/145 (58%), Gaps = 3/145 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  LPHRYPFLLVD+V+           KNVT NEP F GHFPG P+MPGVLILE
Sbjct: 10  DIQRILSILPHRYPFLLVDRVLECVPGSHIKAYKNVTINEPFFQGHFPGAPIMPGVLILE 69

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQT GA+ A+       +    +   +D  +FR+ V PGDRLE H + +R ++ L K 
Sbjct: 70  ALAQT-GALLAVSGMEGDLSDKLFFFTGLDGVKFRRQVVPGDRLELHCDNIRMKLKLCKM 128

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
              A V+  + AEA+I A +    K
Sbjct: 129 DARAYVDGKLAAEAQITAAIGDRPK 153


>gi|66044602|ref|YP_234443.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           syringae B728a]
 gi|71735309|ref|YP_275967.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|237800154|ref|ZP_04588615.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|257487071|ref|ZP_05641112.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626023|ref|ZP_06458977.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651460|ref|ZP_06482803.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289675273|ref|ZP_06496163.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           syringae FF5]
 gi|298488343|ref|ZP_07006375.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302187909|ref|ZP_07264582.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           syringae 642]
 gi|75502994|sp|Q4ZWR7|FABZ_PSEU2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91206640|sp|Q48F70|FABZ_PSE14 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|63255309|gb|AAY36405.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. syringae B728a]
 gi|71555862|gb|AAZ35073.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298157165|gb|EFH98253.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320323109|gb|EFW79198.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329619|gb|EFW85608.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878167|gb|EGH12316.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330894605|gb|EGH27266.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330896070|gb|EGH28291.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330936809|gb|EGH40963.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330950669|gb|EGH50929.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae Cit 7]
 gi|330975388|gb|EGH75454.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330985121|gb|EGH83224.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009294|gb|EGH89350.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331023011|gb|EGI03068.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 146

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DIKEIREYLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG  A   + +        Y +  DK RFR+PV PGD+L      + ++  +WK
Sbjct: 63  EAMAQAAGILAFKMLDSKPSDGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSSKRQIWK 122

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F+C A V+   V  AE ICA
Sbjct: 123 FECKATVDGKAVCSAEIICA 142


>gi|15603860|ref|NP_246934.1| FabZ [Pasteurella multocida subsp. multocida str. Pm70]
 gi|14423702|sp|Q9CJK9|FABZ_PASMU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|12722436|gb|AAK04079.1| FabZ [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 152

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 3/135 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M+ LPHRYPFLLVD+VV+ +  +    +KN++ NEP F GHFP +P+ PGVLILE MA
Sbjct: 15  EIMKLLPHRYPFLLVDRVVDYEEGKWLKAVKNISVNEPCFTGHFPEQPIFPGVLILEAMA 74

Query: 75  QTAGAI-CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q  G + C  +   +     Y  +ID ARF++PV PGD++   V+ ++ R  + +F   A
Sbjct: 75  QATGVLACKTYRQLENEI-YYFAAIDNARFKRPVLPGDQMVLEVHFLKERRGITRFTGVA 133

Query: 134 KVENTVVAEAEI-CA 147
            V+  VV EAE+ CA
Sbjct: 134 TVDGQVVCEAELMCA 148


>gi|330504233|ref|YP_004381102.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas mendocina NK-01]
 gi|328918519|gb|AEB59350.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas mendocina NK-01]
          Length = 145

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +   +   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 2   DINEIREYLPHRYPFLLVDRVVDLDVEGKTVRAYKNVSINEPFFNGHFPEHPIMPGVLII 61

Query: 71  EGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG +     G         Y +  DK RFR PV PGD+L      + +R  +WK
Sbjct: 62  EAMAQAAGILGFKMMGVKPADGTLYYFVGSDKLRFRSPVTPGDQLVLEAKYLSDRRSIWK 121

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F+C A V+   V  AE ICA
Sbjct: 122 FECRATVDGKEVCSAEIICA 141


>gi|28209904|ref|NP_780848.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium tetani E88]
 gi|33516891|sp|Q899N7|FABZ_CLOTE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|28202339|gb|AAO34785.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Clostridium tetani E88]
          Length = 142

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++++ LPHRYP LL+DKV  ++  +  +  KNVTFNE  F GHFP  PVMPGVLI+E 
Sbjct: 6   IKDILQILPHRYPMLLIDKVETVEPGKKIVAYKNVTFNEGFFRGHFPHEPVMPGVLIIEA 65

Query: 73  MAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           +AQ AGAI  +    D++    PY   I+KA+FRK V PGD L+  V  ++ R      +
Sbjct: 66  LAQ-AGAIAVLS--LDEFKGKIPYFAGINKAKFRKKVIPGDTLKLEVEMIKLRGSAGIGK 122

Query: 131 CCAKVENTVVAEAEICAMV 149
             AKV   VVAEAEI  M+
Sbjct: 123 GIAKVNEKVVAEAEIMFMI 141


>gi|331702025|ref|YP_004398984.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Lactobacillus buchneri NRRL B-30929]
 gi|329129368|gb|AEB73921.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Lactobacillus buchneri NRRL B-30929]
          Length = 148

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (60%), Gaps = 4/151 (2%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           ++ LDA    E+M  +P+RYP L +DKV  +   ES +  KNVT NE  F GHFPG PVM
Sbjct: 1   MSVLDAS---EIMDLIPNRYPILFMDKVDELNPGESIVVTKNVTINEEFFQGHFPGNPVM 57

Query: 65  PGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           PGVLI+E +AQ A +I  +     +    YL +ID A+FRK V PGD L+ HV   + R 
Sbjct: 58  PGVLIIESLAQ-AASILILKTEKYKGKTAYLGAIDNAKFRKVVRPGDVLKLHVTMEKQRE 116

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           ++ K +C AKV++ V   AE+  +V   KK+
Sbjct: 117 NMGKVKCEAKVDDKVACSAELTFIVPDPKKK 147


>gi|75906321|ref|YP_320617.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anabaena variabilis ATCC
           29413]
 gi|75700046|gb|ABA19722.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Anabaena
           variabilis ATCC 29413]
          Length = 171

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 84/137 (61%), Gaps = 12/137 (8%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPFLLVDK+++    + A+GIKNVT NEPHF GHFP RP+MPGVLI+E MA
Sbjct: 35  EIQKLLPHRYPFLLVDKIIDYTPGKQAVGIKNVTINEPHFTGHFPDRPLMPGVLIVEAMA 94

Query: 75  QTAGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK--VRNRVDLWK 128
           Q  G +      +  G   +A      IDK RFR+ V PGD+L   V    ++ R    K
Sbjct: 95  QVGGIVMTQLPNLEGGLFVFA-----GIDKVRFRRQVVPGDQLVMTVELLWIKQR-RFGK 148

Query: 129 FQCCAKVENTVVAEAEI 145
            Q  A+V+  + AE E+
Sbjct: 149 MQARAEVDGQLAAEGEL 165


>gi|260889718|ref|ZP_05900981.1| beta-hydroxyacyl-(acyl-carrier- protein) dehydratase FabZ
           [Leptotrichia hofstadii F0254]
 gi|260860324|gb|EEX74824.1| beta-hydroxyacyl-(acyl-carrier- protein) dehydratase FabZ
           [Leptotrichia hofstadii F0254]
          Length = 144

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 86/134 (64%), Gaps = 5/134 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++M+ LPHRYPFLLVD+V+     +S + IKNVT NE  F GHFPG+PVMPGVL +E
Sbjct: 9   NIEDIMKILPHRYPFLLVDRVIEKNGTDSLVAIKNVTMNEEFFQGHFPGKPVMPGVLQIE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  G +       +    P  MSIDK +FR+ V PGD+L   V K++ + ++   + 
Sbjct: 69  ALAQAVGLLM-----LEPGKIPLFMSIDKCKFRRAVVPGDQLRLEVEKIKVKSNVIVARG 123

Query: 132 CAKVENTVVAEAEI 145
              V+ TVV+EA++
Sbjct: 124 RCVVDGTVVSEADL 137


>gi|33240866|ref|NP_875808.1| (3R)-hydroxymyristoyl-ACP dehydratase [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
 gi|47605644|sp|Q7TV98|FABZ_PROMA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|33238395|gb|AAQ00461.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 151

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/136 (48%), Positives = 82/136 (60%), Gaps = 10/136 (7%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPF LVD+VV  +  +SA GIKNVT NEPHF GHFPGRP+MPGVLI+E MA
Sbjct: 15  EIMGLLPHRYPFALVDRVVEYEPGKSATGIKNVTINEPHFQGHFPGRPLMPGVLIVEAMA 74

Query: 75  QTAGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKF 129
           Q  G I      +  G   +A      ID  RFR+PV PGD+L  +   +   R    K 
Sbjct: 75  QVGGLIVKQIPDLPKGLFVFA-----GIDSVRFRRPVVPGDQLLINCELISIKRQRFGKV 129

Query: 130 QCCAKVENTVVAEAEI 145
           +  AKV+  +V   E+
Sbjct: 130 KGEAKVDGNLVCSGEL 145


>gi|190359391|sp|Q1H150|FABZ_METFK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 145

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++ +LPHRYPF+LVD+V++++ ++  + +KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 2   DIHEILNYLPHRYPFVLVDRVLSLELNKEIVAVKNVTINEPFFPGHFPYHPVMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +     G   +  +  Y   +D  RF+KPV PGD+L   V+  R    +W++
Sbjct: 62  ALAQAAAILSFKTMGTKPNDKSVYYFAGMDNVRFKKPVSPGDQLILKVSIDRILRGIWRY 121

Query: 130 QCCAKVENTVVAEAEICAMV 149
           +  A V+  VVAEAE+  ++
Sbjct: 122 KGEALVDGAVVAEAEMMCIL 141


>gi|86606602|ref|YP_475365.1| (3R)-hydroxymyristoyl-ACP dehydratase [Synechococcus sp. JA-3-3Ab]
 gi|109828990|sp|Q2JTA0|FABZ_SYNJA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|86555144|gb|ABD00102.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. JA-3-3Ab]
          Length = 166

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 83/133 (62%), Gaps = 4/133 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           +++  LPHRYPFLLVD+VV  Q  + A+G+KNVTFNEP F GHFP RP+MPGVLI+E MA
Sbjct: 30  QILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFFQGHFPNRPIMPGVLIVEAMA 89

Query: 75  QTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD-LWKFQCC 132
           Q  G +   + +   + A      ID  RFR+PV PGD+L    N +  R   + K  C 
Sbjct: 90  QLGGIVLTKLPDVAGRLA--LFAGIDGVRFRRPVLPGDQLLLSANLLTIRQKRIGKMFCR 147

Query: 133 AKVENTVVAEAEI 145
           A+V   +V E E+
Sbjct: 148 AQVGGQLVTEGEL 160


>gi|317153114|ref|YP_004121162.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943365|gb|ADU62416.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 152

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M  LPHRYPFLLVD+VV  +        KNV+ NE  F GHFPG PVMPGVLILE
Sbjct: 8   DIRQIMDMLPHRYPFLLVDRVVEFEPGVRLKAYKNVSMNEAFFQGHFPGLPVMPGVLILE 67

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G   +  I    +     +   ++K +FRKPV PGDRL   V   R+++++W+ 
Sbjct: 68  ALAQAGGVFVMSTIQESLEDKVFLF-TGLNKVKFRKPVVPGDRLILKVAYDRHKMNIWRM 126

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A+V+  VVA+ E  A V
Sbjct: 127 HGIAEVDGQVVAQGEFSAAV 146


>gi|198283295|ref|YP_002219616.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667522|ref|YP_002425883.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247816|gb|ACH83409.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519735|gb|ACK80321.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 148

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 1/143 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++  +I ++++ LPHRYPFLLVD+VV ++  +    +KNVT NEPHF GHFPG PVMPGV
Sbjct: 1   MNELNIQDILKRLPHRYPFLLVDRVVEVEIGKRLRALKNVTMNEPHFQGHFPGFPVMPGV 60

Query: 68  LILEGMAQTAGAICAI-HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E +AQ A  +  +  + + + A  Y   IDKARFR+PV PGD+LE   N  R R  +
Sbjct: 61  LIIEALAQAAAILAFVSEDKYGENAAVYFAGIDKARFRRPVTPGDQLELIANVSRRRSGM 120

Query: 127 WKFQCCAKVENTVVAEAEICAMV 149
           W+ +  A V+   VA A + A +
Sbjct: 121 WQMETAALVDGVEVASALLMATL 143


>gi|190359401|sp|Q0VQE6|FABZ_ALCBS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 144

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 90/146 (61%), Gaps = 7/146 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+  +LPHRYPFLL+D+V+NI+  +    +KNVT NEP F GHFP  P+MPGVLI+E
Sbjct: 2   DIKEVREYLPHRYPFLLIDRVLNIEPGKRIEALKNVTINEPFFNGHFPEEPIMPGVLIIE 61

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ AG +  +       D Y    L+  DKARF++ V PGD L      V  + ++ K
Sbjct: 62  AMAQAAGILGFVTENKKPSDGYI-YLLVGTDKARFKRQVVPGDTLHLFAEYVVIKRNIIK 120

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
           F C A+V+   VA AE   M++ E+K
Sbjct: 121 FTCEAQVDGKTVASAE---MLVAEQK 143


>gi|254429806|ref|ZP_05043513.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Alcanivorax sp. DG881]
 gi|196195975|gb|EDX90934.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Alcanivorax sp. DG881]
          Length = 146

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 90/146 (61%), Gaps = 7/146 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+  +LPHRYPFLL+D+V+NI+  +    +KNVT NEP F GHFP  P+MPGVLI+E
Sbjct: 4   DIQEVREYLPHRYPFLLIDRVLNIEPGKRIEALKNVTINEPFFNGHFPDEPIMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ AG +  +       D Y    L+  DKARF++ V PGD L      V  + ++ K
Sbjct: 64  AMAQAAGILGFVTEKKKPSDGYI-YLLVGTDKARFKRRVIPGDTLHLFAEYVVVKRNILK 122

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
           F C A+V+   VA AE   M++ E+K
Sbjct: 123 FTCEAQVDGKTVASAE---MLVAEQK 145


>gi|163856836|ref|YP_001631134.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella petrii DSM 12804]
 gi|226700445|sp|A9INS6|FABZ_BORPD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|163260564|emb|CAP42866.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Bordetella
           petrii]
          Length = 151

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 87/143 (60%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LLVD+V++I   +S + IKNV+ NEP F GHFP  PVMPGVLI E
Sbjct: 4   DIKAIMERLPHRYPMLLVDRVLDIVPGKSIVAIKNVSINEPFFEGHFPHHPVMPGVLITE 63

Query: 72  GMAQTAGAICAIHN--GF---DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ A       +  G          YL+ ID+ARFR+PV PGD+L   V   R    +
Sbjct: 64  AMAQAAALFSFTDDDGGLKCDSAKTAYYLVGIDEARFRRPVVPGDQLRLEVQAERLSRAI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+  +VAEA++ CA+
Sbjct: 124 CKYQARALVDGQIVAEAKLMCAI 146


>gi|91206622|sp|Q3MH14|FABZ_ANAVT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 165

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 12/138 (8%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPFLLVDK+++    + A+GIKNVT NEPHF GHFP RP+MPGVLI+E MA
Sbjct: 29  EIQKLLPHRYPFLLVDKIIDYTPGKQAVGIKNVTINEPHFTGHFPDRPLMPGVLIVEAMA 88

Query: 75  QTAGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK--VRNRVDLWK 128
           Q  G +      +  G   +A      IDK RFR+ V PGD+L   V    ++ R    K
Sbjct: 89  QVGGIVMTQLPNLEGGLFVFA-----GIDKVRFRRQVVPGDQLVMTVELLWIKQR-RFGK 142

Query: 129 FQCCAKVENTVVAEAEIC 146
            Q  A+V+  + AE E+ 
Sbjct: 143 MQARAEVDGQLAAEGELM 160


>gi|163750362|ref|ZP_02157602.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella benthica KT99]
 gi|161329852|gb|EDQ00838.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Shewanella benthica KT99]
          Length = 152

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 88/144 (61%), Gaps = 6/144 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E+M  LPHRYPFLL+D+V++    ES   IKNVT NEP F GHFP +PVMPGV
Sbjct: 5   LNTMDIKEIMNSLPHRYPFLLIDRVLDYTPGESLHAIKNVTINEPFFQGHFPVQPVMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LILE MAQ  G +   +   +  A     Y   IDKARF++ V PGD+L + V  ++ R 
Sbjct: 65  LILEAMAQATGLLA--YKSMEAAAEESLYYFAGIDKARFKRVVEPGDQLHFVVKLIKERR 122

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +  F    +V+  +V  A+I CA
Sbjct: 123 GIGVFTGEVRVDGELVCSAKIMCA 146


>gi|259907553|ref|YP_002647909.1| (3R)-hydroxymyristoyl-ACP dehydratase [Erwinia pyrifoliae Ep1/96]
 gi|224963175|emb|CAX54659.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           pyrifoliae Ep1/96]
 gi|283477393|emb|CAY73309.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           pyrifoliae DSM 12163]
 gi|310764939|gb|ADP09889.1| (3R)-hydroxymyristoyl-ACP dehydratase [Erwinia sp. Ejp617]
          Length = 151

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 89/151 (58%), Gaps = 9/151 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +    L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTKTHTLKIEEIIEL---LPHRYPFLLVDRVLEFEESKYLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP---YLMSIDKARFRKPVFPGDRLEYHV 117
           +P+ PGVLILE MAQ  G +     G  + AP    Y   ID ARF+ PV PGD++   V
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVG--KLAPGELYYFAGIDHARFKNPVVPGDQMIMEV 115

Query: 118 NKVRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
              + R  L +F+  A V+  +V EA  +CA
Sbjct: 116 TFEKTRRGLTRFKGVATVDGKIVCEATMMCA 146


>gi|110834015|ref|YP_692874.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Alcanivorax borkumensis SK2]
 gi|110647126|emb|CAL16602.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Alcanivorax borkumensis SK2]
          Length = 149

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 90/146 (61%), Gaps = 7/146 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+  +LPHRYPFLL+D+V+NI+  +    +KNVT NEP F GHFP  P+MPGVLI+E
Sbjct: 7   DIKEVREYLPHRYPFLLIDRVLNIEPGKRIEALKNVTINEPFFNGHFPEEPIMPGVLIIE 66

Query: 72  GMAQTAGAICAIHNG---FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ AG +  +       D Y    L+  DKARF++ V PGD L      V  + ++ K
Sbjct: 67  AMAQAAGILGFVTENKKPSDGYI-YLLVGTDKARFKRQVVPGDTLHLFAEYVVIKRNIIK 125

Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154
           F C A+V+   VA AE   M++ E+K
Sbjct: 126 FTCEAQVDGKTVASAE---MLVAEQK 148


>gi|225874199|ref|YP_002755658.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium capsulatum ATCC 51196]
 gi|225794244|gb|ACO34334.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Acidobacterium capsulatum ATCC 51196]
          Length = 186

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 88/146 (60%), Gaps = 4/146 (2%)

Query: 8   LDAK---DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           LD K   DI E+M  LPHRYPFLL+D+VV I+R +  + IKNVT NEP F GHFPG PVM
Sbjct: 8   LDGKQTLDIREIMSILPHRYPFLLIDRVVEIERKKRIVAIKNVTMNEPFFQGHFPGMPVM 67

Query: 65  PGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           PGV+++E +AQ  G +                SI++A+FR+PV PGD+L   ++ +  + 
Sbjct: 68  PGVMVIEAIAQAGGTLLMPEVPDRDKLLIMFTSIERAKFRRPVVPGDQLRIEIDVLNWKP 127

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAMV 149
              K +  A V+  +  EA + C +V
Sbjct: 128 RRAKMEGRALVDGKLACEATVMCQLV 153


>gi|317046993|ref|YP_004114641.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Pantoea
           sp. At-9b]
 gi|316948610|gb|ADU68085.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Pantoea
           sp. At-9b]
          Length = 151

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLKIEEILEL---LPHRYPFLLVDRVLEFEEHKYLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGKIVCEATMMCA 146


>gi|227509986|ref|ZP_03940035.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
 gi|227512920|ref|ZP_03942969.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           buchneri ATCC 11577]
 gi|227523048|ref|ZP_03953097.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           hilgardii ATCC 8290]
 gi|227083920|gb|EEI19232.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           buchneri ATCC 11577]
 gi|227089866|gb|EEI25178.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           hilgardii ATCC 8290]
 gi|227190592|gb|EEI70659.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
          Length = 148

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (59%), Gaps = 4/151 (2%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           ++ LDA    E+M  +P+RYP L +DKV  +   ES +  KNVT NE  F GHFPG PVM
Sbjct: 1   MSVLDAS---EIMDLIPNRYPILFMDKVDELNPGESIVCTKNVTINEEFFQGHFPGNPVM 57

Query: 65  PGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           PGVLI+E +AQ A +I  +     Q    YL SID A+FRK V PGD L+ HV   + R 
Sbjct: 58  PGVLIIESLAQ-AASILILKTEKYQGKTAYLGSIDNAKFRKVVRPGDVLKLHVEMEKQRD 116

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           ++ K +C AKV+  V   A +  +V   KK+
Sbjct: 117 NMGKVKCEAKVDEKVACSATLTFIVPDPKKK 147


>gi|228948987|ref|ZP_04111260.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228810743|gb|EEM57091.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
          Length = 144

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVDKV+ ++  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDKVLEVEEGKRAIGIKNVTANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGSIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +  E EI    + EKKE
Sbjct: 122 VATVDGEIACETEIT-FALGEKKE 144


>gi|229588814|ref|YP_002870933.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas fluorescens
           SBW25]
 gi|312959403|ref|ZP_07773920.1| (3R)-hydroxymyristoyl-dehydratase [Pseudomonas fluorescens WH6]
 gi|259646356|sp|C3K606|FABZ_PSEFS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|229360680|emb|CAY47538.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas fluorescens SBW25]
 gi|311286120|gb|EFQ64684.1| (3R)-hydroxymyristoyl-dehydratase [Pseudomonas fluorescens WH6]
          Length = 146

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +E  I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVDLNVEEKRIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFD--QYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDLKPADGTLYYFVGSDKLRFRNPVTPGDQLILEAKFISCK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF+C A V+   V  AE ICA
Sbjct: 118 RQIWKFECQASVDGKPVCSAEIICA 142


>gi|148549381|ref|YP_001269483.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas putida F1]
 gi|167032170|ref|YP_001667401.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas putida GB-1]
 gi|33516889|sp|Q88MG9|FABZ_PSEPK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166233431|sp|A5W839|FABZ_PSEP1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044393|sp|B0KSB0|FABZ_PSEPG RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|148513439|gb|ABQ80299.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Pseudomonas
           putida F1]
 gi|166858658|gb|ABY97065.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas putida GB-1]
 gi|313500230|gb|ADR61596.1| FabZ [Pseudomonas putida BIRD-1]
          Length = 146

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V ++  +  +I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTDLDFEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF    A P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRK 117

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +WKF+C A V+   V  AEI CA
Sbjct: 118 SMIWKFECRALVDGKPVCSAEITCA 142


>gi|325278081|ref|ZP_08143600.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas sp. TJI-51]
 gi|324096788|gb|EGB95115.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas sp. TJI-51]
          Length = 146

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +  +I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTELDYEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF    A P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRK 117

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +WKF+C A V+   V  AEI CA
Sbjct: 118 SMIWKFECRALVDGKPVCSAEITCA 142


>gi|304317901|ref|YP_003853046.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779403|gb|ADL69962.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 143

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 95/145 (65%), Gaps = 4/145 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+ KDI E+   +PHRYPFL++D+V+ I  ++ A+GIKN++ NEP+F GHFP  P++PGV
Sbjct: 2   LENKDIREV---IPHRYPFLMIDRVLEIDDNKKAVGIKNISANEPYFQGHFPDNPIVPGV 58

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQ  G I  +H   +         I+K +F++ V PGD+L+  V  + ++++L 
Sbjct: 59  LIVEAMAQL-GGITVMHGKKNNDMIGLFTGINKCKFKRVVKPGDQLKIEVEILSSKLNLV 117

Query: 128 KFQCCAKVENTVVAEAEICAMVMHE 152
           K +  A V+  + AEAEI  M++ +
Sbjct: 118 KAKGIATVDGELAAEAEISFMLVEK 142


>gi|147679105|ref|YP_001213320.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pelotomaculum
           thermopropionicum SI]
 gi|259646355|sp|A5CYG8|FABZ_PELTS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|146275202|dbj|BAF60951.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [Pelotomaculum thermopropionicum SI]
          Length = 140

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 88/136 (64%), Gaps = 5/136 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD++++++    A+G+KNV+ NEP+F GHFPG PVMPGVLI+E
Sbjct: 3   DINQIKEIIPHRYPFLLVDRILSVEDGRKAVGLKNVSANEPYFQGHFPGYPVMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  GA+  +     ++A    +   ID+ARFR+ V PGD+L   V   + R  + K 
Sbjct: 63  AMAQV-GAVAVLR--LPEFAGKMAFFAGIDRARFRRQVVPGDQLRIEVELQKLRGTVGKA 119

Query: 130 QCCAKVENTVVAEAEI 145
           +  A V   + AEAE+
Sbjct: 120 RGAAYVGQELAAEAEL 135


>gi|26988334|ref|NP_743759.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas putida KT2440]
 gi|24983083|gb|AAN67223.1|AE016349_4 (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Pseudomonas putida KT2440]
          Length = 163

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V ++  +  +I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 20  DINEIREYLPHRYPFLLVDRVTDLDFEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVLII 79

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF    A P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 80  EAMAQAAGIL-----GFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRK 134

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +WKF+C A V+   V  AEI CA
Sbjct: 135 SMIWKFECRALVDGKPVCSAEITCA 159


>gi|304396655|ref|ZP_07378536.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Pantoea
           sp. aB]
 gi|308185751|ref|YP_003929882.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Pantoea
           vagans C9-1]
 gi|304356164|gb|EFM20530.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Pantoea
           sp. aB]
 gi|308056261|gb|ADO08433.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Pantoea
           vagans C9-1]
          Length = 151

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 89/149 (59%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLKIEEILEL---LPHRYPFLLVDRVLEFEEHKYLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDSARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGKIVCEATMMCA 146


>gi|94265741|ref|ZP_01289477.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium MLMS-1]
 gi|93453716|gb|EAT04094.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium MLMS-1]
          Length = 149

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 87/142 (61%), Gaps = 3/142 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L   DI E++  LPHRYP ++VD++V ++      G KNV+ NE  F GHFPG PVMPGV
Sbjct: 6   LQGLDIKEILAKLPHRYPMVMVDRIVALEDGVRIRGYKNVSINENFFQGHFPGEPVMPGV 65

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L+LEGMAQT GA+ A  +  +  A    Y   +D  +FR+ V PGD+L Y +  ++ +  
Sbjct: 66  LMLEGMAQT-GALLAYLSASESTAGKLVYFAGLDDVKFRRKVIPGDQLHYDLQVLKRKSR 124

Query: 126 LWKFQCCAKVENTVVAEAEICA 147
            W     A V++ +VAEA++ A
Sbjct: 125 FWVMAGKAYVDDALVAEAQLMA 146


>gi|56552042|ref|YP_162881.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241761996|ref|ZP_04760080.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|260752425|ref|YP_003225318.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|14423716|sp|Q9X5F5|FABZ_ZYMMO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|4768868|gb|AAD29662.1|AF124757_22 hydroxymyristol acyl carrier protein dehydrolase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56543616|gb|AAV89770.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241373462|gb|EER63049.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|258551788|gb|ACV74734.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 158

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +M  LPHR+P LLVD+V  +   E  + IK VT NEP F GHFPG P+MPGVLI+E
Sbjct: 15  DVKRVMAALPHRFPMLLVDRVETLIPGEKIVAIKAVTINEPFFTGHFPGNPIMPGVLIVE 74

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ AG +     G        Y M+I++ +FR PV PG  L   V  ++ R  + KF+
Sbjct: 75  ALAQAAGVLAIESLGLTGTGKLVYFMAINETKFRIPVEPGILLRLEVEFLQKRAKICKFK 134

Query: 131 CCAKVENTVVAEAEICAMV 149
             A +E+ V AE E  AM+
Sbjct: 135 ARALIEDKVAAETEFTAMI 153


>gi|302872443|ref|YP_003841079.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302575302|gb|ADL43093.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 140

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 82/135 (60%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++M  +PHRYPFLLVDK+V I+  + A GIKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   EIEKIMNIIPHRYPFLLVDKIVEIEEGKKAKGIKNVTINEPFFQGHFPQNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +     +   P+   IDK RF++ V PGD L      +  +  + K + 
Sbjct: 63  AMAQV-GAVAMLLKEEFRGKTPFFAGIDKVRFKRVVKPGDVLVIETELISLKGSIGKAKA 121

Query: 132 CAKVENTVVAEAEIC 146
            A V+  VV E E+ 
Sbjct: 122 IATVDGEVVCEGELL 136


>gi|297585400|ref|YP_003701180.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           selenitireducens MLS10]
 gi|297143857|gb|ADI00615.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           selenitireducens MLS10]
          Length = 146

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   +PHRYPFLLVDK+++++  +SA GIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 4   DITAIKEIIPHRYPFLLVDKILDVEEGKSATGIKNVTANEEFFNGHFPDYPVMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   IDK RF+  V PGD+L+  V  +R +  + K + 
Sbjct: 64  ALAQV-GAVAMLKPEENRGRLAFFAGIDKCRFKAQVKPGDQLKLEVEIIRFKGPIGKGKA 122

Query: 132 CAKVENTVVAEAEI 145
            A V+   VAEAE+
Sbjct: 123 TASVDGQTVAEAEL 136


>gi|261364381|ref|ZP_05977264.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           mucosa ATCC 25996]
 gi|288567652|gb|EFC89212.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           mucosa ATCC 25996]
          Length = 149

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFESMKTLTAIKNVTMNEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + N+  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTNKRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFSAVAKVDGQVAVEAIIMCA 145


>gi|312126941|ref|YP_003991815.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311776960|gb|ADQ06446.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 140

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 80/135 (59%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLLVDK+V I+  + A GIKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   DINRIHEVLPHRYPFLLVDKIVEIEEGKRAKGIKNVTINEPFFQGHFPQNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +     +   P+   IDK RF+K V PGD L      +  +  + K + 
Sbjct: 63  AMAQV-GAVAMLSKDEFKGKTPFFAGIDKVRFKKVVKPGDVLVIETELISLKGSIGKAKA 121

Query: 132 CAKVENTVVAEAEIC 146
            A VE  +V E E+ 
Sbjct: 122 FAYVEGEIVCEGELL 136


>gi|220916318|ref|YP_002491622.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254788528|sp|B8JFW8|FABZ_ANAD2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|219954172|gb|ACL64556.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 156

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 90/145 (62%), Gaps = 2/145 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+V + + LPHR PFLLVD+VV  +     + +K VT NEP F GHFP +PVMPGVLILE
Sbjct: 12  DVVGIQKLLPHRPPFLLVDRVVEFEAHRRLVALKGVTMNEPFFQGHFPAQPVMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +  +    D+      YLM ID ARFR+PV PGDRLE  V   + +  +WK 
Sbjct: 72  ALAQAAALLATMSLQPDEVKDKITYLMGIDGARFRRPVVPGDRLELEVEVTKQKGAVWKQ 131

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
              A+V+  VVAEAE  AM+   ++
Sbjct: 132 TGVARVDGQVVAEAEFMAMLADRER 156


>gi|86610211|ref|YP_478973.1| (3R)-hydroxymyristoyl-ACP dehydratase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|109828994|sp|Q2JI59|FABZ_SYNJB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|86558753|gb|ABD03710.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 166

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (62%), Gaps = 6/134 (4%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           +++  LPHRYPFLLVD+VV  Q  + A+G+KNVTFNEP F GHFP RP+MPGVLI+E MA
Sbjct: 30  QILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFFQGHFPNRPIMPGVLIVEAMA 89

Query: 75  QTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN--KVRNRVDLWKFQC 131
           Q  G +   + +   + A      ID  RFR+PV PGD+L    +   +R R  + K  C
Sbjct: 90  QIGGIVLTKLPDVAGRLA--LFAGIDGVRFRRPVLPGDQLLLSADLLTIRQR-RIGKMFC 146

Query: 132 CAKVENTVVAEAEI 145
            A+V   +V E E+
Sbjct: 147 RAQVGGQLVTEGEL 160


>gi|170723232|ref|YP_001750920.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas putida W619]
 gi|226700251|sp|B1JBP9|FABZ_PSEPW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|169761235|gb|ACA74551.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas putida W619]
          Length = 146

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V ++  +  +I   KNV+ NEP F GHFP  PVMPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTDLDFEAQSIRAYKNVSINEPFFNGHFPEHPVMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF    A P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFIGRK 117

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +WKF+C A V+   V  AEI CA
Sbjct: 118 KTIWKFECRALVDGKPVCSAEITCA 142


>gi|119505677|ref|ZP_01627747.1| (3R)-hydroxymyristoyl ACP dehydratase [marine gamma proteobacterium
           HTCC2080]
 gi|119458489|gb|EAW39594.1| (3R)-hydroxymyristoyl ACP dehydratase [marine gamma proteobacterium
           HTCC2080]
          Length = 144

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 85/144 (59%), Gaps = 13/144 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +   LPHRYPFLLVD+V++++  ES    KN++ NEP+F GHFP +PV PGVL++E
Sbjct: 4   DIAAIREHLPHRYPFLLVDRVIDLELGESIHAYKNLSINEPYFDGHFPEQPVFPGVLLVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP-------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            MAQ AG +     GF             YL+ +DK RF++P  PGDR++     V  R 
Sbjct: 64  AMAQAAGIL-----GFKTMGKTPKDGSLYYLVGVDKLRFKRPCVPGDRVDLFAKIVSERR 118

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +WKF   ++VE    A A I CA
Sbjct: 119 GIWKFDVHSEVEGATCASATILCA 142


>gi|117620535|ref|YP_855725.1| (3R)-hydroxymyristoyl-ACP dehydratase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|171855195|sp|A0KHH4|FABZ_AERHH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|117561942|gb|ABK38890.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 153

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 84/145 (57%), Gaps = 15/145 (10%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQ-RDESAI--GIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           I E+M  LPHRYPFL+VDKV N +  DE      IKNV+FNEP F GHFP +PV PGVLI
Sbjct: 10  IQEIMDLLPHRYPFLMVDKVENYEISDERKTLRAIKNVSFNEPIFQGHFPAKPVFPGVLI 69

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LE MAQ  G +      F     P      Y  SID ARF++PV PGD+L   V  ++ R
Sbjct: 70  LEAMAQATGILA-----FTMVGKPSPNELYYFASIDNARFKRPVGPGDQLVLDVEFLKER 124

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             + KF   A V   VV  AE+ CA
Sbjct: 125 RGIAKFTGVATVNGEVVCTAELMCA 149


>gi|104783184|ref|YP_609682.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas entomophila L48]
 gi|122402180|sp|Q1I637|FABZ_PSEE4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|95112171|emb|CAK16898.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas entomophila L48]
          Length = 146

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +  +I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTELDFEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF    A P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRK 117

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +WKF+C A V+   V  AEI CA
Sbjct: 118 SMIWKFECRALVDGKPVCSAEITCA 142


>gi|320449510|ref|YP_004201606.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thermus
           scotoductus SA-01]
 gi|320149679|gb|ADW21057.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Thermus
           scotoductus SA-01]
          Length = 143

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 86/138 (62%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E++  LPHRYPFLL+D+V++   +++   +KNVTFNEPHF GHFPG P+MPGVLI+E
Sbjct: 2   EIGEILALLPHRYPFLLIDRVLHAD-EKTFRALKNVTFNEPHFQGHFPGYPIMPGVLIIE 60

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ A    A   GF      +L+ +++ARF+KPV PGD L      +  R  L K + 
Sbjct: 61  AMAQAAVGSIAKQPGFKPGGLVFLVGVEEARFKKPVVPGDTLILEGELLLFRRGLGKVEV 120

Query: 132 CAKVENTVVAEAEICAMV 149
            A VE    A A +  +V
Sbjct: 121 RALVEGEERASARLSFVV 138


>gi|304407721|ref|ZP_07389372.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus curdlanolyticus YK9]
 gi|304343204|gb|EFM09047.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus curdlanolyticus YK9]
          Length = 143

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 82/135 (60%), Gaps = 3/135 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHR+PFLL+D+++ ++    A+GIKNVT NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DINEIQQIIPHRHPFLLIDRIIEVEEGVRAVGIKNVTMNEPFFAGHFPGFPVMPGVLIVE 62

Query: 72  GMAQTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ    AI  I     + A  +   ID+ RFR  V PGD L   V   R +  + K  
Sbjct: 63  ALAQVGAVAILKIEENRGKLA--FFAGIDEFRFRGQVTPGDTLRLEVEITRLKGKIGKGH 120

Query: 131 CCAKVENTVVAEAEI 145
             AKV + VVAE  I
Sbjct: 121 ATAKVNDKVVAEGGI 135


>gi|255067002|ref|ZP_05318857.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           sicca ATCC 29256]
 gi|255048827|gb|EET44291.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           sicca ATCC 29256]
          Length = 182

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 40  IEAKDIQKL---IPHRYPFLQLDRITAFESMKTLTAIKNVTMNEPQFQGHFPDLPVMPGV 96

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + N+  +
Sbjct: 97  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTNKRGI 156

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 157 GKFSAVAKVDGQVAVEAIIMCA 178


>gi|300715407|ref|YP_003740210.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           billingiae Eb661]
 gi|299061243|emb|CAX58352.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Erwinia
           billingiae Eb661]
          Length = 151

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 89/149 (59%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V+  +  +    +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLKIEEIIEL---LPHRYPFLLVDRVLEFEEHKFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  +V EA  +CA
Sbjct: 118 EKTRRGLTRFKGVATVDGKIVCEATMMCA 146


>gi|22299334|ref|NP_682581.1| (3R)-hydroxymyristoyl-ACP dehydratase [Thermosynechococcus
           elongatus BP-1]
 gi|33516894|sp|Q8DI01|FABZ_THEEB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|22295517|dbj|BAC09343.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Thermosynechococcus elongatus BP-1]
          Length = 153

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           ++D        + EL + LPHRYPFLLVD++++   ++ A+G+KNVT NEP F GHFPGR
Sbjct: 4   LTDSPPTTVLTVTELQQLLPHRYPFLLVDRIIDYVPEKYAVGLKNVTINEPFFQGHFPGR 63

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN-KV 120
           P+MPGVLI+E +AQ  G +    N + +        IDK RFR+PV PGD+L       V
Sbjct: 64  PIMPGVLIVEALAQVGGVVLMQMN-WAKDKLSVFAGIDKVRFRRPVVPGDQLILRAELLV 122

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEI 145
             +  + K Q  A+V   +V E E+
Sbjct: 123 VKQQRIGKMQGRAEVNGQLVCEGEM 147


>gi|332971751|gb|EGK10699.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Desmospora sp. 8437]
          Length = 154

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++  +  + A GIKNVT  EP+F GHFPG PVMPGVLI+E
Sbjct: 14  DINQIQEVIPHRYPFLLVDRILECETGKRATGIKNVTMTEPYFQGHFPGHPVMPGVLIVE 73

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   I+K RFR  V PGD L   V  ++ R    K + 
Sbjct: 74  ALAQV-GAVAVLGMEENRGKLAFFAGIEKFRFRGQVGPGDVLTLEVEMLKLRPSFGKGKA 132

Query: 132 CAKVENTVVAEAEI 145
            A+V++ VVAE EI
Sbjct: 133 VARVKDRVVAEGEI 146


>gi|156742905|ref|YP_001433034.1| (3R)-hydroxymyristoyl-ACP dehydratase [Roseiflexus castenholzii DSM
           13941]
 gi|189044395|sp|A7NN83|FABZ_ROSCS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|156234233|gb|ABU59016.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Roseiflexus castenholzii DSM 13941]
          Length = 143

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+M  +PHRYPFLL+D+++ ++  + A+G K VT NEP F GHFP  P+MPGVLI+E
Sbjct: 3   NIQEIMAIIPHRYPFLLIDRILELEPGQRAVGEKLVTINEPFFQGHFPAHPIMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT GA+ A+    ++    +   ID  RFRKPV+PGD L   V   + R  + K   
Sbjct: 63  ALAQT-GAVAALSLPENRGKIAFFAGIDGVRFRKPVYPGDTLRLEVRFDKMRRGIGKGTG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  VV E E+
Sbjct: 122 VATVDGQVVCEGEL 135


>gi|70728569|ref|YP_258318.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas fluorescens
           Pf-5]
 gi|91206641|sp|Q4KHG5|FABZ_PSEF5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|68342868|gb|AAY90474.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas fluorescens Pf-5]
          Length = 146

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVDLDVEGKCIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLILEAKFISCK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF+C A V+   V  AE ICA
Sbjct: 118 RQIWKFECQASVDGKPVCSAEIICA 142


>gi|86130212|ref|ZP_01048812.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Dokdonia donghaensis MED134]
 gi|85818887|gb|EAQ40046.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Dokdonia donghaensis MED134]
          Length = 468

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL     KDI ++M  LPHR PFLLVDK++ +  +E  IGIKNVT NEP F+GHFPG PV
Sbjct: 317 DLHAAPVKDINQIMEMLPHRPPFLLVDKILELT-EEHVIGIKNVTMNEPFFVGHFPGAPV 375

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN- 122
           MPGVL +E MAQT G +        +    YL+ ID  R++  V PGD L + ++ +   
Sbjct: 376 MPGVLQIEAMAQTGGILVLSTVPDPENYLTYLLKIDNVRYKHQVVPGDTLIFKLDLMAPI 435

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
           R  + + Q  A     +V+EAEI A ++  K
Sbjct: 436 RRGICQMQARAYANGKLVSEAEIMAQIVKVK 466


>gi|253583578|ref|ZP_04860776.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Fusobacterium
           varium ATCC 27725]
 gi|251834150|gb|EES62713.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Fusobacterium
           varium ATCC 27725]
          Length = 141

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 88/133 (66%), Gaps = 4/133 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           D +E+M+ +PHRYPFLLVD+++ + ++E  I G+KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DTLEIMKRIPHRYPFLLVDRIIEVNKEEQKIKGLKNVTINEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  + +G +    PY + ++ A+F+ P+ PGD++ Y V   + + +  K  
Sbjct: 63  EGMAQCLGVL--VMDGVEGKV-PYFVGVESAKFKSPIKPGDQIIYEVEVEKIKRNFVKAH 119

Query: 131 CCAKVENTVVAEA 143
             AKV+  +  EA
Sbjct: 120 GVAKVDGVLACEA 132


>gi|311280851|ref|YP_003943082.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enterobacter cloacae SCF1]
 gi|308750046|gb|ADO49798.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enterobacter cloacae SCF1]
          Length = 151

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M +D   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTDTHTLHIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|90415804|ref|ZP_01223737.1| (3R)-hydroxymyristoyl-acyl carrier protein [marine gamma
           proteobacterium HTCC2207]
 gi|90332178|gb|EAS47375.1| (3R)-hydroxymyristoyl-acyl carrier protein [marine gamma
           proteobacterium HTCC2207]
          Length = 158

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 87/141 (61%), Gaps = 3/141 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A  + E+M  LPHRYPFLLVD+V+ +   E  + +KN+T NE  F GHFPG P+ PGV+I
Sbjct: 10  ALTVTEIMNILPHRYPFLLVDRVLELVEGERILAMKNITGNEDVFNGHFPGAPIFPGVMI 69

Query: 70  LEGMAQTAGAIC-AIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           +E +AQ +G +     N        YL + +DKARF+KPV PGD+L      V  + ++W
Sbjct: 70  IEALAQASGILGFKTTNTTADDGKLYLFAGVDKARFKKPVTPGDQLMLESQVVAVKRNIW 129

Query: 128 KFQCCAKVENTVVAEAE-ICA 147
           +FQ  A V + +V EA  +CA
Sbjct: 130 RFQTRATVNDKLVCEATLLCA 150


>gi|254672761|emb|CBA06793.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase [Neisseria
           meningitidis alpha275]
          Length = 149

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFESMKTLTAIKNVTINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|37521435|ref|NP_924812.1| (3R)-hydroxymyristoyl-ACP dehydratase [Gloeobacter violaceus PCC
           7421]
 gi|47605639|sp|Q7NJG6|FABZ_GLOVI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|35212432|dbj|BAC89807.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Gloeobacter violaceus PCC 7421]
          Length = 142

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 86/136 (63%), Gaps = 4/136 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D +E+ + L HRYPFLLVD+V+  +    A+GIKNVT NEP F GHFPGRP+MPG L++E
Sbjct: 3   DNIEIQKILAHRYPFLLVDRVLVFEPGVRAVGIKNVTINEPFFQGHFPGRPLMPGALLIE 62

Query: 72  GMAQTAGAICA-IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF- 129
            MAQ  G +C  +     +   P L+ ++K RFR+ V PGD++      +R R   +   
Sbjct: 63  AMAQVGGIVCGQLPEAVGKI--PLLVGVNKTRFRRQVVPGDQVIITAEDLRTRQKRFGIM 120

Query: 130 QCCAKVENTVVAEAEI 145
           Q  ++V+  +VAEAEI
Sbjct: 121 QTRSEVDGKLVAEAEI 136


>gi|192359935|ref|YP_001981619.1| (3R)-hydroxymyristoyl-ACP dehydratase [Cellvibrio japonicus
           Ueda107]
 gi|226700450|sp|B3PBQ9|FABZ_CELJU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190686100|gb|ACE83778.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Cellvibrio japonicus Ueda107]
          Length = 145

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+  +LPHRYPFLLVD+VV +   ES I  KN+T NE  F GHFP  PV PGV+ILE
Sbjct: 3   DVNEIREYLPHRYPFLLVDRVVELVEGESIIAYKNITVNEEVFNGHFPQNPVFPGVMILE 62

Query: 72  GMAQTAGAICAIHNGFD-QYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ +G +     G   +    YL + +D  RF++ V PGDRL+     +  +  +WKF
Sbjct: 63  AMAQASGILGFKTMGKKPEDGSIYLFAGVDDVRFKRQVVPGDRLQLESRVISEKRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
           +C A V+  + A A I CA
Sbjct: 123 ECKATVDGVLAASATILCA 141


>gi|323703002|ref|ZP_08114658.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532015|gb|EGB21898.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfotomaculum nigrificans DSM 574]
          Length = 142

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLLVD+++ I+  +  +GIKNVT NE  F GHFPG PVMPGVLI+E
Sbjct: 3   DINAIQQILPHRYPFLLVDRILEIEEGKKVVGIKNVTANEQFFQGHFPGYPVMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +          +   IDKARFR+ V PGD L   V  ++ R  + K   
Sbjct: 63  AMAQV-GAVAVLSMPAYAGRIAFFAGIDKARFRRQVVPGDTLRIEVEVLKLRGTVGKSMA 121

Query: 132 CAKVENTVVAEAEI 145
            A V   + AEAE+
Sbjct: 122 RAYVGEELAAEAEL 135


>gi|152979550|ref|YP_001345179.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Actinobacillus succinogenes 130Z]
 gi|171704352|sp|A6VQJ7|FABZ_ACTSZ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|150841273|gb|ABR75244.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Actinobacillus succinogenes 130Z]
          Length = 150

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHR+PFLLVD+VV+ Q  E    IKN++ NEP F GHFP  P++PGVLILE +A
Sbjct: 15  EIMTLLPHRFPFLLVDRVVDFQEGEWLKAIKNISVNEPCFTGHFPNEPILPGVLILEALA 74

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q+ G +    +        Y   ID ARF++PV PGD++E +V  ++ R  +  F   A 
Sbjct: 75  QSMGLLAFKTHEIQGGELFYFAGIDDARFKRPVLPGDQMELYVEVIKERRGITSFIGRAT 134

Query: 135 VENTVVAEAEI-CA 147
           V   V  EA++ CA
Sbjct: 135 VNGEVACEAKLMCA 148


>gi|238893176|ref|YP_002917910.1| (3R)-hydroxymyristoyl-ACP dehydratase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238545492|dbj|BAH61843.1| putative (3R)-hydroxymyristoyl-ACP dehydratase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 175

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 91/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           + +D   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 25  LTTDTHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 81

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P++PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 82  KPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 141

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 142 EKTRRGLTRFKGVALVDGKVVCEATMMCA 170


>gi|323698043|ref|ZP_08109955.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio sp. ND132]
 gi|323457975|gb|EGB13840.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio desulfuricans ND132]
          Length = 152

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 89/141 (63%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M  LPHRYPFLLVD+V+  +       +KNVT NE  F GHFPG PVMPGVL LE
Sbjct: 8   DIRKIMEMLPHRYPFLLVDRVLEFEAGVRLKAVKNVTINENFFQGHFPGLPVMPGVLQLE 67

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLM---SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            +AQT GA+  + N FD+     +     +DK +FR+PV PGD+L  +V  ++ ++++WK
Sbjct: 68  ALAQT-GALF-VMNSFDEPLGDRIFLFTGLDKVKFRRPVVPGDQLVLNVQFLKQKLNIWK 125

Query: 129 FQCCAKVENTVVAEAEICAMV 149
            +  A+V+  V  + E  A +
Sbjct: 126 MRGVAEVDGQVTCQGEFSAAI 146


>gi|167854837|ref|ZP_02477614.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Haemophilus parasuis 29755]
 gi|167854016|gb|EDS25253.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Haemophilus parasuis 29755]
          Length = 161

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+VV+ +  +    +KNV+ NEP F GHFP +PV PGVLILE
Sbjct: 22  EVTEIMEMLPHRYPFLLVDRVVDFEEGKWLRAVKNVSVNEPCFTGHFPNQPVFPGVLILE 81

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G        Y  ++D ARF++PV PGD++   V  V+ R  +  F 
Sbjct: 82  AMAQATGVLAIKSYGKLKDNELYYFAAVDNARFKRPVVPGDQMIIEVTFVKERRGITAFT 141

Query: 131 CCAKVENTVVAEAEI-CA 147
               V++T+V EA++ CA
Sbjct: 142 GKVYVDDTLVCEADLMCA 159


>gi|37524684|ref|NP_928028.1| (3R)-hydroxymyristoyl-ACP dehydratase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|47605637|sp|Q7N8N6|FABZ_PHOLL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|36784109|emb|CAE12978.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) (17 kDa
           actomyosincomponent) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 150

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 87/137 (63%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHRYPFLLVD+V++ +  +    +KNV+FNEP F GHFPG+P+ PGVLILE 
Sbjct: 9   IEEILDLLPHRYPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPIFPGVLILEA 68

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y  +ID ARF++PV PGD++   V  ++ R  + + + 
Sbjct: 69  MAQATGILAFRSVGKLEPNELYYFAAIDGARFKRPVVPGDQMILEVEFIKERRGVARCRG 128

Query: 132 CAKVENTVVAEAE-ICA 147
            AKV+  +  EAE +CA
Sbjct: 129 VAKVDGEIACEAEMMCA 145


>gi|197105232|ref|YP_002130609.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Phenylobacterium zucineum HLK1]
 gi|196478652|gb|ACG78180.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Phenylobacterium zucineum HLK1]
          Length = 156

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 86/141 (60%), Gaps = 1/141 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  +PHRYPFLLVD+    +  ES +GIK VT NEP F GHFP  PVMPGVL++E
Sbjct: 15  DITEVLERIPHRYPFLLVDRCEEYKPSESIVGIKCVTVNEPFFQGHFPDYPVMPGVLLIE 74

Query: 72  GMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQT   + +     D      + MS D  RFR PV PGD +   V  VR+R D++KF 
Sbjct: 75  AMAQTGAVLMSKSLEVDTAGKAIFFMSADNCRFRSPVRPGDVVRMPVRVVRHRGDVFKFA 134

Query: 131 CCAKVENTVVAEAEICAMVMH 151
             A V + V AEAE  AMV+ 
Sbjct: 135 GQALVGDKVAAEAEFAAMVVE 155


>gi|16759217|ref|NP_454834.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16763617|ref|NP_459232.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29140767|ref|NP_804109.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56412500|ref|YP_149575.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161504654|ref|YP_001571766.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161612600|ref|YP_001586565.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553359|ref|ZP_02347108.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990114|ref|ZP_02571214.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230536|ref|ZP_02655594.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168235007|ref|ZP_02660065.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244995|ref|ZP_02669927.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168264635|ref|ZP_02686608.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168464208|ref|ZP_02698111.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168823103|ref|ZP_02835103.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194446275|ref|YP_002039467.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451218|ref|YP_002044217.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469903|ref|ZP_03075887.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194738401|ref|YP_002113250.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197248328|ref|YP_002145232.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262248|ref|ZP_03162322.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197361435|ref|YP_002141071.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198245833|ref|YP_002214188.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388350|ref|ZP_03214962.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204927047|ref|ZP_03218249.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205351564|ref|YP_002225365.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207855745|ref|YP_002242396.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213163128|ref|ZP_03348838.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425953|ref|ZP_03358703.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580732|ref|ZP_03362558.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213609717|ref|ZP_03369543.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213648455|ref|ZP_03378508.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213857934|ref|ZP_03384905.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582075|ref|YP_002635873.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238911293|ref|ZP_04655130.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289807003|ref|ZP_06537632.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289825705|ref|ZP_06544873.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|60392271|sp|P0A1H9|FABZ_SALTY RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|60392272|sp|P0A1I0|FABZ_SALTI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|62286728|sp|Q5PD74|FABZ_SALPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91206648|sp|Q57T28|FABZ_SALCH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044397|sp|A9MPI1|FABZ_SALAR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044398|sp|A9N0T0|FABZ_SALPB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700255|sp|B5F8U1|FABZ_SALA4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700256|sp|B5FJ27|FABZ_SALDC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700809|sp|B5R419|FABZ_SALEP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700810|sp|B5RHG5|FABZ_SALG2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700811|sp|B4TK55|FABZ_SALHS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700812|sp|B4SV09|FABZ_SALNS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700813|sp|B5BAN7|FABZ_SALPK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700814|sp|B4TYE0|FABZ_SALSV RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788936|sp|C0Q6K3|FABZ_SALPC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|25319418|pir||AE0530 (3R)-hydroxymyristol acyl carrier protein dehydrase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16418732|gb|AAL19191.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16501508|emb|CAD08685.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29136391|gb|AAO67958.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56126757|gb|AAV76263.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|160866001|gb|ABX22624.1| hypothetical protein SARI_02775 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161361964|gb|ABX65732.1| hypothetical protein SPAB_00291 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404938|gb|ACF65160.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194409522|gb|ACF69741.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194456267|gb|EDX45106.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194713903|gb|ACF93124.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195632581|gb|EDX51035.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197092911|emb|CAR58340.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197212031|gb|ACH49428.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197240503|gb|EDY23123.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197291849|gb|EDY31199.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940349|gb|ACH77682.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199605448|gb|EDZ03993.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204323712|gb|EDZ08907.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205271345|emb|CAR36138.1| 3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205322195|gb|EDZ10034.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205331320|gb|EDZ18084.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335094|gb|EDZ21858.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336206|gb|EDZ22970.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205340612|gb|EDZ27376.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205346923|gb|EDZ33554.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206707548|emb|CAR31822.1| 3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|224466602|gb|ACN44432.1| (3R)-hydroxymyristoyl ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261245459|emb|CBG23249.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|301156854|emb|CBW16330.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312911197|dbj|BAJ35171.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320084481|emb|CBY94274.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321222189|gb|EFX47261.1| 3R-hydroxymyristoyl-acyl carrier protein dehydratase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322616051|gb|EFY12968.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620834|gb|EFY17694.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623815|gb|EFY20652.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322627263|gb|EFY24054.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322630570|gb|EFY27334.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322638212|gb|EFY34913.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640697|gb|EFY37348.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645519|gb|EFY42046.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648187|gb|EFY44654.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322657138|gb|EFY53421.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657508|gb|EFY53780.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663828|gb|EFY60028.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322666661|gb|EFY62839.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672181|gb|EFY68293.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676508|gb|EFY72579.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679400|gb|EFY75445.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686273|gb|EFY82257.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323193453|gb|EFZ78661.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323197525|gb|EFZ82660.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201206|gb|EFZ86275.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209601|gb|EFZ94534.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212147|gb|EFZ96971.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216452|gb|EGA01178.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323223358|gb|EGA07693.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225919|gb|EGA10139.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228540|gb|EGA12669.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236847|gb|EGA20923.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239653|gb|EGA23700.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242300|gb|EGA26329.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249962|gb|EGA33858.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252392|gb|EGA36243.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255675|gb|EGA39428.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262888|gb|EGA46438.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323265374|gb|EGA48870.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271839|gb|EGA55257.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|332987179|gb|AEF06162.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 151

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 91/149 (61%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTNTHTLQIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P++PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|221632678|ref|YP_002521899.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermomicrobium roseum DSM 5159]
 gi|254788537|sp|B9KYV7|FABZ_THERP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|221157153|gb|ACM06280.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermomicrobium roseum DSM 5159]
          Length = 149

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 90/147 (61%), Gaps = 9/147 (6%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++   +PHRYPFLLVD+++ I+  + A+GIKNVT NEP F+GHFPG PVMPGVLI+E +A
Sbjct: 6   QIQEIIPHRYPFLLVDRIIEIEWGQRAVGIKNVTVNEPFFVGHFPGNPVMPGVLIIEALA 65

Query: 75  QTAGAICAIHNGFDQY--APPYLMSIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKFQ 130
           Q  GA+  +  G  QY     +   ID  RF++PV PGD  RLE  + KVR  +     +
Sbjct: 66  QV-GAVALL--GHPQYRDKTAFFAGIDGVRFKRPVRPGDTLRLEVQIGKVRRNIGTGTGR 122

Query: 131 CCAKVENTVVAEAEICAMVMHEKKEKN 157
             A V+  + AE EI   ++  +  + 
Sbjct: 123 --ATVDGELAAEGEILFALLDPEAART 147


>gi|159898865|ref|YP_001545112.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|226700475|sp|A9AYK6|FABZ_HERA2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|159891904|gb|ABX04984.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 141

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 89/133 (66%), Gaps = 9/133 (6%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           +++  LPHR PFLLVD+++ I+    A+G+KNVT NEP F+GHFPGRPVMPGVLI+E +A
Sbjct: 6   DILAILPHRPPFLLVDRILEIEDGLRAVGLKNVTMNEPFFVGHFPGRPVMPGVLIVEALA 65

Query: 75  QTAGAICAIHNGFDQYAPPYLM--SIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKFQ 130
           Q  GA+  +     +Y    +M   ID  RF++PV PGD  +LE  ++K+R R+   K Q
Sbjct: 66  QV-GAVIILRQ--PEYVGKIVMFAGIDDFRFKRPVTPGDTLKLEVSLDKMRRRI--GKGQ 120

Query: 131 CCAKVENTVVAEA 143
             A V+ TVVAE 
Sbjct: 121 AKATVDGTVVAEG 133


>gi|304388983|ref|ZP_07371030.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           meningitidis ATCC 13091]
 gi|304337117|gb|EFM03304.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           meningitidis ATCC 13091]
          Length = 149

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFESMKTLTAIKNVTINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAIIMCA 145


>gi|148657230|ref|YP_001277435.1| (3R)-hydroxymyristoyl-ACP dehydratase [Roseiflexus sp. RS-1]
 gi|189044396|sp|A5UXY2|FABZ_ROSS1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|148569340|gb|ABQ91485.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Roseiflexus sp.
           RS-1]
          Length = 143

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+M  +PHRYPFLL+D+++ ++  + A+G K VT  EP+F GHFP RP+MPGVLI+E 
Sbjct: 4   IQEIMAIIPHRYPFLLIDRILELEPGQRAVGEKLVTIGEPYFQGHFPNRPIMPGVLIVEA 63

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           +AQT GA+ A+    ++    +   ID  RFRKPV+PGD L   V   + R  + K    
Sbjct: 64  LAQT-GAVAALSLPENRGKMAFFAGIDGVRFRKPVYPGDTLRLEVRFDKMRRGIGKGTGV 122

Query: 133 AKVENTVVAEAEICAMVMHE 152
           A V   +V E E+   +  E
Sbjct: 123 ATVNGQLVCEGELMFALSSE 142


>gi|222100751|ref|YP_002535319.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Thermotoga neapolitana DSM 4359]
 gi|254788536|sp|B9KAH0|FABZ_THENN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|221573141|gb|ACM23953.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Thermotoga neapolitana DSM 4359]
          Length = 137

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 85/131 (64%), Gaps = 5/131 (3%)

Query: 19  FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78
            LPHRYPFLLVD V+  + ++  +  KN++ ++P F GHFP  P+ PGVLI+EG+AQTAG
Sbjct: 9   ILPHRYPFLLVDGVIE-ESEDRIVAFKNISISDPVFQGHFPEYPIYPGVLIIEGLAQTAG 67

Query: 79  AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENT 138
            +       D    P  + ID+ARF+K V PGD+L Y V K+  ++   + +  AKVENT
Sbjct: 68  ILLL----KDLEGIPLFLGIDEARFKKEVRPGDKLIYEVKKIGEKLGTVQVEGVAKVENT 123

Query: 139 VVAEAEICAMV 149
           +VA+A++   V
Sbjct: 124 IVAKAKLLLGV 134


>gi|77457339|ref|YP_346844.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas fluorescens
           Pf0-1]
 gi|91206643|sp|Q3KHA1|FABZ_PSEPF RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|77381342|gb|ABA72855.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Pseudomonas fluorescens Pf0-1]
          Length = 146

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 85/145 (58%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVELDTEGKRIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLILEAKFISCK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF+C A V+   V  AE ICA
Sbjct: 118 RQIWKFECQASVDGKPVCSAEIICA 142


>gi|319776683|ref|YP_004139171.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           influenzae F3047]
 gi|317451274|emb|CBY87508.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           influenzae F3047]
          Length = 134

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/132 (43%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +AQ 
Sbjct: 1   MTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALAQA 60

Query: 77  AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVE 136
            G +    +        Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A V 
Sbjct: 61  MGILAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKKRRGITAFTGVATVN 120

Query: 137 NTVVAEAEI-CA 147
             +  EA++ CA
Sbjct: 121 GEIACEAKLMCA 132


>gi|219871435|ref|YP_002475810.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus parasuis SH0165]
 gi|219691639|gb|ACL32862.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase [Haemophilus
           parasuis SH0165]
          Length = 155

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+VV+ +  +    +KNV+ NEP F GHFP +PV PGVLILE
Sbjct: 16  EVTEIMEMLPHRYPFLLVDRVVDFEEGKWLRAVKNVSVNEPCFTGHFPNQPVFPGVLILE 75

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G        Y  ++D ARF++PV PGD++   V  V+ R  +  F 
Sbjct: 76  AMAQATGVLAIKSYGKLKDNELYYFAAVDNARFKRPVVPGDQMIIEVTFVKERRGITAFT 135

Query: 131 CCAKVENTVVAEAEI-CA 147
               V++T+V EA++ CA
Sbjct: 136 GKVYVDDTLVCEADLMCA 153


>gi|224437062|ref|ZP_03658043.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter cinaedi CCUG
           18818]
 gi|313143534|ref|ZP_07805727.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter cinaedi CCUG 18818]
 gi|313128565|gb|EFR46182.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Helicobacter cinaedi CCUG 18818]
          Length = 163

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 12/150 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-------GIKNVTFNEPHFMGHFPGRPVM 64
           D+ ++ + LPHRYP LLVD+VV + R+ +           KNVT NE  F+GHFP +P+ 
Sbjct: 9   DVEKIRQILPHRYPMLLVDRVVELVRNSNDTKPDGYIKAYKNVTINEEVFLGHFPSKPIY 68

Query: 65  PGVLILEGMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNK 119
           PGV+ +EGMAQ  G +  +    D  A       Y M+ID  +FR PV PGDRL Y +  
Sbjct: 69  PGVMQIEGMAQAGGLLAFVSMFGDNVAEAENKIVYFMTIDNVKFRIPVVPGDRLVYELKV 128

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMV 149
           ++++  +W+    A V++ +V+EAE+ AM+
Sbjct: 129 LKHKGSVWQLGAKAFVDDKLVSEAELKAMI 158


>gi|171914458|ref|ZP_02929928.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Verrucomicrobium spinosum DSM 4136]
          Length = 437

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 88/141 (62%), Gaps = 5/141 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+M+ LPHRYPFL+VD++V  + +    G+KNVT NEP F GHFPG P+MPGVL LE
Sbjct: 298 NINEVMKILPHRYPFLMVDRIVGFEGESKCTGVKNVTINEPFFQGHFPGHPIMPGVLQLE 357

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRL--EYHVNKVRNRVDLWKF 129
            MAQ A +I  +    +Q    Y MS D  ++R+PV PGD L  E  + KV+  +   + 
Sbjct: 358 AMAQVA-SIQLLRAPENQGKIGYFMSADNVKWRRPVLPGDILFIETELLKVKRSIGTARG 416

Query: 130 QCCAKVENTVVAEAEICAMVM 150
           +C   V   VV+EA++   +M
Sbjct: 417 RCI--VNGQVVSEADLMFALM 435


>gi|119477113|ref|ZP_01617349.1| (3R)-hydroxymyristoyl ACP dehydratase [marine gamma proteobacterium
           HTCC2143]
 gi|119449476|gb|EAW30714.1| (3R)-hydroxymyristoyl ACP dehydratase [marine gamma proteobacterium
           HTCC2143]
          Length = 145

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 5/139 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+  +LPHR+PFLLVD+V  + + ES I IKNV+ NEP F GHFP   VMPGVLI+E 
Sbjct: 4   IKEIQEYLPHRFPFLLVDRVEEVTKGESIIAIKNVSINEPFFQGHFPQVAVMPGVLIVEA 63

Query: 73  MAQTAGAICAIHNGFDQYAPPYL---MSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           MAQ A AI          A   L   +  D  RFR+ V PGD+L  +V  V +R  +WKF
Sbjct: 64  MAQ-AAAILGFKTQDKTPADGSLYLFVGADNVRFRRQVVPGDQLLLNVAYVSDRRGIWKF 122

Query: 130 QCCAKVENTVVAEAE-ICA 147
           +C + V+  + A A+ ICA
Sbjct: 123 KCTSYVDKELAASADIICA 141


>gi|189220142|ref|YP_001940782.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Methylacidiphilum infernorum V4]
 gi|189187000|gb|ACD84185.1| UDP-3-O-acyl-N-acetylglucosamine deacetylase and
           (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Methylacidiphilum infernorum V4]
          Length = 436

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 80/136 (58%), Gaps = 1/136 (0%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A DI E+M+ LPHRYPFL++D+V+  Q D  AIG K VT NE +F GHFPG P+MPGVL 
Sbjct: 295 ALDINEVMKILPHRYPFLMLDRVLGFQDDVKAIGQKAVTMNEAYFQGHFPGHPIMPGVLQ 354

Query: 70  LEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           +E MAQ A +I  +    +     Y MS DK +FRKPV PGD L   V   + R  + K 
Sbjct: 355 IEAMAQLA-SILLLRKAGNAGKLGYFMSADKVKFRKPVMPGDTLIIEVEMTKARGKIGKA 413

Query: 130 QCCAKVENTVVAEAEI 145
                V    V E E+
Sbjct: 414 FGKCYVNKETVCEGEL 429


>gi|170761576|ref|YP_001788940.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum A3
           str. Loch Maree]
 gi|190359380|sp|B1KU67|FABZ_CLOBM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|169408565|gb|ACA56976.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 144

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 87/140 (62%), Gaps = 5/140 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLVDKITELEEGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKF 129
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD  RL   + K++    + K 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLRLSIELTKIKGVAGVGK- 123

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A V+  VVAEAE+  ++
Sbjct: 124 -AVATVDGKVVAEAELLFVI 142


>gi|220932592|ref|YP_002509500.1| 3-hydroxydecanoyl-(acyl-carrier-protein)
           dehydratase;3-hydroxyacyl-(acyl-carrier-protein)
           dehydratase [Halothermothrix orenii H 168]
 gi|219993902|gb|ACL70505.1| 3-hydroxydecanoyl-(acyl-carrier-protein)
           dehydratase;3-hydroxyacyl-(acyl-carrier-protein)
           dehydratase [Halothermothrix orenii H 168]
          Length = 143

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (58%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++   LPHR+PFLLVD++  ++  +  +G KNVT NE  F GH+PG P+MPGVLI+E 
Sbjct: 4   IQDIKNILPHRFPFLLVDRITELEPGKKVVGFKNVTVNEEFFQGHYPGHPIMPGVLIIEA 63

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ  G +       D+   P    IDKARFR+ V PGDRL      ++ R  + K    
Sbjct: 64  MAQVGGFLMMYSVDDDEEKIPLFAGIDKARFRRNVVPGDRLRIEAEVIKLRGRIGKIAAK 123

Query: 133 AKVENTVVAEAEIC 146
             VE+ + AEAE+ 
Sbjct: 124 GFVEDELAAEAELM 137


>gi|317121028|ref|YP_004101031.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Thermaerobacter
           marianensis DSM 12885]
 gi|315591008|gb|ADU50304.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Thermaerobacter
           marianensis DSM 12885]
          Length = 151

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 3/138 (2%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A D+ +++  LPHRYPFLLVD+++ ++    A+G K V+ NEP+F GHFPGRP+MPGVLI
Sbjct: 10  AMDVQDILSVLPHRYPFLLVDRILELEPGRRAVGRKCVSANEPYFQGHFPGRPIMPGVLI 69

Query: 70  LEGMAQT-AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           LE MAQ  A A+ ++     + A       D+ R+R+PV PGD LE  V  +  R  + K
Sbjct: 70  LEAMAQVGAAAVLSMPENRGRLA--LFAGADRVRWRRPVIPGDCLEIEVEIIAMRGPIGK 127

Query: 129 FQCCAKVENTVVAEAEIC 146
            +  A V+  + AEAE+ 
Sbjct: 128 GRARATVDGELAAEAELS 145


>gi|289523525|ref|ZP_06440379.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503217|gb|EFD24381.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 155

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 91/148 (61%), Gaps = 6/148 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M+ LPHRYPFLLVD+++ +  +   +G+KNVT NEP F GHFP  PVMPGVL+LE
Sbjct: 12  DIHKIMKCLPHRYPFLLVDRILELG-EGKIVGLKNVTINEPFFQGHFPDEPVMPGVLVLE 70

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRL--EYHVNKVRNRVDLWKF 129
            M Q A  +  +     Q    YL  +DKARFR+PV PGD+L  E  V K+R RV   + 
Sbjct: 71  AMGQVAAMMIVLRPDM-QGMVTYLTGVDKARFRRPVCPGDQLITEALVCKLRGRV--GQV 127

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKEKN 157
           +  A+V + + AEA    +V     +K 
Sbjct: 128 KATARVNDEMAAEATFSFVVAKNLLQKG 155


>gi|312897547|ref|ZP_07756967.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Megasphaera micronuciformis F0359]
 gi|310621399|gb|EFQ04939.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Megasphaera micronuciformis F0359]
          Length = 146

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 1/144 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ ++M  LPHRYP LLVD++  ++  + A+GIKN TFNE  F GHFPG+PVMPGVL+ E
Sbjct: 4   EVTDIMEILPHRYPMLLVDRITELEPMKYAVGIKNATFNEQFFQGHFPGKPVMPGVLLAE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +  ++   ++   P+   IDK RFR PV PGD++    + ++ +  + K   
Sbjct: 64  AMAQV-GGVALLYPEENRGLIPFFTGIDKLRFRHPVRPGDQVIMRADIIKIKGRMGKVTA 122

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
             +V +TV AE E    +M  +K+
Sbjct: 123 QCRVGDTVCAEGEYLFALMPGQKK 146


>gi|327480165|gb|AEA83475.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas stutzeri DSM
           4166]
          Length = 146

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 83/140 (59%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +   +   KNVT NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVTELDVEAKRVRAYKNVTINEPFFNGHFPQHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG +     G         Y +  DK RFR+PV PGD+L    + + N+  +WK
Sbjct: 63  EAMAQAAGLLGFKMMGVKPSDGTLYYFVGSDKLRFRQPVRPGDQLVLEADFLSNKRGIWK 122

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F C A V+   V  AE ICA
Sbjct: 123 FDCRATVDGKPVCSAEIICA 142


>gi|82701800|ref|YP_411366.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosospira multiformis ATCC 25196]
 gi|91206635|sp|Q2YB97|FABZ_NITMU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|82409865|gb|ABB73974.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Nitrosospira
           multiformis ATCC 25196]
          Length = 146

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++++LPHRYP LLVD+V+  +  +S   +KNVT NEP F GHFP  PVMPGVL++E
Sbjct: 2   DIHEILKYLPHRYPLLLVDRVLAFEPGKSLTALKNVTINEPFFTGHFPHHPVMPGVLVIE 61

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +    +    D+ +  Y + ID ARF++PV PGD+L      ++ R+ +WK+
Sbjct: 62  ALAQAAALLTLKTSNVEADENSIYYFVGIDNARFKRPVEPGDQLILKATVLKERIGIWKY 121

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A+V+  V AEAE+   V
Sbjct: 122 AARAEVDGRVAAEAELMCTV 141


>gi|94269141|ref|ZP_01291379.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium MLMS-1]
 gi|93451327|gb|EAT02201.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [delta
           proteobacterium MLMS-1]
          Length = 141

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 86/138 (62%), Gaps = 3/138 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++  LPHRYP ++VD++V ++      G KNV+ NE  F GHFPG PVMPGVL+LE
Sbjct: 2   DIKEILAKLPHRYPMVMVDRIVALEDGVRIRGYKNVSINENFFQGHFPGEPVMPGVLMLE 61

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           GMAQT GA+ A  +  +  A    Y   +D  +FR+ V PGD+L Y +  ++ +   W  
Sbjct: 62  GMAQT-GALLAYLSASESTAGKLVYFAGLDDVKFRRKVIPGDQLHYDLQVLKRKSRFWVM 120

Query: 130 QCCAKVENTVVAEAEICA 147
              A V++ +VAEA++ A
Sbjct: 121 AGKAYVDDALVAEAQLMA 138


>gi|86157511|ref|YP_464296.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|109828895|sp|Q2IPX8|FABZ_ANADE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|85774022|gb|ABC80859.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 156

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 89/145 (61%), Gaps = 2/145 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+V +   LPHR PFLLVD+VV  +     + +K VT NEP F GHFP +PVMPGVLILE
Sbjct: 12  DVVGIQELLPHRPPFLLVDRVVEFEAHRRLVALKGVTMNEPFFQGHFPAQPVMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +  +    D+      YLM ID ARFR+PV PGDRLE  V   + +  +WK 
Sbjct: 72  ALAQAAALLATMSLKPDEVKDKITYLMGIDGARFRRPVVPGDRLELEVEVTKQKGAVWKQ 131

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
              A+V+  VVAEAE  AM+   ++
Sbjct: 132 TGVARVDGQVVAEAEFMAMLADRER 156


>gi|332799998|ref|YP_004461497.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Tepidanaerobacter sp. Re1]
 gi|332697733|gb|AEE92190.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Tepidanaerobacter sp. Re1]
          Length = 142

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 86/135 (63%), Gaps = 3/135 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E+ + +PHRYPFLLVD+++ ++  + A+G+KNV+ NE  F GHFPG+P+MPGVLI+E
Sbjct: 3   SIEEIKKIIPHRYPFLLVDRILELEEGKRAVGVKNVSANEEFFQGHFPGKPIMPGVLIVE 62

Query: 72  GMAQTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ    AI +  N  D+ A      ID+ RF++ V PGD+L   V   + +  + K +
Sbjct: 63  ALAQVGACAILSSENNRDKIA--LFAGIDRMRFKRQVIPGDQLRLEVELTKIKGPIGKGK 120

Query: 131 CCAKVENTVVAEAEI 145
             A V+  +VAE E+
Sbjct: 121 AKATVDGEIVAEGEL 135


>gi|329893781|ref|ZP_08269869.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [gamma
           proteobacterium IMCC3088]
 gi|328923504|gb|EGG30818.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [gamma
           proteobacterium IMCC3088]
          Length = 143

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ ++LPHRYPFLLVD+VV++   ES    KN+T NE  F GHFP  PV PGVL++E
Sbjct: 3   DIHEVRKYLPHRYPFLLVDRVVDLVPGESITAYKNLTINEEFFQGHFPQEPVFPGVLLVE 62

Query: 72  GMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ AG      ++   +  +  Y +  D  RF++P  PGDR+  H   V  +  +WKF
Sbjct: 63  AMAQAAGILGFVTMNKTPEDGSIYYFVGADNLRFKRPCVPGDRVMLHARIVSEKRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
           +  A VE    A A I CA
Sbjct: 123 EVSADVEGQKAASATILCA 141


>gi|323128547|gb|ADX15977.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326621931|gb|EGE28276.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326626591|gb|EGE32934.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 157

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P++PGVLILE
Sbjct: 15  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPILPGVLILE 74

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 75  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 134

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 135 GVALVDGKVVCEATMMCA 152


>gi|291288195|ref|YP_003505011.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290885355|gb|ADD69055.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 145

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 88/142 (61%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+M+ LPHR+PFLLVD+V+ I  D+    +KNV+ NEP F GHFPG PVMPGVLI+E
Sbjct: 3   DIKEIMKILPHRFPFLLVDRVLEITPDKIR-AVKNVSMNEPFFQGHFPGHPVMPGVLIVE 61

Query: 72  GMAQTAGAICAIHNGFDQYAP----PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ AG      +G D  AP       M +D  +FRK V PGD+LE  V  +R +  + 
Sbjct: 62  ALAQCAGIHTISTSGED--APENMLTLFMGVDGVKFRKQVVPGDQLEMVVTIIRKKGKIV 119

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K +  A V+  +  E E+ AM+
Sbjct: 120 KAKGEAFVDGQLACEGELTAMM 141


>gi|282898366|ref|ZP_06306357.1| Beta-hydroxyacyl-(acyl-carrier-like protein) dehydratase FabZ
           [Raphidiopsis brookii D9]
 gi|281196897|gb|EFA71802.1| Beta-hydroxyacyl-(acyl-carrier-like protein) dehydratase FabZ
           [Raphidiopsis brookii D9]
          Length = 171

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 88/147 (59%), Gaps = 4/147 (2%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           I+  A      I E+ + +PHRYPFLLVDK+V+    + A+GIKNVTFNEP F GHFPGR
Sbjct: 22  INTSATKTTFTIEEIQQLIPHRYPFLLVDKIVDYIPGKLAVGIKNVTFNEPQFQGHFPGR 81

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN--K 119
            +MPGVLI+E MAQ  G + +      +    ++  IDK RFR+ V PGD+L   V    
Sbjct: 82  SLMPGVLIVEAMAQVGGVVMSQMPNMPEGLFVFV-GIDKVRFRRQVVPGDQLIMTVELLS 140

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEIC 146
           V+ R    K Q  A+V+  + AE E+ 
Sbjct: 141 VKQR-RFGKMQGRAEVDGNLAAEGELM 166


>gi|283853286|ref|ZP_06370536.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio sp. FW1012B]
 gi|283571326|gb|EFC19336.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio sp. FW1012B]
          Length = 154

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 5/143 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+   LPHRYPFLLVD+V+      S   +KNVT NEP F GHFPG PVMPG+LILE 
Sbjct: 11  ITEIFDLLPHRYPFLLVDRVLEYDPGVSITALKNVTINEPFFQGHFPGVPVMPGMLILEA 70

Query: 73  MAQTAGAICAIHNGFDQYAPPYLM---SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           +AQ  G +  +    D      +     ++KA+FR+PV PGD+L      ++ R+ L K 
Sbjct: 71  LAQAGGIL--VSKSLDGPLGDRIFMFTGVEKAKFRRPVTPGDQLVLRCFDLKRRMTLCKM 128

Query: 130 QCCAKVENTVVAEAEICAMVMHE 152
           +  A V+  VVAEA++ A V+ +
Sbjct: 129 RAQASVDGKVVAEADLSAAVVDK 151


>gi|317130720|ref|YP_004097002.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475668|gb|ADU32271.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cellulosilyticus DSM 2522]
          Length = 143

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E+   +PHRYPFLLVD+++ ++  + A+GIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   SIEEIKEIIPHRYPFLLVDRILEVEEGQRAVGIKNVTANEEFFNGHFPDYPVMPGVLIIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF+  V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDGCRFKGQVKPGDQLRLEVEMTRLRGKIGKGRA 121

Query: 132 CAKVENTVVAEAEI 145
            A VE   VAEAEI
Sbjct: 122 VASVEGKTVAEAEI 135


>gi|257455337|ref|ZP_05620572.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enhydrobacter aerosaccus SK60]
 gi|257447299|gb|EEV22307.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Enhydrobacter aerosaccus SK60]
          Length = 171

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 6/135 (4%)

Query: 16  LMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQ 75
           L  +LPHRYPF+L+D+V  ++ +E   G+KN+T NEP F GHFP  P+MPGVL++E MAQ
Sbjct: 28  LRDYLPHRYPFMLLDRVTAVKPNEWITGLKNITINEPFFNGHFPEEPIMPGVLMIEAMAQ 87

Query: 76  TAGAICAIHNGF---DQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            AG +  I       D Y   YL + +DK RF++ V PGD+L     K   R  ++KF C
Sbjct: 88  VAGVLGFISKNVKPRDGYI--YLFAGVDKVRFKRQVIPGDQLILRAEKTMERHSIYKFSC 145

Query: 132 CAKVENTVVAEAEIC 146
            A V + + A AEI 
Sbjct: 146 TACVGDELAASAEIT 160


>gi|294012392|ref|YP_003545852.1| 3R-hydroxymyristoyl ACP dehydrase [Sphingobium japonicum UT26S]
 gi|292675722|dbj|BAI97240.1| 3R-hydroxymyristoyl ACP dehydrase [Sphingobium japonicum UT26S]
          Length = 159

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 86/145 (59%), Gaps = 1/145 (0%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           A +   DI  +M  LPHRYP LLVD+V+++  + +   +K V+ NE  F GHFPGRP+MP
Sbjct: 9   AAVGPIDIRGVMAALPHRYPMLLVDRVISLVPNSTIHAVKAVSINEGFFQGHFPGRPIMP 68

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           GVLI+E MAQ AG +              Y MSID A+FR PV PG  L+ HV+ V+ R 
Sbjct: 69  GVLIVEAMAQAAGVLTVETMDLRGSGKLVYFMSIDGAKFRNPVEPGCLLDLHVDLVQIRG 128

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            + KF   A VE  + AEA   AM+
Sbjct: 129 RVCKFTGKAMVEGKLCAEASFVAMI 153


>gi|253574274|ref|ZP_04851616.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846751|gb|EES74757.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 140

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (62%), Gaps = 1/131 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++   LPHR PFLLVD+++ ++  + A+GIKNVT NEP F GHFPG PVMPGVLI E +A
Sbjct: 6   QIQEILPHRPPFLLVDRIIELEEGKRAVGIKNVTMNEPFFTGHFPGYPVMPGVLITEALA 65

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  GA+  ++   ++    +L  +D  RFR  V PGD L   V   R +  + K    AK
Sbjct: 66  QV-GAVAILNVEENRGKIGFLAGLDGFRFRGQVVPGDTLRLEVEVTRMKGSIGKGHAIAK 124

Query: 135 VENTVVAEAEI 145
           V++ +VAE +I
Sbjct: 125 VDDKIVAEGDI 135


>gi|294671231|ref|ZP_06736084.1| hypothetical protein NEIELOOT_02941 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307059|gb|EFE48302.1| hypothetical protein NEIELOOT_02941 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 171

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 7/150 (4%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++A++I E+   LPHR+PFLL+D+V+  +  +S   IKNVTFNE  F GHFP  PVMPGV
Sbjct: 24  IEAREIQEI---LPHRFPFLLLDRVIAAKPGKSLTAIKNVTFNEQFFQGHFPESPVMPGV 80

Query: 68  LILEGMAQTAGAICAIHNGFDQYAP---PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           LI+E MAQ  G +  +  G  +           +D  RF++ V PGDRL++ V  + ++ 
Sbjct: 81  LIVEAMAQACGVLAVLSQGSTKRRENEITLFAGLDNVRFKRQVIPGDRLQFEVELLAHKR 140

Query: 125 DLWKFQCCAKVENTVVAEAEI-CAMVMHEK 153
            + KF   AKV+  +  EA I CA  + EK
Sbjct: 141 GIGKFNAVAKVDGELACEATIMCAQRIVEK 170


>gi|228988490|ref|ZP_04148580.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228771258|gb|EEM19734.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 144

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVDKV+ ++  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDKVLEVEEGKRAIGIKNVTANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGSIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +  E EI    + +KKE
Sbjct: 122 IATVDGEIACETEIT-FALGDKKE 144


>gi|189182979|ref|YP_001936764.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Orientia
           tsutsugamushi str. Ikeda]
 gi|189179750|dbj|BAG39530.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 161

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 88/147 (59%), Gaps = 9/147 (6%)

Query: 6   ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMP 65
           + L  +DI+   R +PHRYPFL++DKV+ ++  +  IGIKNVT NEP F GHFP  PVMP
Sbjct: 12  SVLSTQDII---RIIPHRYPFLMIDKVIKLEPGQEIIGIKNVTANEPQFAGHFPNNPVMP 68

Query: 66  GVLILEGMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRL--EYHVNKVRN 122
           GVL +E MAQ +  + A    FD      YL++I+K +FRK +  GD +     +++  N
Sbjct: 69  GVLTIESMAQLSAILVAKTIKFDTNGKIFYLITIEKVKFRKIITSGDTMVITSKISQAYN 128

Query: 123 RVDLWKFQCCAKVE--NTVVAEAEICA 147
           +  +WKF    K++  N + AE    A
Sbjct: 129 K-HIWKFNAEVKIDGTNNLAAEGTFTA 154


>gi|146281922|ref|YP_001172075.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas stutzeri A1501]
 gi|158514172|sp|A4VJT2|FABZ_PSEU5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|145570127|gb|ABP79233.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudomonas stutzeri A1501]
          Length = 145

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 83/140 (59%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +   +   KNVT NEP F GHFP  P+MPGVLI+
Sbjct: 2   DINEIREYLPHRYPFLLVDRVTELDVEAKRVRAYKNVTINEPFFNGHFPQHPIMPGVLII 61

Query: 71  EGMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG +     G         Y +  DK RFR+PV PGD+L    + + N+  +WK
Sbjct: 62  EAMAQAAGLLGFKMMGVKPSDGTLYYFVGSDKLRFRQPVRPGDQLVLEADFLSNKRGIWK 121

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F C A V+   V  AE ICA
Sbjct: 122 FDCRATVDGRPVCSAEIICA 141


>gi|330721097|gb|EGG99232.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [gamma
           proteobacterium IMCC2047]
          Length = 145

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 83/138 (60%), Gaps = 3/138 (2%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+  +LPHRYPFLLVD+VV ++  +S +  KNVT NE  F GHFP  PVMPGVLI+E 
Sbjct: 4   IDEIREYLPHRYPFLLVDRVVEMELGKSIVAYKNVTVNEEFFNGHFPDTPVMPGVLIIEA 63

Query: 73  MAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           MAQ AG +    +       +  Y +  +K RF++PV PGD+L      +  +  +WKF 
Sbjct: 64  MAQAAGILGFKTMDKKPSDGSIYYFVGSEKLRFKRPVVPGDQLRLEATIMTEKRGIWKFD 123

Query: 131 CCAKVENTVVAEA-EICA 147
           C A VE  +V+    ICA
Sbjct: 124 CKATVEGELVSSGIIICA 141


>gi|56459942|ref|YP_155223.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Idiomarina loihiensis L2TR]
 gi|62286745|sp|Q5R0Z2|FABZ_IDILO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56178952|gb|AAV81674.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Idiomarina loihiensis L2TR]
          Length = 151

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 84/142 (59%), Gaps = 9/142 (6%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  LPHRYPFLL+D+V+     +S   IKNVTFNEP F GHFP +P+ PGVL+LE
Sbjct: 9   DIQGVLDLLPHRYPFLLIDRVIETNSKDSLHAIKNVTFNEPMFNGHFPAKPIFPGVLLLE 68

Query: 72  GMAQTAGAIC-----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            +AQ  G +      +  N  D Y       ID ARF++ V PGD +++ V   + R  +
Sbjct: 69  AIAQACGLLGFKITESKKNANDLY---LFAGIDNARFKRQVIPGDTVDFFVTFEKERRGI 125

Query: 127 WKFQCCAKVENTVVAEAE-ICA 147
           WKF   A+V+  V   AE ICA
Sbjct: 126 WKFTGRAEVDGDVACTAEIICA 147


>gi|15829436|ref|NP_308209.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. Sakai]
 gi|13359638|dbj|BAB33605.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O157:H7 str. Sakai]
          Length = 151

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTNTHTLQIEEILEL---LPHRFPFLLVDRVLDFEEGRLLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|328949872|ref|YP_004367207.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450196|gb|AEB11097.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase
           [Marinithermus hydrothermalis DSM 14884]
          Length = 142

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I E+M+ LPHRYPFLLVD+V+    D+    IKNVT NEPHF GHFP  PVMPGVLILE
Sbjct: 2   NITEIMQILPHRYPFLLVDRVLEAD-DKRFKAIKNVTMNEPHFQGHFPDYPVMPGVLILE 60

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ + A+      F      +L+ +D+ RF++ V PGD L      +  R  L K + 
Sbjct: 61  AMAQASVAVVVHQPEFKPGGLVFLVGVDRVRFKRQVVPGDTLVMEGELLTYRRGLGKVRV 120

Query: 132 CAKVENTVVAEAEICAMV 149
            A V   + A+AEI  +V
Sbjct: 121 RATVNEELAAQAEISFVV 138


>gi|262038009|ref|ZP_06011421.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptotrichia goodfellowii F0264]
 gi|261747962|gb|EEY35389.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Leptotrichia goodfellowii F0264]
          Length = 141

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 82/133 (61%), Gaps = 5/133 (3%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++M+ LPHRYPFLLVDKV+     E+ + IKNVT NE  F GHFPG+PVMPGVL +E 
Sbjct: 7   IEDIMKILPHRYPFLLVDKVIEKNGTETLVAIKNVTMNEEFFNGHFPGKPVMPGVLQVEA 66

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCC 132
           MAQ  G +       +    P  MSIDK +FRK V PGD+L   V KV+ + ++   +  
Sbjct: 67  MAQAVGLLM-----LEPGKIPLFMSIDKCKFRKGVVPGDQLRIEVEKVKVKRNVIVAKGK 121

Query: 133 AKVENTVVAEAEI 145
             V+  V  EA++
Sbjct: 122 CTVDGAVTCEADL 134


>gi|332967722|gb|EGK06829.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Kingella
           kingae ATCC 23330]
          Length = 149

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 89/142 (62%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPF+L+D++   +  +S   +KNV+ NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFMLLDRITAFESGKSLTALKNVSMNEPQFTGHFPDFPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  GA+  +  G       Y  + ID ARF++ V PGD+L + +  ++++  +
Sbjct: 64  LIIEAMAQACGALAILTEGGRNPDEIYFFAGIDNARFKRQVIPGDQLTFQIELLQSKRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   A V + +  EAEI CA
Sbjct: 124 GKFAAKAFVGDELAVEAEIMCA 145


>gi|254785184|ref|YP_003072612.1| (3R)-hydroxymyristoyl-ACP dehydratase [Teredinibacter turnerae
           T7901]
 gi|259646360|sp|C5BQG6|FABZ_TERTT RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|237684758|gb|ACR12022.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Teredinibacter turnerae T7901]
          Length = 146

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI+E+ ++LPHRYPFL++D+VV +   ES    KNV+ NE  F GHFP  PV PGVL++E
Sbjct: 3   DILEIRKYLPHRYPFLMIDRVVELIEGESITAYKNVSINEEIFQGHFPHFPVFPGVLLIE 62

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +     N   +    YL + ID  RF++ V PGDR+ +    V  +  +WKF
Sbjct: 63  AMAQACGVLGFKTANKTPEDGSIYLFAGIDGVRFKRQVVPGDRVYFECKVVSAKRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
            C AKV+  +V  A I CA
Sbjct: 123 DCVAKVDGELVTSATIMCA 141


>gi|332095119|gb|EGJ00151.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           boydii 5216-82]
          Length = 151

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTNTHTLQIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|163755585|ref|ZP_02162704.1| preprotein translocase ATPase subunit [Kordia algicida OT-1]
 gi|161324498|gb|EDP95828.1| preprotein translocase ATPase subunit [Kordia algicida OT-1]
          Length = 473

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (58%), Gaps = 2/153 (1%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL      DI ++M  LPHR PFLLVDK++ +  D+  +G+KNVT NEP F+GHFPG PV
Sbjct: 317 DLHQTPLMDINQIMTMLPHRPPFLLVDKILELS-DKHVVGVKNVTMNEPFFVGHFPGAPV 375

Query: 64  MPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN- 122
           MPGVL +E MAQT G +        +    + M IDK +F++ V PGD L +  + +   
Sbjct: 376 MPGVLQVEAMAQTGGILVLSTVPDPENYLTFFMKIDKVKFKQKVVPGDTLIFKADLITPI 435

Query: 123 RVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           R  +   Q  A     +VAEAE+ A +  +K+E
Sbjct: 436 RRGICHMQAYAYANGKLVAEAELMAQIARKKEE 468


>gi|257468112|ref|ZP_05632208.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Fusobacterium ulcerans ATCC 49185]
 gi|317062397|ref|ZP_07926882.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Fusobacterium
           ulcerans ATCC 49185]
 gi|313688073|gb|EFS24908.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Fusobacterium
           ulcerans ATCC 49185]
          Length = 141

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 88/133 (66%), Gaps = 4/133 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           D +E+M+ +PHRYPFLLVD+++ + ++E  I G+KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DTLEIMKRIPHRYPFLLVDRILEVNKEEQKIKGLKNVTINEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  + +G +    PY + ++ A+F+ P+ PGD++ Y V   + + +  K  
Sbjct: 63  EGMAQCLGVL--VMDGVEGKV-PYFVGVESAKFKSPIKPGDQVIYEVEVEKIKRNFVKAH 119

Query: 131 CCAKVENTVVAEA 143
             AKV+  +  EA
Sbjct: 120 GVAKVDGVLACEA 132


>gi|156935304|ref|YP_001439220.1| (3R)-hydroxymyristoyl-ACP dehydratase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166233421|sp|A7MI19|FABZ_ENTS8 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|156533558|gb|ABU78384.1| hypothetical protein ESA_03161 [Cronobacter sakazakii ATCC BAA-894]
          Length = 151

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHRYPFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTETHTLHIEEILEL---LPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMVMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  + +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGVTRFKGVALVDGKVVCEATMMCA 146


>gi|15799862|ref|NP_285874.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           EDL933]
 gi|16128173|ref|NP_414722.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|30061737|ref|NP_835908.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella flexneri 2a str.
           2457T]
 gi|56479620|ref|NP_706125.2| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella flexneri 2a str.
           301]
 gi|74310800|ref|YP_309219.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella sonnei Ss046]
 gi|82542779|ref|YP_406726.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella boydii Sb227]
 gi|82775570|ref|YP_401917.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella dysenteriae Sd197]
 gi|89107060|ref|AP_000840.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K-12 substr. W3110]
 gi|110640399|ref|YP_668127.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli 536]
 gi|157156776|ref|YP_001461349.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli E24377A]
 gi|168752162|ref|ZP_02777184.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4113]
 gi|168769947|ref|ZP_02794954.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4486]
 gi|168777712|ref|ZP_02802719.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4196]
 gi|168782072|ref|ZP_02807079.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4076]
 gi|168789289|ref|ZP_02814296.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC869]
 gi|170021467|ref|YP_001726421.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli ATCC 8739]
 gi|170079816|ref|YP_001729136.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170680401|ref|YP_001742308.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli SMS-3-5]
 gi|170768418|ref|ZP_02902871.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia albertii TW07627]
 gi|187731029|ref|YP_001878982.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella boydii CDC 3083-94]
 gi|188495751|ref|ZP_03003021.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 53638]
 gi|191167038|ref|ZP_03028860.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B7A]
 gi|191172812|ref|ZP_03034349.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli F11]
 gi|193063229|ref|ZP_03044320.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E22]
 gi|193067715|ref|ZP_03048682.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E110019]
 gi|194428301|ref|ZP_03060843.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B171]
 gi|194435014|ref|ZP_03067255.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           dysenteriae 1012]
 gi|194439903|ref|ZP_03071965.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 101-1]
 gi|195939876|ref|ZP_03085258.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. EC4024]
 gi|208807810|ref|ZP_03250147.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4206]
 gi|208812227|ref|ZP_03253556.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4045]
 gi|208818595|ref|ZP_03258915.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4042]
 gi|209396127|ref|YP_002268788.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4115]
 gi|209917370|ref|YP_002291454.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli SE11]
 gi|215485341|ref|YP_002327772.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O127:H6
           str. E2348/69]
 gi|217324917|ref|ZP_03441001.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. TW14588]
 gi|218547635|ref|YP_002381426.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia fergusonii ATCC
           35469]
 gi|218552761|ref|YP_002385674.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli IAI1]
 gi|218557121|ref|YP_002390034.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli S88]
 gi|218688055|ref|YP_002396267.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli ED1a]
 gi|218693645|ref|YP_002401312.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli 55989]
 gi|218698600|ref|YP_002406229.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli IAI39]
 gi|218703434|ref|YP_002410953.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli UMN026]
 gi|227884907|ref|ZP_04002712.1| 3-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Escherichia
           coli 83972]
 gi|237704339|ref|ZP_04534820.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238899578|ref|YP_002925374.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli BW2952]
 gi|253774793|ref|YP_003037624.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037599|ref|ZP_04871676.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|254160299|ref|YP_003043407.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli B str.
           REL606]
 gi|254791313|ref|YP_003076150.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. TW14359]
 gi|256021612|ref|ZP_05435477.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella sp. D9]
 gi|256025492|ref|ZP_05439357.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia sp. 4_1_40B]
 gi|260842412|ref|YP_003220190.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O103:H2 str. 12009]
 gi|260853390|ref|YP_003227281.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O26:H11 str. 11368]
 gi|260866329|ref|YP_003232731.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O111:H- str. 11128]
 gi|261226934|ref|ZP_05941215.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255338|ref|ZP_05947871.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. FRIK966]
 gi|291281002|ref|YP_003497820.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Escherichia coli O55:H7 str. CB9615]
 gi|293403249|ref|ZP_06647346.1| fabZ [Escherichia coli FVEC1412]
 gi|293408272|ref|ZP_06652112.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B354]
 gi|293418065|ref|ZP_06660687.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B185]
 gi|298378785|ref|ZP_06988669.1| 3R-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Escherichia
           coli FVEC1302]
 gi|300816220|ref|ZP_07096443.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 107-1]
 gi|300824097|ref|ZP_07104217.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 119-7]
 gi|300900782|ref|ZP_07118926.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 198-1]
 gi|300901999|ref|ZP_07120026.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 84-1]
 gi|300920138|ref|ZP_07136589.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 115-1]
 gi|300923028|ref|ZP_07139095.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 182-1]
 gi|300932134|ref|ZP_07147419.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 187-1]
 gi|300938587|ref|ZP_07153320.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 21-1]
 gi|300949788|ref|ZP_07163762.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 116-1]
 gi|300956063|ref|ZP_07168388.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 175-1]
 gi|300984940|ref|ZP_07177205.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 200-1]
 gi|301025940|ref|ZP_07189424.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 69-1]
 gi|301028673|ref|ZP_07191894.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 196-1]
 gi|301305316|ref|ZP_07211412.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 124-1]
 gi|301330022|ref|ZP_07222706.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 78-1]
 gi|301646503|ref|ZP_07246378.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 146-1]
 gi|306815221|ref|ZP_07449370.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli NC101]
 gi|307136780|ref|ZP_07496136.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli H736]
 gi|307311372|ref|ZP_07591014.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli W]
 gi|309787146|ref|ZP_07681758.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           dysenteriae 1617]
 gi|309796357|ref|ZP_07690766.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 145-7]
 gi|312966317|ref|ZP_07780543.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 2362-75]
 gi|312970281|ref|ZP_07784463.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 1827-70]
 gi|331640634|ref|ZP_08341782.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H736]
 gi|331645323|ref|ZP_08346434.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli M605]
 gi|331651085|ref|ZP_08352113.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli M718]
 gi|331661554|ref|ZP_08362478.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA143]
 gi|331666421|ref|ZP_08367302.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA271]
 gi|331671686|ref|ZP_08372484.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA280]
 gi|331680759|ref|ZP_08381418.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H591]
 gi|331681565|ref|ZP_08382202.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H299]
 gi|332282854|ref|ZP_08395267.1| conserved hypothetical protein [Shigella sp. D9]
 gi|68056567|sp|P0A6Q6|FABZ_ECOLI RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase;
           AltName: Full=17 kDa actomyosin component
 gi|71159323|sp|P0A6Q8|FABZ_ECO57 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|71159324|sp|P0A6Q9|FABZ_SHIFL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|85681846|sp|P0A6Q7|FABZ_ECOL6 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91206649|sp|Q325W0|FABZ_SHIBS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91206650|sp|Q32JS9|FABZ_SHIDS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|91206651|sp|Q3Z5H8|FABZ_SHISS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|123148408|sp|Q0TLF3|FABZ_ECOL5 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166971617|sp|A7ZHS0|FABZ_ECO24 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044388|sp|B1IQG1|FABZ_ECOLC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700460|sp|B7MBG1|FABZ_ECO45 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700461|sp|B5Z0F9|FABZ_ECO5E RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700462|sp|B7NIE2|FABZ_ECO7I RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700463|sp|B7M1Y3|FABZ_ECO8A RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700464|sp|B1XD49|FABZ_ECODH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700465|sp|B7N847|FABZ_ECOLU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700466|sp|B6HZF4|FABZ_ECOSE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700467|sp|B1LGY2|FABZ_ECOSM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700469|sp|B7LW77|FABZ_ESCF3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700816|sp|B2U323|FABZ_SHIB3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788927|sp|B7UJ81|FABZ_ECO27 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788928|sp|B7LGP2|FABZ_ECO55 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788929|sp|B7MP40|FABZ_ECO81 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|259646351|sp|C4ZRS2|FABZ_ECOBW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|12512908|gb|AAG54482.1|AE005194_3 (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O157:H7 str. EDL933]
 gi|450761|gb|AAC36917.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Escherichia
           coli]
 gi|1552757|gb|AAB08609.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Escherichia
           coli]
 gi|1786377|gb|AAC73291.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K-12 substr. MG1655]
 gi|4902921|dbj|BAA77855.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K12 substr. W3110]
 gi|30039979|gb|AAP15713.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           flexneri 2a str. 2457T]
 gi|56383171|gb|AAN41832.2| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           flexneri 2a str. 301]
 gi|73854277|gb|AAZ86984.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           sonnei Ss046]
 gi|81239718|gb|ABB60428.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           dysenteriae Sd197]
 gi|81244190|gb|ABB64898.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           boydii Sb227]
 gi|110341991|gb|ABG68228.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli 536]
 gi|157078806|gb|ABV18514.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E24377A]
 gi|169756395|gb|ACA79094.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli ATCC 8739]
 gi|169887651|gb|ACB01358.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170122522|gb|EDS91453.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia albertii TW07627]
 gi|170518119|gb|ACB16297.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli SMS-3-5]
 gi|187428021|gb|ACD07295.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           boydii CDC 3083-94]
 gi|187767113|gb|EDU30957.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4196]
 gi|188013926|gb|EDU52048.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4113]
 gi|188490950|gb|EDU66053.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 53638]
 gi|189000474|gb|EDU69460.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4076]
 gi|189361035|gb|EDU79454.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4486]
 gi|189371127|gb|EDU89543.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC869]
 gi|190902931|gb|EDV62658.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B7A]
 gi|190906962|gb|EDV66564.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli F11]
 gi|192931137|gb|EDV83740.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E22]
 gi|192959127|gb|EDV89563.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E110019]
 gi|194413676|gb|EDX29956.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B171]
 gi|194416750|gb|EDX32878.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           dysenteriae 1012]
 gi|194421149|gb|EDX37174.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 101-1]
 gi|208727611|gb|EDZ77212.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733504|gb|EDZ82191.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4045]
 gi|208738718|gb|EDZ86400.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4042]
 gi|209157527|gb|ACI34960.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. EC4115]
 gi|209745744|gb|ACI71179.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli]
 gi|209745746|gb|ACI71180.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli]
 gi|209745748|gb|ACI71181.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli]
 gi|209745750|gb|ACI71182.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli]
 gi|209745752|gb|ACI71183.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli]
 gi|209910629|dbj|BAG75703.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli SE11]
 gi|215263413|emb|CAS07733.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217321138|gb|EEC29562.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli O157:H7 str. TW14588]
 gi|218350377|emb|CAU96060.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli 55989]
 gi|218355176|emb|CAQ87783.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           fergusonii ATCC 35469]
 gi|218359529|emb|CAQ97067.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli IAI1]
 gi|218363890|emb|CAR01555.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli S88]
 gi|218368586|emb|CAR16323.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli IAI39]
 gi|218425619|emb|CAR06405.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli ED1a]
 gi|218430531|emb|CAR11397.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli UMN026]
 gi|222032010|emb|CAP74749.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] [Escherichia coli
           LF82]
 gi|226840705|gb|EEH72707.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226902251|gb|EEH88510.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227838045|gb|EEJ48511.1| 3-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Escherichia
           coli 83972]
 gi|238859725|gb|ACR61723.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli BW2952]
 gi|242376011|emb|CAQ30694.1| 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase [Escherichia coli
           BL21(DE3)]
 gi|253325837|gb|ACT30439.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972200|gb|ACT37871.1| (3R)-hydroxymyristoyl ACP dehydratase [Escherichia coli B str.
           REL606]
 gi|253976409|gb|ACT42079.1| (3R)-hydroxymyristoyl ACP dehydratase [Escherichia coli BL21(DE3)]
 gi|254590713|gb|ACT70074.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O157:H7 str. TW14359]
 gi|257752039|dbj|BAI23541.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O26:H11 str. 11368]
 gi|257757559|dbj|BAI29056.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O103:H2 str. 12009]
 gi|257762685|dbj|BAI34180.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli O111:H- str. 11128]
 gi|262176877|gb|ACY27493.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli LW1655F+]
 gi|281177405|dbj|BAI53735.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli SE15]
 gi|284919955|emb|CBG33010.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli 042]
 gi|290760875|gb|ADD54836.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Escherichia coli O55:H7 str. CB9615]
 gi|291430164|gb|EFF03178.1| fabZ [Escherichia coli FVEC1412]
 gi|291430783|gb|EFF03781.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B185]
 gi|291472523|gb|EFF15005.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli B354]
 gi|294493646|gb|ADE92402.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli IHE3034]
 gi|298281119|gb|EFI22620.1| 3R-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Escherichia
           coli FVEC1302]
 gi|299878305|gb|EFI86516.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 196-1]
 gi|300306590|gb|EFJ61110.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 200-1]
 gi|300317093|gb|EFJ66877.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 175-1]
 gi|300355731|gb|EFJ71601.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 198-1]
 gi|300395739|gb|EFJ79277.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 69-1]
 gi|300405885|gb|EFJ89423.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 84-1]
 gi|300412835|gb|EFJ96145.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 115-1]
 gi|300420655|gb|EFK03966.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 182-1]
 gi|300450820|gb|EFK14440.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 116-1]
 gi|300456469|gb|EFK19962.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 21-1]
 gi|300460110|gb|EFK23603.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 187-1]
 gi|300523374|gb|EFK44443.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 119-7]
 gi|300531427|gb|EFK52489.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 107-1]
 gi|300839421|gb|EFK67181.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 124-1]
 gi|300843933|gb|EFK71693.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 78-1]
 gi|301075289|gb|EFK90095.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 146-1]
 gi|305850883|gb|EFM51338.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli NC101]
 gi|306908351|gb|EFN38849.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli W]
 gi|307552030|gb|ADN44805.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli ABU 83972]
 gi|307629756|gb|ADN74060.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli UM146]
 gi|308120061|gb|EFO57323.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 145-7]
 gi|308924724|gb|EFP70219.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           dysenteriae 1617]
 gi|309700388|emb|CBI99676.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli ETEC H10407]
 gi|310337779|gb|EFQ02890.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 1827-70]
 gi|312289560|gb|EFR17454.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli 2362-75]
 gi|312944788|gb|ADR25615.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313646759|gb|EFS11218.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri 2a str. 2457T]
 gi|315059398|gb|ADT73725.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli W]
 gi|315134870|dbj|BAJ42029.1| 3R-hydroxymyristoyl ACP dehydrase [Escherichia coli DH1]
 gi|315254982|gb|EFU34950.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 85-1]
 gi|315285253|gb|EFU44698.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 110-3]
 gi|315294584|gb|EFU53931.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 153-1]
 gi|315300684|gb|EFU59911.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 16-3]
 gi|320173339|gb|EFW48542.1| 3R-hydroxymyristoyl-ACP dehydratase [Shigella dysenteriae CDC
           74-1112]
 gi|320180913|gb|EFW55835.1| 3R-hydroxymyristoyl-ACP dehydratase [Shigella boydii ATCC 9905]
 gi|320186602|gb|EFW61327.1| 3R-hydroxymyristoyl-ACP dehydratase [Shigella flexneri CDC 796-83]
 gi|320190294|gb|EFW64944.1| 3R-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196943|gb|EFW71564.1| 3R-hydroxymyristoyl-ACP dehydratase [Escherichia coli WV_060327]
 gi|320200294|gb|EFW74880.1| 3R-hydroxymyristoyl-ACP dehydratase [Escherichia coli EC4100B]
 gi|320639986|gb|EFX09571.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. G5101]
 gi|320644756|gb|EFX13800.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H-
           str. 493-89]
 gi|320652912|gb|EFX21150.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H-
           str. H 2687]
 gi|320658300|gb|EFX26029.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320663610|gb|EFX30894.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668923|gb|EFX35718.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. LSU-61]
 gi|323157983|gb|EFZ44085.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli EPECa14]
 gi|323160200|gb|EFZ46159.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E128010]
 gi|323165881|gb|EFZ51663.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           sonnei 53G]
 gi|323170972|gb|EFZ56621.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli LT-68]
 gi|323190420|gb|EFZ75695.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli RN587/1]
 gi|323380043|gb|ADX52311.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli KO11]
 gi|323935020|gb|EGB31393.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E1520]
 gi|323939944|gb|EGB36142.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E482]
 gi|323945657|gb|EGB41706.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H120]
 gi|323950821|gb|EGB46698.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H252]
 gi|323955141|gb|EGB50916.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H263]
 gi|323959941|gb|EGB55588.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H489]
 gi|323964927|gb|EGB60393.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli M863]
 gi|323970659|gb|EGB65915.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA007]
 gi|323975652|gb|EGB70748.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TW10509]
 gi|324008242|gb|EGB77461.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 57-2]
 gi|324014102|gb|EGB83321.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 60-1]
 gi|324017813|gb|EGB87032.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 117-3]
 gi|324112409|gb|EGC06386.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia fergusonii B253]
 gi|324118300|gb|EGC12195.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli E1167]
 gi|325496112|gb|EGC93971.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia fergusonii
           ECD227]
 gi|326339765|gb|EGD63573.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7
           str. 1044]
 gi|326345099|gb|EGD68842.1| 3R-hydroxymyristoyl-ACP dehydratase [Escherichia coli O157:H7 str.
           1125]
 gi|327255159|gb|EGE66762.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli STEC_7v]
 gi|330910030|gb|EGH38540.1| 3R-hydroxymyristoyl-[acyl carrier protein] dehydratase [Escherichia
           coli AA86]
 gi|331040380|gb|EGI12587.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H736]
 gi|331046080|gb|EGI18199.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli M605]
 gi|331051539|gb|EGI23588.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli M718]
 gi|331061469|gb|EGI33432.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA143]
 gi|331066632|gb|EGI38509.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA271]
 gi|331071531|gb|EGI42888.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli TA280]
 gi|331072222|gb|EGI43558.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H591]
 gi|331081786|gb|EGI52947.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli H299]
 gi|332097586|gb|EGJ02563.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           dysenteriae 155-74]
 gi|332098755|gb|EGJ03715.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           boydii 3594-74]
 gi|332105206|gb|EGJ08552.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332341513|gb|AEE54847.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli UMNK88]
 gi|332762030|gb|EGJ92301.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri 2747-71]
 gi|332762184|gb|EGJ92453.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri 4343-70]
 gi|333009358|gb|EGK28814.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri K-218]
 gi|333010675|gb|EGK30108.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri VA-6]
 gi|333011019|gb|EGK30438.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri K-272]
 gi|333021814|gb|EGK41063.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri K-227]
 gi|333022236|gb|EGK41475.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Shigella
           flexneri K-304]
          Length = 151

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTNTHTLQIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|196039452|ref|ZP_03106757.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cereus NVH0597-99]
 gi|196029612|gb|EDX68214.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cereus NVH0597-99]
          Length = 144

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVDKV+ ++  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDKVLEVEEGKRAIGIKNVTVNEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGAIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +  E EI    + +KKE
Sbjct: 122 IATVDGEIACETEIT-FALGDKKE 144


>gi|197121554|ref|YP_002133505.1| (3R)-hydroxymyristoyl-ACP dehydratase [Anaeromyxobacter sp. K]
 gi|226700438|sp|B4UGV1|FABZ_ANASK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|196171403|gb|ACG72376.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Anaeromyxobacter sp. K]
          Length = 156

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 92/145 (63%), Gaps = 2/145 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+V + + LPHR PFLLVD+VV  + ++  + +K VT NEP F GHFP +PVMPGVLILE
Sbjct: 12  DVVGIQKLLPHRPPFLLVDRVVEFEPNKRVVALKGVTMNEPFFQGHFPAQPVMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +  +    ++      YLM ID ARFR+PV PGDRLE  V   + +  +WK 
Sbjct: 72  ALAQAAALLATLSMKPEEVNDKITYLMGIDAARFRRPVVPGDRLELEVEVTKQKGAVWKQ 131

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
              A+V+  VVAEAE  AM+   ++
Sbjct: 132 TGVARVDGQVVAEAEFMAMLADRER 156


>gi|224003015|ref|XP_002291179.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220972955|gb|EED91286.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 142

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (60%), Gaps = 2/130 (1%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPFLLVDKVV  +  + A+GIK+VT NEPHF GHFP RP+MPGVL +E MA
Sbjct: 9   DIAKILPHRYPFLLVDKVVEYEMGKRAVGIKSVTLNEPHFTGHFPDRPIMPGVLQVEAMA 68

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRL--EYHVNKVRNRVDLWKFQCC 132
           Q AG +C    G +  A  +   +D  +++KPV PGD L  E  + K   R  +      
Sbjct: 69  QLAGIVCLQMEGAEPGAVFFFAGVDGVKWKKPVVPGDTLVMEVEIKKWNKRFGIATATGR 128

Query: 133 AKVENTVVAE 142
           A V+  +  E
Sbjct: 129 AYVDGEMAVE 138


>gi|330807792|ref|YP_004352254.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
           ((3R)-hydroxymyristoyl-[acyl carrier protein]
           dehydratase) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375900|gb|AEA67250.1| 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
           ((3R)-hydroxymyristoyl-[acyl carrier protein]
           dehydratase) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 146

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVDLDVEGKRIRAYKNVSINEPFFNGHFPAHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTLYYFVGSDKLRFRQPVTPGDQLILEAKFISCK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF+C A V+   V  AE ICA
Sbjct: 118 RQIWKFECQASVDGKPVCSAEIICA 142


>gi|261378079|ref|ZP_05982652.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           cinerea ATCC 14685]
 gi|269145527|gb|EEZ71945.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           cinerea ATCC 14685]
          Length = 149

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVTMNEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|59802122|ref|YP_208834.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae FA
           1090]
 gi|161870884|ref|YP_001600058.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria meningitidis
           053442]
 gi|194099956|ref|YP_002003095.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           NCCP11945]
 gi|218767128|ref|YP_002341640.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria meningitidis
           Z2491]
 gi|239997964|ref|ZP_04717888.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae 35/02]
 gi|240015058|ref|ZP_04721971.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae DGI18]
 gi|240017507|ref|ZP_04724047.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           FA6140]
 gi|240081647|ref|ZP_04726190.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae FA19]
 gi|240113928|ref|ZP_04728418.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae MS11]
 gi|240116661|ref|ZP_04730723.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae PID18]
 gi|240118883|ref|ZP_04732945.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae PID1]
 gi|240122127|ref|ZP_04735089.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           PID24-1]
 gi|240124420|ref|ZP_04737376.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           PID332]
 gi|240124708|ref|ZP_04737594.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           SK-92-679]
 gi|240129097|ref|ZP_04741758.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|254494682|ref|ZP_05107853.1| FabZ [Neisseria gonorrhoeae 1291]
 gi|260439580|ref|ZP_05793396.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae DGI2]
 gi|268593813|ref|ZP_06127980.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597744|ref|ZP_06131911.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599992|ref|ZP_06134159.1| FabZ [Neisseria gonorrhoeae MS11]
 gi|268602329|ref|ZP_06136496.1| FabZ [Neisseria gonorrhoeae PID18]
 gi|268604592|ref|ZP_06138759.1| FabZ [Neisseria gonorrhoeae PID1]
 gi|268683049|ref|ZP_06149911.1| FabZ [Neisseria gonorrhoeae PID332]
 gi|268683283|ref|ZP_06150145.1| FabZ [Neisseria gonorrhoeae SK-92-679]
 gi|268687478|ref|ZP_06154340.1| FabZ [Neisseria gonorrhoeae SK-93-1035]
 gi|291042816|ref|ZP_06568557.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           gonorrhoeae DGI2]
 gi|293398163|ref|ZP_06642368.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           gonorrhoeae F62]
 gi|14423705|sp|Q9JX28|FABZ_NEIMA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|75355456|sp|Q5F5W5|FABZ_NEIG1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|189044391|sp|A9M3S9|FABZ_NEIM0 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700247|sp|B4RR12|FABZ_NEIG2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|59719017|gb|AAW90422.1| putative (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Neisseria gonorrhoeae FA 1090]
 gi|121051136|emb|CAM07407.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Neisseria
           meningitidis Z2491]
 gi|161596437|gb|ABX74097.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Neisseria
           meningitidis 053442]
 gi|193935246|gb|ACF31070.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase [Neisseria
           gonorrhoeae NCCP11945]
 gi|226513722|gb|EEH63067.1| FabZ [Neisseria gonorrhoeae 1291]
 gi|268547202|gb|EEZ42620.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268551532|gb|EEZ46551.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268584123|gb|EEZ48799.1| FabZ [Neisseria gonorrhoeae MS11]
 gi|268586460|gb|EEZ51136.1| FabZ [Neisseria gonorrhoeae PID18]
 gi|268588723|gb|EEZ53399.1| FabZ [Neisseria gonorrhoeae PID1]
 gi|268623333|gb|EEZ55733.1| FabZ [Neisseria gonorrhoeae PID332]
 gi|268623567|gb|EEZ55967.1| FabZ [Neisseria gonorrhoeae SK-92-679]
 gi|268627762|gb|EEZ60162.1| FabZ [Neisseria gonorrhoeae SK-93-1035]
 gi|291013250|gb|EFE05216.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           gonorrhoeae DGI2]
 gi|291611426|gb|EFF40496.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           gonorrhoeae F62]
 gi|317165408|gb|ADV08949.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria gonorrhoeae
           TCDC-NG08107]
 gi|319411335|emb|CBY91746.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) [Neisseria
           meningitidis WUE 2594]
 gi|325205272|gb|ADZ00725.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M04-240196]
          Length = 149

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|269120960|ref|YP_003309137.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sebaldella termitidis ATCC 33386]
 gi|268614838|gb|ACZ09206.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Sebaldella termitidis ATCC 33386]
          Length = 141

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 84/135 (62%), Gaps = 9/135 (6%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I ++M  LPHRYPFLLVD+V+     ES + IKN+T NE  F GHFPG PVMPGVL +E 
Sbjct: 7   IEDIMNILPHRYPFLLVDRVIEKNGTESLVAIKNITINEEFFNGHFPGLPVMPGVLQVEA 66

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN--KVRNRVDLWKFQ 130
           MAQ  G +       +    P  MS+DK +FRK V PGD+L   V   KV++R+   K +
Sbjct: 67  MAQAVGLLM-----LEPGKIPLFMSVDKCKFRKQVVPGDQLRIEVEKLKVKSRIIQAKGR 121

Query: 131 CCAKVENTVVAEAEI 145
           C   V+  VV+EAE+
Sbjct: 122 CL--VDGAVVSEAEL 134


>gi|320108840|ref|YP_004184430.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Terriglobus saanensis SP1PR4]
 gi|319927361|gb|ADV84436.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Terriglobus saanensis SP1PR4]
          Length = 173

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 5/145 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M  LPHRYP LL+D+V+ ++  +  + +KNV+ NEPHF GHFP  P+MPGVL++E
Sbjct: 16  DIQQIMAILPHRYPMLLIDRVIEVEPRQRIVALKNVSANEPHFTGHFPDYPIMPGVLMVE 75

Query: 72  GMAQTAGAICA--IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ  G +    I +  D+       SID A+FRKPV PGD+L   V  +  R    K 
Sbjct: 76  AIAQAGGLLLLNDIPDREDKLM--VFTSIDGAKFRKPVVPGDQLRIEVKVLNWRTSAVKM 133

Query: 130 QCCAKVENTVVAEAEI-CAMVMHEK 153
           +  A V+  +  EA + CA+V   K
Sbjct: 134 RGTATVDGKLACEATVMCALVARPK 158


>gi|170757864|ref|YP_001783233.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum B1
           str. Okra]
 gi|190359378|sp|B1IH50|FABZ_CLOBK RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|169123076|gb|ACA46912.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum B1 str. Okra]
          Length = 144

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ R +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKRIIPHRYPFLLVDKITELEEGKSAVGYKNVTVNEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD L+  +   + +      + 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDELKLSIELTKIKGVAGVGKA 124

Query: 132 CAKVENTVVAEAEICAMV 149
            A V+  V AEAE+  ++
Sbjct: 125 VATVDGKVAAEAELLFVI 142


>gi|270719954|ref|ZP_06223359.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae HK1212]
 gi|319897456|ref|YP_004135653.1| (3r)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           influenzae F3031]
 gi|270315359|gb|EFA27646.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus influenzae HK1212]
 gi|317432962|emb|CBY81329.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Haemophilus
           influenzae F3031]
          Length = 134

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/132 (43%), Positives = 80/132 (60%), Gaps = 1/132 (0%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M  LPHRYPFLLVD+V++ +  E    IKN++ NEP F GHFPG P++PGVLILE +AQ 
Sbjct: 1   MTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEPILPGVLILEALAQA 60

Query: 77  AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVE 136
            G +             Y   ID+ARF++PV PGD++E +V  ++ R  +  F   A V 
Sbjct: 61  MGILAFKTLELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKERRGITAFTGVATVN 120

Query: 137 NTVVAEAEI-CA 147
             +  EA++ CA
Sbjct: 121 GEIACEAKLMCA 132


>gi|149370457|ref|ZP_01890146.1| candidate UDP-3-0-acyl N-acetylglucosamine deacetylase,
           carbohydrate esterase family 11 protein [unidentified
           eubacterium SCB49]
 gi|149356008|gb|EDM44565.1| candidate UDP-3-0-acyl N-acetylglucosamine deacetylase,
           carbohydrate esterase family 11 protein [unidentified
           eubacterium SCB49]
          Length = 468

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 92/152 (60%), Gaps = 4/152 (2%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL     KDI ++M  LPHR PFLLVDK++ +  D   IG+KNVT NEP F+GHFPG PV
Sbjct: 317 DLYAKPVKDINQIMEMLPHRSPFLLVDKILELSNDH-VIGMKNVTMNEPFFVGHFPGAPV 375

Query: 64  MPGVLILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           MPGVLI+E MAQT G I A+    D +    + M I+  +F++ V PGD L + +  +  
Sbjct: 376 MPGVLIVEAMAQT-GGILALSTVPDPENYLTFFMKINNVKFKQQVNPGDTLVFSLELITP 434

Query: 123 -RVDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
            R  +   +  A V + +V EAE+ A ++  K
Sbjct: 435 IRRGIVHMKGSAFVGDKLVTEAELMAQIVKTK 466


>gi|282899942|ref|ZP_06307903.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Cylindrospermopsis raciborskii CS-505]
 gi|281195212|gb|EFA70148.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Cylindrospermopsis raciborskii CS-505]
          Length = 171

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E+ + +PHRYPFLLVDK+V+    + A+GIKNVTFNEP F GHFPGR +MPGVLI+E 
Sbjct: 33  IEEIQQLIPHRYPFLLVDKIVDYIPGKLAVGIKNVTFNEPQFQGHFPGRSLMPGVLIVEA 92

Query: 73  MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN--KVRNRVDLWKFQ 130
           MAQ  G + +      +    ++  IDK RFR+ V PGD+L   V    V+ R    K Q
Sbjct: 93  MAQVGGVVMSQMPNMPEGLFVFV-GIDKVRFRRQVVPGDQLIMTVELLSVKQR-RFGKMQ 150

Query: 131 CCAKVENTVVAEAEIC 146
             A+V+  + AE E+ 
Sbjct: 151 GRAEVDGNLAAEGELM 166


>gi|32266680|ref|NP_860712.1| (3R)-hydroxymyristoyl-ACP dehydratase [Helicobacter hepaticus ATCC
           51449]
 gi|47605645|sp|Q7U319|FABZ_HELHP RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|32262731|gb|AAP77778.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Helicobacter
           hepaticus ATCC 51449]
          Length = 169

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 92/155 (59%), Gaps = 12/155 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-------GIKNVTFNEPHFMGHFPGRPVM 64
           ++ ++ + LPHRYP LLVD+V+ + ++ S           KNVT NE  F+GHFP +P+ 
Sbjct: 14  NVEKIRQILPHRYPMLLVDRVMELVQNTSDSEPNGYIKAYKNVTINEEVFLGHFPNKPIY 73

Query: 65  PGVLILEGMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNK 119
           PGV+ +EGMAQ  G +  +    D  A       Y M+ID  +FR PV PGDRL Y +  
Sbjct: 74  PGVMQIEGMAQAGGLLAFVSMFGDNVAEAKNKIVYFMTIDNVKFRIPVVPGDRLVYELKV 133

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           ++++  +W+    A VE+ +V+EAE+ AM+   K+
Sbjct: 134 LKHKGSIWQLGANAFVEDKLVSEAELKAMITEAKE 168


>gi|182414392|ref|YP_001819458.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Opitutus terrae PB90-1]
 gi|177841606|gb|ACB75858.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Opitutus
           terrae PB90-1]
          Length = 446

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 93/155 (60%), Gaps = 9/155 (5%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           +++D   LD + I++    +PHRYPF++VD+V+ I+  +  + +KNVT NEP+F GHFPG
Sbjct: 294 LLTDETSLDIRRILDT---VPHRYPFIMVDRVLEIKGPDELVALKNVTINEPYFQGHFPG 350

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
            PVMPGVL +E MAQ AG I  +     +      MS DK +FR+ V PGD+L   V   
Sbjct: 351 NPVMPGVLQIEAMAQAAG-ILMLRKISSEGKTALFMSCDKVKFRRAVRPGDQLLIQVKMT 409

Query: 121 R---NRVDLWKFQCCAKVENTVVAEAEICAMVMHE 152
           +   NR+ + + QC   V   VV+ AE+   V+ E
Sbjct: 410 KSRGNRIGVAEGQCS--VNGQVVSSAELMFTVIDE 442


>gi|254415051|ref|ZP_05028814.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Microcoleus chthonoplastes PCC 7420]
 gi|196178198|gb|EDX73199.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Microcoleus chthonoplastes PCC 7420]
          Length = 170

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 81/133 (60%), Gaps = 2/133 (1%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPF LVD+++     + A+G+KNVTFNEP+F GHFPGRP+MPGV+I+E MA
Sbjct: 34  DIHKLLPHRYPFALVDRIIEYVPGKLAVGLKNVTFNEPYFQGHFPGRPMMPGVMIVEAMA 93

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKFQCCA 133
           Q  G +       D  A      IDK RFR+PV PGD+L      +   R    K Q  A
Sbjct: 94  QVGGIVLKQMADVDD-ALFVFAGIDKVRFRRPVVPGDQLILTTELISVKRRRFGKMQARA 152

Query: 134 KVENTVVAEAEIC 146
            V++  VAE E+ 
Sbjct: 153 VVDDQRVAEGELM 165


>gi|326389276|ref|ZP_08210844.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325994639|gb|EGD53063.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 142

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 87/139 (62%), Gaps = 3/139 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPFLLVD+++ I+  + A+GIKNVT NEP F GHFP  P+MPGVLI+E +A
Sbjct: 5   DIRKILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQGHFPDNPIMPGVLIVEALA 64

Query: 75  QTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q AG A+  I     +        IDK RF+K V PGD+L   V     ++ L K +  A
Sbjct: 65  QVAGIAVMNIEEFKGKLG--LFTGIDKCRFKKVVRPGDQLVLEVLIDSIKMGLVKAKGAA 122

Query: 134 KVENTVVAEAEICAMVMHE 152
           KV + VVA AE+  ++  E
Sbjct: 123 KVGDEVVATAELMFIMTEE 141


>gi|237744961|ref|ZP_04575442.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Fusobacterium sp. 7_1]
 gi|256028419|ref|ZP_05442253.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Fusobacterium sp. D11]
 gi|289766343|ref|ZP_06525721.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. D11]
 gi|229432190|gb|EEO42402.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Fusobacterium sp. 7_1]
 gi|289717898|gb|EFD81910.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. D11]
          Length = 141

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI+E+M+ +PHRYPFLLVD+++ + R+   I G KNVT NE  F GHFPG PVMPGVL++
Sbjct: 3   DILEIMKRIPHRYPFLLVDRILEMDRENQTIKGKKNVTMNEEFFNGHFPGHPVMPGVLVI 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  + +   +   PY  +I+  +FR PV PGD L Y V   + + +  K  
Sbjct: 63  EGMAQCLG-VLVMESALGKV--PYFAAIENTKFRNPVRPGDTLIYDVKVDKVKRNFVKAS 119

Query: 131 CCAKVENTVVAEAEICAMV 149
               V++ VVAEA    ++
Sbjct: 120 GKTYVDDAVVAEASFTFVI 138


>gi|322383076|ref|ZP_08056903.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152738|gb|EFX45364.1| (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 149

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M  D + LD K I E+   +PHR PFLLVD+++ ++  + A+GIKNVT NEP F GHFP 
Sbjct: 1   MKGDFSVLDIKQIQEI---IPHRPPFLLVDRILEVEEGKRALGIKNVTMNEPFFTGHFPD 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
            PVMPGVLI+E +AQ  GA+  + +  ++        ID  R R+ V PGD L   +   
Sbjct: 58  YPVMPGVLIIEALAQV-GAVAILKSEANKGKIALFAGIDHVRIRQQVVPGDTLTLELELT 116

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEIC 146
           R R    K +  AKV + VV E E+ 
Sbjct: 117 RMRGSFGKGKGTAKVGDNVVLEGELM 142


>gi|30265290|ref|NP_847667.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Ames]
 gi|47530825|ref|YP_022174.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|47569371|ref|ZP_00240054.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cereus G9241]
 gi|49188102|ref|YP_031355.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Sterne]
 gi|52140297|ref|YP_086532.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus cereus E33L]
 gi|65317235|ref|ZP_00390194.1| COG0764: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
           protein) dehydratases [Bacillus anthracis str. A2012]
 gi|165870065|ref|ZP_02214722.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0488]
 gi|177654100|ref|ZP_02936110.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0174]
 gi|190567771|ref|ZP_03020683.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis Tsiankovskii-I]
 gi|196036311|ref|ZP_03103709.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           cereus W]
 gi|218906443|ref|YP_002454277.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           cereus AH820]
 gi|227818027|ref|YP_002818036.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. CDC 684]
 gi|229124772|ref|ZP_04253952.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus 95/8201]
 gi|229158828|ref|ZP_04286886.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus ATCC 4342]
 gi|229169973|ref|ZP_04297666.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH621]
 gi|229601884|ref|YP_002869481.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0248]
 gi|254686311|ref|ZP_05150170.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724307|ref|ZP_05186091.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           A1055]
 gi|254735193|ref|ZP_05192902.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744399|ref|ZP_05202079.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Kruger B]
 gi|254755701|ref|ZP_05207734.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Vollum]
 gi|254759567|ref|ZP_05211592.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus anthracis str.
           Australia 94]
 gi|301056733|ref|YP_003794944.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Bacillus
           anthracis CI]
 gi|33516880|sp|Q81JE0|FABZ_BACAN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|62286772|sp|Q630Y5|FABZ_BACCZ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226700440|sp|B7JGJ1|FABZ_BACC0 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788913|sp|C3P1B5|FABZ_BACAA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|254788914|sp|C3LEN8|FABZ_BACAC RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|30259968|gb|AAP29153.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           anthracis str. Ames]
 gi|47505973|gb|AAT34649.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|47553959|gb|EAL12327.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           cereus G9241]
 gi|49182029|gb|AAT57405.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. Sterne]
 gi|51973766|gb|AAU15316.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Bacillus
           cereus E33L]
 gi|164714388|gb|EDR19908.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0488]
 gi|172080983|gb|EDT66062.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0174]
 gi|190561187|gb|EDV15160.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis Tsiankovskii-I]
 gi|195991103|gb|EDX55073.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           cereus W]
 gi|218539912|gb|ACK92310.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           cereus AH820]
 gi|227004506|gb|ACP14249.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           anthracis str. CDC 684]
 gi|228613491|gb|EEK70623.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH621]
 gi|228624812|gb|EEK81581.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus ATCC 4342]
 gi|228658749|gb|EEL14409.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus 95/8201]
 gi|229266292|gb|ACQ47929.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Bacillus
           anthracis str. A0248]
 gi|300378902|gb|ADK07806.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase [Bacillus
           cereus biovar anthracis str. CI]
          Length = 144

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVDKV+ ++  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDKVLEVEEGKRAIGIKNVTANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGAIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +  E EI    + +KKE
Sbjct: 122 IATVDGEIACETEIT-FALGDKKE 144


>gi|225077049|ref|ZP_03720248.1| hypothetical protein NEIFLAOT_02101 [Neisseria flavescens
           NRL30031/H210]
 gi|241760734|ref|ZP_04758826.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           flavescens SK114]
 gi|261379553|ref|ZP_05984126.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           subflava NJ9703]
 gi|319638844|ref|ZP_07993602.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           mucosa C102]
 gi|224951606|gb|EEG32815.1| hypothetical protein NEIFLAOT_02101 [Neisseria flavescens
           NRL30031/H210]
 gi|241318915|gb|EER55441.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           flavescens SK114]
 gi|284798026|gb|EFC53373.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           subflava NJ9703]
 gi|317399748|gb|EFV80411.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Neisseria
           mucosa C102]
          Length = 149

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVTMNEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID ARF++ V PGD+L + V  + N+  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDDARFKRQVIPGDQLVFEVELLTNKRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|15676106|ref|NP_273237.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria meningitidis MC58]
 gi|14423697|sp|P95378|FABZ_NEIMB RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|1718488|gb|AAC45423.1| FabZ [Neisseria meningitidis]
 gi|7225398|gb|AAF40636.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase [Neisseria
           meningitidis MC58]
 gi|261391715|emb|CAX49164.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           ((3R)-hydroxymyristoyl ACP dehydrase) [Neisseria
           meningitidis 8013]
 gi|308388397|gb|ADO30717.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria meningitidis
           alpha710]
 gi|316985704|gb|EFV64650.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis H44/76]
 gi|325131036|gb|EGC53761.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis OX99.30304]
 gi|325135106|gb|EGC57733.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M13399]
 gi|325137012|gb|EGC59608.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M0579]
 gi|325141193|gb|EGC63693.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis CU385]
 gi|325143193|gb|EGC65533.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis 961-5945]
 gi|325145376|gb|EGC67653.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M01-240013]
 gi|325197466|gb|ADY92922.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis G2136]
 gi|325199392|gb|ADY94847.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis H44/76]
 gi|325202986|gb|ADY98440.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M01-240149]
 gi|325207216|gb|ADZ02668.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis NZ-05/33]
          Length = 149

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAIIMCA 145


>gi|90022231|ref|YP_528058.1| (3R)-hydroxymyristoyl-ACP dehydratase [Saccharophagus degradans
           2-40]
 gi|109828973|sp|Q21HI3|FABZ_SACD2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|89951831|gb|ABD81846.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Saccharophagus
           degradans 2-40]
          Length = 145

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D V++ ++LPHRYPFLL+D+VV +   +  +  KN+T NE  F GHFP  PV PGV+++E
Sbjct: 3   DSVQIRKYLPHRYPFLLIDRVVELVEGDYILAYKNITINEEVFQGHFPNYPVFPGVMLIE 62

Query: 72  GMAQTAGAIC--AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            MAQ  G +    +    D  +      ID  RF++ V PGDR+ ++  K+ ++  +WKF
Sbjct: 63  AMAQACGVLGFKTMDKTPDDGSIYLFAGIDNVRFKRQVIPGDRVFFNCKKISDKRGIWKF 122

Query: 130 QCCAKVENTVVAEAEI-CA 147
           +C A V++ +V  A I CA
Sbjct: 123 ECVATVDDQLVTSATIMCA 141


>gi|307266105|ref|ZP_07547650.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918887|gb|EFN49116.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 142

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 87/139 (62%), Gaps = 3/139 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPFLLVD+++ I+  + A+GIKNVT NEP F GHFP  P+MPGVLI+E +A
Sbjct: 5   DIRKILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQGHFPDNPIMPGVLIVEALA 64

Query: 75  QTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q AG A+  I     +        IDK RF+K V PGD+L   V     ++ L K +  A
Sbjct: 65  QVAGIAVMNIEEFKGKLG--LFTGIDKCRFKKVVRPGDQLVLEVLIDSIKMGLVKAKGVA 122

Query: 134 KVENTVVAEAEICAMVMHE 152
           KV + VVA AE+  ++  E
Sbjct: 123 KVGDEVVATAELMFIMTEE 141


>gi|255020978|ref|ZP_05293033.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969583|gb|EET27090.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 148

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 87/139 (62%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+++ LPHRYPFLLVD+V  +Q +     +KNV+ NEP+F GHFP  PVMPGVLI+E
Sbjct: 5   DIHEILKRLPHRYPFLLVDRVEELQPNHYLRALKNVSINEPYFQGHFPDFPVMPGVLIVE 64

Query: 72  GMAQTAGAICAI-HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ A  +  +    + +    Y   IDKARFRKPV PGD+L       R R  +W+ Q
Sbjct: 65  ALAQAAALLAFVSEEKYGENEAVYFAGIDKARFRKPVVPGDQLILLAEVSRRRGGMWQMQ 124

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V +T+VA A + A +
Sbjct: 125 TTAHVGDTLVASAMLMATL 143


>gi|261866964|ref|YP_003254886.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293390807|ref|ZP_06635141.1| hypothetical protein D7S_0947 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412296|gb|ACX81667.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951341|gb|EFE01460.1| hypothetical protein D7S_0947 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 136

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M+ LPHRYPFLLVD+V+N +  +    IKN++ NEP F GHFP  P++PGVLILE +AQ 
Sbjct: 1   MQLLPHRYPFLLVDRVINFEEGKWLTAIKNISVNEPCFTGHFPDNPILPGVLILEALAQA 60

Query: 77  AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVE 136
            G +    +        Y   +D+ARF++P+ PGD++  HV  ++ R  +  F   A V+
Sbjct: 61  MGILAFKTHELVGGEIFYFAGVDEARFKRPIIPGDQMVLHVEVIKERRGITAFTATATVD 120

Query: 137 NTVVAEAEI-CA 147
             V  EA++ CA
Sbjct: 121 GEVACEAKLMCA 132


>gi|113461503|ref|YP_719572.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus somnus 129PT]
 gi|170718382|ref|YP_001783606.1| (3R)-hydroxymyristoyl-ACP dehydratase [Haemophilus somnus 2336]
 gi|123327388|sp|Q0I4M3|FABZ_HAES1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190359385|sp|B0UW60|FABZ_HAES2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|112823546|gb|ABI25635.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Haemophilus
           somnus 129PT]
 gi|168826511|gb|ACA31882.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Haemophilus somnus 2336]
          Length = 151

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  LPHRYPFLLVD+V + +  +    IKNV+ NEP F GHFP +P++PGVLILE +A
Sbjct: 16  EIMTLLPHRYPFLLVDRVTDYEEGKWLTAIKNVSVNEPCFTGHFPDQPILPGVLILEALA 75

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAK 134
           Q  G +    +        Y   +D+ARF++P+ PGD++   V  +R R  +  F   A 
Sbjct: 76  QAMGILAFKTHELSNKELFYFAGVDEARFKRPILPGDQMMLKVEVIRERRGITAFTGVAS 135

Query: 135 VENTVVAEAEI-CA 147
           V   V  EA++ CA
Sbjct: 136 VNGEVACEAKLMCA 149


>gi|237729486|ref|ZP_04559967.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|283783964|ref|YP_003363829.1| (3r)-hydroxymyristol acyl carrier protein dehydratase [Citrobacter
           rodentium ICC168]
 gi|283835242|ref|ZP_06354983.1| hypothetical protein CIT292_09549 [Citrobacter youngae ATCC 29220]
 gi|226909215|gb|EEH95133.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|282947418|emb|CBG86963.1| (3r)-hydroxymyristol acyl carrier protein dehydratase (ec 4.2.1.-)
           [Citrobacter rodentium ICC168]
 gi|291068953|gb|EFE07062.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Citrobacter youngae ATCC 29220]
          Length = 151

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG
Sbjct: 1   MTTNTHTLHIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|296327499|ref|ZP_06870045.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296155325|gb|EFG96096.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 141

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI+E+M+ +PHRYPFLLVD+++ + R+   I G KNVT NE  F GHFPG PVMPGVL++
Sbjct: 3   DILEIMKRIPHRYPFLLVDRILEMDRENQTIKGKKNVTMNEEFFNGHFPGHPVMPGVLVI 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  + +   +   PY  +I+  +FR PV PGD L Y V   + + +  K  
Sbjct: 63  EGMAQCLG-VLVMESALGKV--PYFAAIENTKFRNPVRPGDTLIYDVKVDKVKRNFVKAS 119

Query: 131 CCAKVENTVVAEAEICAMV 149
               V++ +VAEA    ++
Sbjct: 120 GKTYVDDAIVAEASFTFVI 138


>gi|332686078|ref|YP_004455852.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Melissococcus plutonius ATCC 35311]
 gi|332370087|dbj|BAK21043.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Melissococcus plutonius ATCC 35311]
          Length = 140

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+M  +PHRYPFLL+D V  I   +  I  KNVT NEP F GHFP  PVMPGVLI+E +A
Sbjct: 6   EIMAIIPHRYPFLLLDSVEEIIDGKKVIAKKNVTVNEPFFQGHFPDEPVMPGVLIVEALA 65

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDR--LEYHVNKVRNRVDLWKFQCC 132
           Q AGA+  +     +    Y   I+KA+FRK V PGD   LE  + K+R+   L K    
Sbjct: 66  Q-AGAVALLSKPDFKGKTAYFGGIEKAKFRKKVVPGDTLILEVEITKIRSVAGLGK--GI 122

Query: 133 AKVENTVVAEAEICAMV 149
           AKV+   VAEAE+  M+
Sbjct: 123 AKVDGKKVAEAELTFMI 139


>gi|300993599|ref|ZP_07180455.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 45-1]
 gi|300406522|gb|EFJ90060.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 45-1]
          Length = 155

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 13  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 72

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 73  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 132

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 133 GVALVDGKVVCEATMMCA 150


>gi|303328122|ref|ZP_07358561.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio sp. 3_1_syn3]
 gi|302861948|gb|EFL84883.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio sp. 3_1_syn3]
          Length = 155

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  LPHRYPFLLVD+VV           KNV+ NEP F GHFPG P+MPGVLILE
Sbjct: 12  DIQRILSILPHRYPFLLVDRVVECVPGSHIKAYKNVSVNEPFFQGHFPGVPIMPGVLILE 71

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQT G + A   G D     +L + +D  +FR+ V PGDRL+   + +R ++ L K +
Sbjct: 72  ALAQTGGLLAAAGMG-DLADKLFLFTGLDGVKFRRQVVPGDRLDLECSNMRMKLKLCKME 130

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V+  + AEA I A +
Sbjct: 131 ARAFVDGKLAAEARITAAI 149


>gi|325983656|ref|YP_004296058.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosomonas sp. AL212]
 gi|325533175|gb|ADZ27896.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Nitrosomonas sp. AL212]
          Length = 148

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           +  +I E++++LPHRYP LLVD+V++ +  +  + +KNV+ NEP F GHFP  PVMPGVL
Sbjct: 3   NTMNIHEILKYLPHRYPLLLVDRVISYEAGKDIVALKNVSINEPFFSGHFPHHPVMPGVL 62

Query: 69  ILEGMAQTAGAICAI---HNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           I+E +AQ A AI  +   +    +    Y + ID  RF+KPV  GD+L   V+  R    
Sbjct: 63  IVEALAQ-AAAILTLRTENTTNKEDTVYYFVGIDGVRFKKPVMAGDQLILKVSIQRQIKG 121

Query: 126 LWKFQCCAKVENTVVAEAEI 145
           LWK+   A+V+  +V EA++
Sbjct: 122 LWKYSARAEVDGQLVTEAQL 141


>gi|229088046|ref|ZP_04220102.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus Rock3-44]
 gi|228695275|gb|EEL48204.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus Rock3-44]
          Length = 144

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + A+GIKNVT NE +F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDQILEVEEGKRAVGIKNVTANEEYFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAVLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGPIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V   +  EAEI    + +KKE
Sbjct: 122 VATVNGEIACEAEIT-FALGDKKE 144


>gi|81299739|ref|YP_399947.1| (3R)-hydroxymyristoyl-ACP dehydratase [Synechococcus elongatus PCC
           7942]
 gi|109828998|sp|Q31PQ9|FABZ_SYNE7 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|81168620|gb|ABB56960.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Synechococcus
           elongatus PCC 7942]
          Length = 155

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 78/133 (58%), Gaps = 10/133 (7%)

Query: 19  FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78
            LPHRYPF LVD++++    E A+GIKNVTFNEP F GHFPGRP+MPGVLI+E MAQ  G
Sbjct: 23  LLPHRYPFALVDRIIDYVPGERAVGIKNVTFNEPQFQGHFPGRPLMPGVLIVEAMAQVGG 82

Query: 79  AICAIH----NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKFQCCA 133
            I  +      G   +A      ID+ RFR+PV PGD+L      +   R    K Q  A
Sbjct: 83  VIVTLMPDMPQGLFVFA-----GIDQVRFRRPVVPGDQLVLSAQLLSVKRRRFCKIQGEA 137

Query: 134 KVENTVVAEAEIC 146
            V+  + A  E+ 
Sbjct: 138 MVDGQLAASGELL 150


>gi|325203300|gb|ADY98753.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M01-240355]
          Length = 149

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNVT NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV   V  EA I CA
Sbjct: 124 GKFNAVAKVNGQVAVEAVIMCA 145


>gi|56750621|ref|YP_171322.1| (3R)-hydroxymyristoyl-ACP dehydratase [Synechococcus elongatus PCC
           6301]
 gi|62286719|sp|Q5N4G7|FABZ_SYNP6 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56685580|dbj|BAD78802.1| (3R)-hydroxymyristol acyl carrier protein dehydrase [Synechococcus
           elongatus PCC 6301]
          Length = 155

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 78/133 (58%), Gaps = 10/133 (7%)

Query: 19  FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78
            LPHRYPF LVD++++    E A+GIKNVTFNEP F GHFPGRP+MPGVLI+E MAQ  G
Sbjct: 23  LLPHRYPFALVDRIIDYVPGERAVGIKNVTFNEPQFQGHFPGRPLMPGVLIVEAMAQVGG 82

Query: 79  AICAIH----NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKFQCCA 133
            I  +      G   +A      ID+ RFR+PV PGD+L      +   R    K Q  A
Sbjct: 83  VIVTLMPDMPQGLFVFA-----GIDQVRFRRPVVPGDQLVLSAQLLSAKRRRFCKIQGEA 137

Query: 134 KVENTVVAEAEIC 146
            V+  + A  E+ 
Sbjct: 138 MVDGQLAASGELV 150


>gi|62178797|ref|YP_215214.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62126430|gb|AAX64133.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|267991918|gb|ACY86803.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|322713251|gb|EFZ04822.1| (3R)-hydroxymyristoyl-ACP dehydratase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 181

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (61%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P++PGVLILE
Sbjct: 39  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPILPGVLILE 98

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 99  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 158

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 159 GVALVDGKVVCEATMMCA 176


>gi|168181065|ref|ZP_02615729.1| beta-hydroxyacyl- dehydratase FabZ [Clostridium botulinum NCTC
           2916]
 gi|168183676|ref|ZP_02618340.1| beta-hydroxyacyl- dehydratase FabZ [Clostridium botulinum Bf]
 gi|226951050|ref|YP_002806141.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum A2
           str. Kyoto]
 gi|237797055|ref|YP_002864607.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum Ba4
           str. 657]
 gi|254788924|sp|C1FNK0|FABZ_CLOBJ RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|259646349|sp|C3KWF0|FABZ_CLOB6 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|182668069|gb|EDT80048.1| beta-hydroxyacyl- dehydratase FabZ [Clostridium botulinum NCTC
           2916]
 gi|182673178|gb|EDT85139.1| beta-hydroxyacyl- dehydratase FabZ [Clostridium botulinum Bf]
 gi|226844431|gb|ACO87097.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum A2 str. Kyoto]
 gi|229262610|gb|ACQ53643.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum Ba4 str. 657]
          Length = 144

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 5/140 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLVDKITELEEGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKF 129
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD  RL   + K++    + K 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLRLSIELTKIKGVAGVGK- 123

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A V+  V AEAE+  ++
Sbjct: 124 -AVATVDGKVAAEAELLFVI 142


>gi|134300934|ref|YP_001114430.1| (3R)-hydroxymyristoyl-ACP dehydratase [Desulfotomaculum reducens
           MI-1]
 gi|259646350|sp|A4J952|FABZ_DESRM RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|134053634|gb|ABO51605.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Desulfotomaculum
           reducens MI-1]
          Length = 142

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  + + LPHRYPFLLVD+++ ++  +  +GIKNVT NEP F GHFPG PVMPGVL++E
Sbjct: 3   DINAIQQILPHRYPFLLVDRILEMEEGKRVVGIKNVTANEPFFPGHFPGYPVMPGVLVIE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +              IDKARFR+ V PGD L   V  ++ R  + K   
Sbjct: 63  AMAQV-GAVAILSMPAYAGRIALFAGIDKARFRRQVVPGDTLRIEVEVLKLRGTIGKSMA 121

Query: 132 CAKVENTVVAEAEI 145
            A V   + AEAE+
Sbjct: 122 RAYVGEELAAEAEL 135


>gi|312792756|ref|YP_004025679.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876803|ref|ZP_07736781.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796422|gb|EFR12773.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179896|gb|ADQ40066.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 140

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 83/135 (61%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++++ +PHRYPFLLVD+++ ++  + A G+KNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   NIDKILQIIPHRYPFLLVDRIIEVEEGKRAKGVKNVTINEPFFQGHFPSNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +     +   P+   IDK RF+K V PGD L      +  +  + K + 
Sbjct: 63  AMAQV-GAVAMLLKEEFRGKTPFFAGIDKVRFKKVVKPGDVLVIETELISLKGSIGKAKA 121

Query: 132 CAKVENTVVAEAEIC 146
            A V+  VV E E+ 
Sbjct: 122 VATVDGEVVCEGELL 136


>gi|222530015|ref|YP_002573897.1| (3R)-hydroxymyristoyl-ACP dehydratase [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312621710|ref|YP_004023323.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase fabz
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|254788912|sp|B9MLD4|FABZ_ANATD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|222456862|gb|ACM61124.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor bescii DSM 6725]
 gi|312202177|gb|ADQ45504.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 140

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/135 (43%), Positives = 82/135 (60%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I +++  +PHRYPFLLVD+++ ++  + A GIKNVT NEP F GHFP  PVMPGVLI+E
Sbjct: 3   NIDKILEIIPHRYPFLLVDRIIEVEEGKRAKGIKNVTINEPFFQGHFPSNPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  GA+  +     +   P+   IDK RF+K V PGD L      +  +  + K + 
Sbjct: 63  AMAQV-GAVAMLLKEEFKGKTPFFAGIDKVRFKKVVKPGDVLVIETELISLKGSIGKAKA 121

Query: 132 CAKVENTVVAEAEIC 146
            A V+  VV E E+ 
Sbjct: 122 VAMVDGEVVCEGELL 136


>gi|297519545|ref|ZP_06937931.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli OP50]
          Length = 145

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 3   QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 62

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 63  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLARFK 122

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 123 GVALVDGKVVCEATMMCA 140


>gi|298492228|ref|YP_003722405.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ ['Nostoc
           azollae' 0708]
 gi|298234146|gb|ADI65282.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ ['Nostoc
           azollae' 0708]
          Length = 171

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 86/147 (58%), Gaps = 12/147 (8%)

Query: 5   LACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVM 64
           L       + E+ + LPHRYPFLLVDK+++    + A+G+KNVTFNEPHF GHFPG  +M
Sbjct: 25  LTIKTTYSVEEIQQLLPHRYPFLLVDKIIDYVPGKMAVGVKNVTFNEPHFQGHFPGGALM 84

Query: 65  PGVLILEGMAQTAGAICAIHN----GFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK- 119
           PGVLI+E MAQ  G +    +    G   +A      IDK RFR+ V PGD+L   V   
Sbjct: 85  PGVLIVEAMAQVGGVVMTQMSDSPRGLFVFA-----GIDKVRFRRQVTPGDQLVMTVELL 139

Query: 120 -VRNRVDLWKFQCCAKVENTVVAEAEI 145
            V+ R    K Q  A+V+  + AE E+
Sbjct: 140 WVKQR-RFGKMQGRAEVDGQIAAEGEL 165


>gi|149186833|ref|ZP_01865143.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Erythrobacter sp. SD-21]
 gi|148829500|gb|EDL47941.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Erythrobacter sp. SD-21]
          Length = 150

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 81/139 (58%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+VE+++ LPHRYP LLVD+V  +  DE    IK V+FNE  F GHFPG P+MPGVL +E
Sbjct: 7   DVVEVLKRLPHRYPLLLVDRVAELVPDERIHAIKAVSFNEDFFQGHFPGAPIMPGVLQIE 66

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ AG +     G        Y M+I+ A+FR PV PG  L+   + V+ R  + KF 
Sbjct: 67  ALAQAAGVLAVESLGLAGSGKLVYFMAIENAKFRAPVTPGVLLDLKASFVQKRARVCKFA 126

Query: 131 CCAKVENTVVAEAEICAMV 149
             A V+  V  E    AM+
Sbjct: 127 GEASVDGKVTCEVSFTAMI 145


>gi|330959209|gb|EGH59469.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 146

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 81/140 (57%), Gaps = 4/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+V  +  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DIKEIREYLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAG--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG  A   +          Y +  DK RFR PV PGD+L      +  +  +WK
Sbjct: 63  EAMAQAAGILAFKMLDTKPSDGTLYYFVGSDKLRFRHPVLPGDQLILEARFLSCKRQIWK 122

Query: 129 FQCCAKVENTVVAEAE-ICA 147
           F+C A V+   V  AE ICA
Sbjct: 123 FECKATVDGKAVCSAEIICA 142


>gi|229014778|ref|ZP_04171881.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides DSM 2048]
 gi|228746544|gb|EEL96444.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides DSM 2048]
          Length = 144

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + A+GIKNVT NE +F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDQILEVEEGKRAVGIKNVTANEEYFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAVLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGPIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V   +  EAEI    + +KKE
Sbjct: 122 VATVNGEIACEAEIT-FAIGDKKE 144


>gi|254304237|ref|ZP_04971595.1| 3-hydroxydecanoyl-[acyl-carrier protein] dehydratase [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
 gi|148324429|gb|EDK89679.1| 3-hydroxydecanoyl-[acyl-carrier protein] dehydratase [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
          Length = 141

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI+E+M+ +PHRYPFLLVD+++ + ++   I G KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DILEIMKRIPHRYPFLLVDRILEMDKEAQTIKGKKNVTMNEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  +   F     PY  +ID A+F+ PV PGD L Y V   + + +  K  
Sbjct: 63  EGMAQCLGVM--VMENFPGKV-PYFAAIDNAKFKNPVKPGDTLIYDVKVEKVKRNFVKAT 119

Query: 131 CCAKVENTVVAEAEICAMV 149
               V++ VVAEA    ++
Sbjct: 120 GKTYVDDAVVAEASFTFVI 138


>gi|261400094|ref|ZP_05986219.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           lactamica ATCC 23970]
 gi|313667482|ref|YP_004047766.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Neisseria
           lactamica ST-640]
 gi|269210321|gb|EEZ76776.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           lactamica ATCC 23970]
 gi|309379122|emb|CBX22253.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313004944|emb|CBN86371.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Neisseria
           lactamica 020-06]
          Length = 149

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNV+ NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVSINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVGLLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|223940408|ref|ZP_03632261.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [bacterium
           Ellin514]
 gi|223890903|gb|EEF57411.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [bacterium
           Ellin514]
          Length = 247

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 93/150 (62%), Gaps = 7/150 (4%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           ++D A LD   I+++M+ LPHRYPFL+VDK+  I+ ++   G+KN++ NEP+F GHFP  
Sbjct: 102 VADGATLD---IMQVMKVLPHRYPFLMVDKITKIEGNK-ITGVKNISINEPYFEGHFPNH 157

Query: 62  PVMPGVLILEGMAQTAGAICAIH-NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           P+MPGVL LE +AQ AG +       F + A  Y M+ +  ++RKPV PGD L   V   
Sbjct: 158 PIMPGVLQLEAIAQVAGILTLKQAENFGRLA--YFMAAESVKWRKPVRPGDTLVIDVELT 215

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVM 150
           + R  + K +    V+   V+EAE+  M++
Sbjct: 216 KARGKIGKAKGVCSVDGEPVSEAEVTFMIV 245


>gi|47605657|sp|Q7WA49|FABZ_BORPA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
          Length = 151

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 86/143 (60%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+V+ +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKGIMDRLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEPFFTGHFPHHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAI-HNGF----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +        NG           YL+ ID ARFRKPV PGD+L   V   R    +
Sbjct: 64  AMAQASALFSFTDENGGLKCDGAKTAYYLVGIDGARFRKPVVPGDQLRLEVEAERLSCTI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+  +VAEA++ CA+
Sbjct: 124 CKYQGRALVDGQLVAEAKLMCAI 146


>gi|294501849|ref|YP_003565549.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           megaterium QM B1551]
 gi|294351786|gb|ADE72115.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           megaterium QM B1551]
          Length = 144

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + A+G+KNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIEQIKEIIPHRYPFLLVDRILEVEEGKKAVGLKNVSANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    +Q    +   ID  RF+K V PGD+L   V  VR R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENQGRLAFFAGIDNCRFKKQVRPGDQLRLEVEIVRARGSIGKGKG 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +V E +I    + +KKE
Sbjct: 122 IATVDGELVCETDIM-FALGDKKE 144


>gi|240949510|ref|ZP_04753850.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus minor NM305]
 gi|240296083|gb|EER46744.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus minor NM305]
          Length = 154

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    +KN+T NEP F GHFP +P+ PGVLILE
Sbjct: 15  EVTEIMGMLPHRYPFLLVDRVTDYEEGKWLRAVKNITVNEPCFTGHFPEKPIFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A +    +    Y  +ID ARF++PV PGD+L   V  ++    + KF 
Sbjct: 75  AMAQATGVLAVATYGKMKEGELYYFAAIDNARFKRPVVPGDQLVLEVEFIKEMRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +  EA++ CA
Sbjct: 135 GKAYVDGKLACEADLMCA 152


>gi|148284238|ref|YP_001248328.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Orientia
           tsutsugamushi str. Boryong]
 gi|146739677|emb|CAM79470.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Orientia
           tsutsugamushi str. Boryong]
          Length = 167

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 85/141 (60%), Gaps = 7/141 (4%)

Query: 7   CLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPG 66
            L  +DI+   R +PHRYPFL++DKV+ ++  +  IGIKNVT NEP F GHFP  PVMPG
Sbjct: 13  VLSTQDII---RIIPHRYPFLMIDKVIKLEPGQKIIGIKNVTANEPQFTGHFPNNPVMPG 69

Query: 67  VLILEGMAQTAGAICAIHNGFDQYAPP-YLMSIDKARFRKPVFPGDRL--EYHVNKVRNR 123
           VL +E MAQ +  + A    FD  +   YL++I+  +FRK +  GD +     +++  N+
Sbjct: 70  VLTIESMAQLSAILVAKTIMFDTNSKIFYLINIENVKFRKIITSGDTMVITSKISQAYNK 129

Query: 124 VDLWKFQCCAKVENTVVAEAE 144
             +WKF    K+E T    AE
Sbjct: 130 -SIWKFNAEVKIEGTNNLAAE 149


>gi|308048680|ref|YP_003912246.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Ferrimonas
           balearica DSM 9799]
 gi|307630870|gb|ADN75172.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Ferrimonas
           balearica DSM 9799]
          Length = 149

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 87/142 (61%), Gaps = 3/142 (2%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L+  DI E++ +LPHR+PF+LVD+V+ I   E  +  KNVTFNEP F GHFP   +MPGV
Sbjct: 5   LNTMDIQEILDYLPHRHPFVLVDRVLEIVPGERLVARKNVTFNEPFFPGHFPNMAIMPGV 64

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LILE +AQ A AI A      Q    YL + ID ARF++PV PGD L   V  ++ R  +
Sbjct: 65  LILEALAQ-ASAILAFKTHGKQDNALYLFAGIDNARFKQPVVPGDSLTLEVEAIKERRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
             +   A V+  VV  A++ CA
Sbjct: 124 GFYSARALVDGKVVCSADLMCA 145


>gi|228993957|ref|ZP_04153859.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           pseudomycoides DSM 12442]
 gi|229000028|ref|ZP_04159599.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides Rock3-17]
 gi|229007546|ref|ZP_04165141.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides Rock1-4]
 gi|228753684|gb|EEM03127.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides Rock1-4]
 gi|228759712|gb|EEM08687.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           mycoides Rock3-17]
 gi|228765755|gb|EEM14407.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           pseudomycoides DSM 12442]
          Length = 144

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 87/144 (60%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + A+GIKNVT NE +F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIKEIIPHRYPFLLVDQILEVEEGKRAVGIKNVTANEEYFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAVLKKEENRGRLAFFAGIDNCRFKRQVRPGDQLRLEVEMTRVRGPIGKGKA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V   +  EAE+    + +KKE
Sbjct: 122 VATVNGEIACEAEVT-FALGDKKE 144


>gi|225175282|ref|ZP_03729277.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169034|gb|EEG77833.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Dethiobacter alkaliphilus AHT 1]
          Length = 144

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 88/143 (61%), Gaps = 8/143 (5%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++   LPHRYPFLLVDK++++   +SA G+KNVT NEP F GHFPG PVMPGVLI+E MA
Sbjct: 6   DIQSVLPHRYPFLLVDKMLDVVPGQSAKGMKNVTINEPFFQGHFPGYPVMPGVLIVEAMA 65

Query: 75  QTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDR--LEYHVNKVRNRVDLWKFQC 131
           Q    AI ++    D+ A      ID  RF+K V PGD   LE  + K+R  V   K + 
Sbjct: 66  QVGAFAILSMEGNDDKLA--LFTGIDNLRFKKQVVPGDTLVLEMEIQKIRGPVG--KGRG 121

Query: 132 CAKVENTVVAEAEIC-AMVMHEK 153
            A VE  VVA  ++  A+V  E+
Sbjct: 122 TATVEGKVVASGDLMFALVDKEQ 144


>gi|311033280|ref|ZP_07711370.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus sp. m3-13]
          Length = 143

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+   +PHRYPFLL+D++V I+  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DINEIKAIIPHRYPFLLIDRIVEIEEGQRAIGIKNVTANEEFFNGHFPEFPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF+K V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENKGRLAFFTGIDNCRFKKQVVPGDQLRLEVEMTRVRGSIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +V E E+
Sbjct: 122 VATVDGQLVCELEM 135


>gi|257464975|ref|ZP_05629346.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus minor 202]
 gi|257450635|gb|EEV24678.1| (3R)-hydroxymyristoyl-ACP dehydratase [Actinobacillus minor 202]
          Length = 154

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    +KN+T NEP F GHFP +P+ PGVLILE
Sbjct: 15  EVTEIMGMLPHRYPFLLVDRVTDYEEGKWLRAVKNITVNEPCFTGHFPEKPIFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A +    +    Y  +ID ARF++PV PGD+L   V  ++    + KF 
Sbjct: 75  AMAQATGVLAVATYGKMKEGELYYFAAIDNARFKRPVVPGDQLVLEVEFIKEMRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +  EA++ CA
Sbjct: 135 GKAYVDGKLACEADLMCA 152


>gi|170076705|ref|YP_001733343.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. PCC 7002]
 gi|190359432|sp|B1XLC7|FABZ_SYNP2 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|169884374|gb|ACA98087.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Synechococcus sp. PCC 7002]
          Length = 155

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 10/137 (7%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPF LVD+++     E A+G+KN+TFNEPHF GH P  P+MPGVL++E MA
Sbjct: 17  EIQKLLPHRYPFSLVDRILEYIPGEKAVGLKNITFNEPHFQGHIPNHPIMPGVLMVEAMA 76

Query: 75  QTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD-LWKF 129
           Q  G I      + + F  +A      IDK RFR+PV PGD+L   V  +  +   + K 
Sbjct: 77  QVGGFILTQMPGMEDSFFAFA-----GIDKVRFRRPVVPGDQLIMTVEVITVKAKRIAKM 131

Query: 130 QCCAKVENTVVAEAEIC 146
           + C  V+  V  E E+ 
Sbjct: 132 KGCGTVDGQVAVEGEML 148


>gi|296313400|ref|ZP_06863341.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           polysaccharea ATCC 43768]
 gi|296840111|gb|EFH24049.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           polysaccharea ATCC 43768]
          Length = 149

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNV+ NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVSINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAVIMCA 145


>gi|322514259|ref|ZP_08067320.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus ureae ATCC 25976]
 gi|322119871|gb|EFX91885.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Actinobacillus ureae ATCC 25976]
          Length = 154

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    +KNVT NEP F GHFP  P+ PGVLILE
Sbjct: 15  EVTEIMNMLPHRYPFLLVDRVTDYEEGKWLKAVKNVTVNEPCFTGHFPANPIFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +    H   +     Y  +ID ARF++PV PGD+L   V  ++    + KF 
Sbjct: 75  AMAQATGVLAVTTHGKMNPDELYYFAAIDNARFKRPVVPGDQLVLEVEFLKEMRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V+  +  EA++ CA
Sbjct: 135 GKAYVDGKLACEADLMCA 152


>gi|68304070|gb|AAY89693.1| FabZ [Escherichia coli LW1655F+]
          Length = 166

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 24  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 83

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 84  AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 143

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 144 GVALVDGKVVCEATMMCA 161


>gi|219848803|ref|YP_002463236.1| (3R)-hydroxymyristoyl-ACP dehydratase [Chloroflexus aggregans DSM
           9485]
 gi|254788922|sp|B8GBH2|FABZ_CHLAD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|219543062|gb|ACL24800.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chloroflexus aggregans DSM 9485]
          Length = 144

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 88/145 (60%), Gaps = 5/145 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E+M  +PHRYPFLLVD++V ++    A+G K V+ NEP+F GHFPG P+MPGVLILE
Sbjct: 3   SIQEIMALIPHRYPFLLVDRIVELEPGVRAVGEKLVSANEPYFQGHFPGNPIMPGVLILE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLM--SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQT GA+ A+     ++A   ++   ID ARF++ V PGD L   V   R R  + K 
Sbjct: 63  ALAQT-GAVAALS--LPEHAGKLVLFAGIDGARFKRVVRPGDTLRLEVQLERMRRGIGKG 119

Query: 130 QCCAKVENTVVAEAEICAMVMHEKK 154
           Q  A V + +  EAE+   V    K
Sbjct: 120 QARATVADQLACEAELLFAVTDPTK 144


>gi|297531532|ref|YP_003672807.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. C56-T3]
 gi|297254784|gb|ADI28230.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. C56-T3]
          Length = 145

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD++V I+  + A+GIKNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIQSIIPHRYPFLLVDRIVEIEEGKRAVGIKNVSANESFFAGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  + +  ++    +   ID  RF+K V PGD+L   V  +R R  + K + 
Sbjct: 63  ALAQV-GAVVLLQSEENRGRLAFFAGIDNCRFKKQVKPGDQLRLEVEILRARGAIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +V E E+
Sbjct: 122 IATVDGELVCETEL 135


>gi|323143571|ref|ZP_08078248.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Succinatimonas hippei YIT 12066]
 gi|322416634|gb|EFY07291.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Succinatimonas hippei YIT 12066]
          Length = 157

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (60%), Gaps = 15/145 (10%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQ-RDE--SAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           I ++M  LPHRYPFL+VD+V++    DE  +   IKN++FNEP F GHFPG+PV+PGVLI
Sbjct: 14  IEQIMNLLPHRYPFLMVDRVIDYSITDEHKTLRAIKNISFNEPFFQGHFPGKPVLPGVLI 73

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LE MAQ  G +      F     P      Y  +ID ARF++PV PGD+L   V  ++ +
Sbjct: 74  LEAMAQATGVLA-----FTMVGKPEPDELYYFAAIDNARFKRPVVPGDQLVLDVEFLKEK 128

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             +  F+  A V+  +V  A++ CA
Sbjct: 129 RGIASFKGVATVDGEIVCSADLMCA 153


>gi|220909859|ref|YP_002485170.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Cyanothece sp. PCC 7425]
 gi|219866470|gb|ACL46809.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Cyanothece sp. PCC 7425]
          Length = 166

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 4/148 (2%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           +I   A L    + E+   LPHRYPFLLVD+++     + A+G+KNVT NE  F GHFPG
Sbjct: 16  VIPPAATLPMLTVEEIQNLLPHRYPFLLVDRIIEHVPGQRAVGLKNVTVNEQFFQGHFPG 75

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDR--LEYHVN 118
           RP+MPGVLI+E MAQ  G +     G +     +   IDK RFR+PV PGD+  L   + 
Sbjct: 76  RPIMPGVLIVEAMAQVGGIVLMQMGGLEGKLSLF-AGIDKVRFRRPVVPGDQLILTAELL 134

Query: 119 KVRNRVDLWKFQCCAKVENTVVAEAEIC 146
            V+ R    K Q  A+V   + AE E+ 
Sbjct: 135 WVKQR-RFGKMQTRAEVGGELAAEGELM 161


>gi|261420738|ref|YP_003254420.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacillus sp. Y412MC61]
 gi|319768408|ref|YP_004133909.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. Y412MC52]
 gi|261377195|gb|ACX79938.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. Y412MC61]
 gi|317113274|gb|ADU95766.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. Y412MC52]
          Length = 145

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD++V I+  + A+GIKNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIQSIIPHRYPFLLVDRIVEIEEGKRAVGIKNVSANESFFAGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  + +  ++    +   ID  RF+K V PGD+L   V  +R R  + K + 
Sbjct: 63  ALAQV-GAVVLLQSEENRGRLAFFAGIDNCRFKKQVKPGDQLRLEVEILRARGAIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +V E E+
Sbjct: 122 IAAVDGELVCETEL 135


>gi|119511194|ref|ZP_01630311.1| (3R)-hydroxymyristoyl ACP dehydratase [Nodularia spumigena CCY9414]
 gi|119464182|gb|EAW45102.1| (3R)-hydroxymyristoyl ACP dehydratase [Nodularia spumigena CCY9414]
          Length = 169

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 85/139 (61%), Gaps = 12/139 (8%)

Query: 14  VELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGM 73
           VE+ + LPHRYPFLLVDK+++    + A+G+KN+T NEP F GHFP +P+MPGVLI+E M
Sbjct: 32  VEIQKLLPHRYPFLLVDKIIDYVPGKLAVGVKNITVNEPQFTGHFPEQPLMPGVLIVEAM 91

Query: 74  AQTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK--VRNRVDLW 127
           AQ  G I      + +G   +A      IDK RFR+ V PGD+L   V    ++ R    
Sbjct: 92  AQVGGIILKQLPGLEDGLFVFA-----GIDKVRFRRQVVPGDQLVMTVELLWIKQR-RFS 145

Query: 128 KFQCCAKVENTVVAEAEIC 146
           K Q  A+V+  + AE E+ 
Sbjct: 146 KMQARAEVDGQLAAEGELM 164


>gi|121634054|ref|YP_974299.1| (3R)-hydroxymyristoyl-ACP dehydratase [Neisseria meningitidis
           FAM18]
 gi|254805777|ref|YP_003083998.1| 3R-hydroxymyristoyl ACP dehydrase [Neisseria meningitidis alpha14]
 gi|158513132|sp|A1KRL1|FABZ_NEIMF RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|120865760|emb|CAM09489.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Neisseria
           meningitidis FAM18]
 gi|254669319|emb|CBA08338.1| 3R-hydroxymyristoyl ACP dehydrase [Neisseria meningitidis alpha14]
 gi|254670399|emb|CBA05936.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase [Neisseria
           meningitidis alpha153]
 gi|325129098|gb|EGC51947.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis N1568]
 gi|325133093|gb|EGC55765.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis M6190]
 gi|325139071|gb|EGC61617.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           meningitidis ES14902]
          Length = 149

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           ++AKDI +L   +PHRYPFL +D++   +  ++   IKNV+ NEP F GHFP  PVMPGV
Sbjct: 7   IEAKDIQKL---IPHRYPFLQLDRITAFEPMKTLTAIKNVSINEPQFQGHFPDLPVMPGV 63

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           LI+E MAQ  G +  +  G  +    +  + ID+ARF++ V PGD+L + V  + +R  +
Sbjct: 64  LIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSRRGI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CA 147
            KF   AKV+  V  EA I CA
Sbjct: 124 GKFNAVAKVDGQVAVEAIIMCA 145


>gi|226945930|ref|YP_002801003.1| (3R)-hydroxymyristoyl-ACP dehydratase [Azotobacter vinelandii DJ]
 gi|259646348|sp|C1DST5|FABZ_AZOVD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|226720857|gb|ACO80028.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Azotobacter vinelandii DJ]
          Length = 146

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV++  +   I   KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVDLDVEGQRIRAYKNVSINEPFFNGHFPQHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E MAQ AG +     GF      P      Y +  DK RFR+PV PGD+L      +  +
Sbjct: 63  EAMAQAAGIL-----GFKMLDVKPADGTIYYFVGSDKMRFRQPVIPGDQLILEARFLSAK 117

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF+C A V++  V   E ICA
Sbjct: 118 RSIWKFECQALVDDKQVCSGEIICA 142


>gi|301049906|ref|ZP_07196832.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 185-1]
 gi|300298359|gb|EFJ54744.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli MS 185-1]
          Length = 186

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 44  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 103

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 104 AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 163

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 164 GVALVDGKVVCEATMMCA 181


>gi|153940033|ref|YP_001392952.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum F str.
           Langeland]
 gi|190359379|sp|A7GJJ2|FABZ_CLOBL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|152935929|gb|ABS41427.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum F str. Langeland]
 gi|295320929|gb|ADG01307.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum F str. 230613]
          Length = 144

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLVDKITELEEGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD L+  ++  + +      + 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLKLSIDLTKIKGVAGVGKA 124

Query: 132 CAKVENTVVAEAEICAMV 149
            A V+  V AEAE+  +V
Sbjct: 125 VATVDGKVAAEAELLFVV 142


>gi|55670131|pdb|1U1Z|A Chain A, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
 gi|55670132|pdb|1U1Z|B Chain B, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
 gi|55670133|pdb|1U1Z|C Chain C, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
 gi|55670134|pdb|1U1Z|D Chain D, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
 gi|55670135|pdb|1U1Z|E Chain E, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
 gi|55670136|pdb|1U1Z|F Chain F, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz)
          Length = 168

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 85/145 (58%), Gaps = 14/145 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +  +   I   KNV+ NEP F GHFP  P+ PGVLI+
Sbjct: 23  DINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIXPGVLII 82

Query: 71  EGMAQTAGAICAIHNGFDQY-APP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           E  AQ AG +     GF      P      Y +  DK RFR+PV PGD+L+ H   +  +
Sbjct: 83  EAXAQAAGIL-----GFKXLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVK 137

Query: 124 VDLWKFQCCAKVENTVVAEAE-ICA 147
             +WKF C A V++  V  AE ICA
Sbjct: 138 RSIWKFDCHATVDDKPVCSAEIICA 162


>gi|303248487|ref|ZP_07334745.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio fructosovorans JJ]
 gi|302490107|gb|EFL50027.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Desulfovibrio fructosovorans JJ]
          Length = 154

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 1/145 (0%)

Query: 10  AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           A  + E+   LPHRYPFLLVD+V+  +   S   IKNVT NEP F GHFPG PVMPG+LI
Sbjct: 8   AIAVTEIFDLLPHRYPFLLVDRVLEYEPGVSITAIKNVTVNEPFFQGHFPGLPVMPGMLI 67

Query: 70  LEGMAQTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           LE +AQ  G + +           ++ + ++KA+FR+PV PGD+L      ++ R+ L +
Sbjct: 68  LEALAQAGGLLVSKSLEGPLGDRIFMFTGVEKAKFRRPVTPGDQLVLRCFDLKRRMTLCR 127

Query: 129 FQCCAKVENTVVAEAEICAMVMHEK 153
               A V+  + AEAE+ A V+ + 
Sbjct: 128 MHVEATVDGKIAAEAELSAAVVDKS 152


>gi|261409666|ref|YP_003245907.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. Y412MC10]
 gi|329928759|ref|ZP_08282608.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. HGF5]
 gi|261286129|gb|ACX68100.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. Y412MC10]
 gi|328937540|gb|EGG33958.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Paenibacillus sp. HGF5]
          Length = 143

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++   +PHR PFLLVDK+V I+  + A+GIKNVT NEP F+GHFP   VMPGVLI+E
Sbjct: 3   NIKQIQEIIPHRPPFLLVDKIVEIEDGKRAVGIKNVTINEPFFVGHFPEYAVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  ++   ++    +L  ID  RFR  V PGD L   V  +R +  + K + 
Sbjct: 63  ALAQV-GAVAILNVESNRGKLGFLAGIDGFRFRGQVVPGDTLRLEVEIIRLKGMIGKGKA 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  VVAE EI
Sbjct: 122 TATVDGRVVAEGEI 135


>gi|148553394|ref|YP_001260976.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Sphingomonas
           wittichii RW1]
 gi|190359448|sp|A5V3H2|FABZ_SPHWW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|148498584|gb|ABQ66838.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Sphingomonas
           wittichii RW1]
          Length = 157

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 80/139 (57%), Gaps = 1/139 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+  +M  LPHRYP LLVD+V  +  DE    IK VT NE  F GHFPGRP+MPGVLI+E
Sbjct: 13  DVRRVMAALPHRYPLLLVDRVEELVVDERITAIKAVTINENFFQGHFPGRPIMPGVLIVE 72

Query: 72  GMAQTAGAICAIHNGFDQYAP-PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ AG +     G        Y M+ID+ +FR PV PG  L   V   + R  + KF+
Sbjct: 73  AMAQAAGVLAVESLGLAGSGKLVYFMTIDEVKFRTPVEPGVLLRLEVAFAQKRGSVCKFE 132

Query: 131 CCAKVENTVVAEAEICAMV 149
             A + + + A+A   AM+
Sbjct: 133 GKAYIGDKLAAQANFTAMI 151


>gi|71278178|ref|YP_268306.1| (3R)-hydroxymyristoyl-ACP dehydratase [Colwellia psychrerythraea
           34H]
 gi|91206628|sp|Q485F9|FABZ_COLP3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|71143918|gb|AAZ24391.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Colwellia
           psychrerythraea 34H]
          Length = 150

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+   +PHRYP LLVDKV++ +  ++   IKNVT NEP F GHFP   + PGVLILE
Sbjct: 9   DLNEIKTLIPHRYPMLLVDKVIDHEPGKTLHAIKNVTINEPVFTGHFPELAIFPGVLILE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            +AQ  G +             YL  SIDKA+F+KPV PGD +  HV  ++ R  +WKF 
Sbjct: 69  ALAQATGILGFKSTEGRGDNEMYLFASIDKAKFKKPVLPGDTMHLHVEFLKERRGMWKFY 128

Query: 131 CCAKVENTVVAEAEI-CA 147
             A+V+  VV  A++ CA
Sbjct: 129 GEARVDGKVVCSADLMCA 146


>gi|33596185|ref|NP_883828.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella parapertussis
           12822]
 gi|33573188|emb|CAE36840.1| (3R)-hydroxymyristol-[acyl carrier protein] dehydratase [Bordetella
           parapertussis]
          Length = 167

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 86/143 (60%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+V+ +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 20  DIKGIMDRLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEPFFTGHFPHHPVMPGVLIVE 79

Query: 72  GMAQTAGAICAI-HNGF----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +        NG           YL+ ID ARFRKPV PGD+L   V   R    +
Sbjct: 80  AMAQASALFSFTDENGGLKCDGAKTAYYLVGIDGARFRKPVVPGDQLRLEVEAERLSCTI 139

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+  +VAEA++ CA+
Sbjct: 140 CKYQGRALVDGQLVAEAKLMCAI 162


>gi|33592528|ref|NP_880172.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella pertussis Tohama
           I]
 gi|33601593|ref|NP_889153.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella bronchiseptica
           RB50]
 gi|47605655|sp|Q7VYB9|FABZ_BORPE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|47605658|sp|Q7WJ83|FABZ_BORBR RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|33572174|emb|CAE41720.1| (3R)-hydroxymyristol-[acyl carrier protein] dehydratase [Bordetella
           pertussis Tohama I]
 gi|33576029|emb|CAE33109.1| (3R)-hydroxymyristol-[acyl carrier protein] dehydratase [Bordetella
           bronchiseptica RB50]
 gi|332381946|gb|AEE66793.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella pertussis CS]
          Length = 151

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 86/143 (60%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+V+ +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKGIMDRLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEPFFTGHFPHHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAI-HNGF----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +        NG           YL+ ID ARFRKPV PGD+L   V   R    +
Sbjct: 64  AMAQASALFSFTDENGGLKCDGAKTAYYLVGIDGARFRKPVVPGDQLRLEVEAERLSRTI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+  +VAEA++ CA+
Sbjct: 124 CKYQGRALVDGQLVAEAKLMCAI 146


>gi|26246126|ref|NP_752165.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli CFT073]
 gi|91209250|ref|YP_539236.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli UTI89]
 gi|110804232|ref|YP_687752.1| (3R)-hydroxymyristoyl-ACP dehydratase [Shigella flexneri 5 str.
           8401]
 gi|293476837|ref|ZP_06665245.1| 3R-hydroxymyristoyl ACP dehydrase [Escherichia coli B088]
 gi|26106523|gb|AAN78709.1|AE016755_209 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Escherichia coli CFT073]
 gi|91070824|gb|ABE05705.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia
           coli UTI89]
 gi|110613780|gb|ABF02447.1| (3R)-hydroxymyristol acyl carrier protein dehydratase [Shigella
           flexneri 5 str. 8401]
 gi|281599535|gb|ADA72519.1| FabZ [Shigella flexneri 2002017]
 gi|291321290|gb|EFE60732.1| 3R-hydroxymyristoyl ACP dehydrase [Escherichia coli B088]
          Length = 182

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE
Sbjct: 40  QIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILE 99

Query: 72  GMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+
Sbjct: 100 AMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFK 159

Query: 131 CCAKVENTVVAEAE-ICA 147
             A V+  VV EA  +CA
Sbjct: 160 GVALVDGKVVCEATMMCA 177


>gi|167038470|ref|YP_001666048.1| (3R)-hydroxymyristoyl-ACP dehydratase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256751335|ref|ZP_05492214.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|320116864|ref|YP_004187023.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|226700821|sp|B0K7E6|FABZ_THEP3 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166857304|gb|ABY95712.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749717|gb|EEU62742.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|319929955|gb|ADV80640.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 142

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPFLLVD+++ I+  + A+GIKNVT NEP F GHFP  P+MPGVLI+E +A
Sbjct: 5   DIRKILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQGHFPDNPIMPGVLIVEALA 64

Query: 75  QTAG-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q AG A+  I     +        IDK RF+K V PGD+L   V     ++ L K +  A
Sbjct: 65  QVAGIAVMNIEEFKGKLG--LFTGIDKCRFKKVVRPGDQLVLEVLIDSIKMGLVKAKGVA 122

Query: 134 KVENTVVAEAEICAMVMHE 152
           KV + V A AE+  ++  E
Sbjct: 123 KVGDEVAATAELMFIMTEE 141


>gi|157147388|ref|YP_001454707.1| (3R)-hydroxymyristoyl-ACP dehydratase [Citrobacter koseri ATCC
           BAA-895]
 gi|157084593|gb|ABV14271.1| hypothetical protein CKO_03186 [Citrobacter koseri ATCC BAA-895]
          Length = 195

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 84/137 (61%), Gaps = 2/137 (1%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEG 72
           I E++  LPHR+PFLLVD+V++ +       +KNV+ NEP F GHFPG+P+ PGVLILE 
Sbjct: 54  IEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILEA 113

Query: 73  MAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
           MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V   + R  L +F+ 
Sbjct: 114 MAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKG 173

Query: 132 CAKVENTVVAEAE-ICA 147
            A V+  VV EA  +CA
Sbjct: 174 VALVDGKVVCEATMMCA 190


>gi|33152296|ref|NP_873649.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase [Haemophilus
           ducreyi 35000HP]
 gi|47605651|sp|Q7VM25|FABZ_HAEDU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|33148519|gb|AAP96038.1| (3R)-hydroxymyristoyl-acyl carrier protein dehydratase [Haemophilus
           ducreyi 35000HP]
          Length = 154

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 82/138 (59%), Gaps = 2/138 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+M  LPHRYPFLLVD+V + +  +    IKNVT NEP F GHFP  PV PGVLILE
Sbjct: 15  EVTEIMNMLPHRYPFLLVDRVTDYEEGKWLRAIKNVTVNEPCFTGHFPSSPVFPGVLILE 74

Query: 72  GMAQTAGAIC-AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  G +  A +    +    Y  +ID ARF++PV PGD+L   V  ++    + KF 
Sbjct: 75  AMAQATGVLAVATYGKMREDELYYFAAIDNARFKRPVVPGDQLVLEVEFLKEIRGITKFT 134

Query: 131 CCAKVENTVVAEAEI-CA 147
             A V   +  EA++ CA
Sbjct: 135 GKAYVNGKLACEADLMCA 152


>gi|322807920|emb|CBZ05495.1| (3r)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Clostridium botulinum H04402 065]
          Length = 144

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 5/140 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLVDKITELEEGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKF 129
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD  +L   + K++    + K 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLKLSIELTKIKGVAGVGK- 123

Query: 130 QCCAKVENTVVAEAEICAMV 149
              A V+  V AEAE+  ++
Sbjct: 124 -AVATVDGKVAAEAELLFVI 142


>gi|315641170|ref|ZP_07896247.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Enterococcus italicus DSM 15952]
 gi|315482937|gb|EFU73456.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Enterococcus italicus DSM 15952]
          Length = 142

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           + +  I E+   +PHRYP LL+D+V  +   E  I  KNVT NEP F GHFP  PVMPGV
Sbjct: 1   MTSLSITEIKEIIPHRYPMLLIDRVEELVVGERIIAKKNVTINEPFFQGHFPHEPVMPGV 60

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E MAQ AGA+  +     +    Y   IDKA+FRK V PGD L   V  ++ + +  
Sbjct: 61  LIIEAMAQ-AGAVALLSIEEFKGKTAYFGGIDKAKFRKKVTPGDTLILEVELLKVKANAG 119

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
             +  AKV+   VAEAE+  M+
Sbjct: 120 MGKGIAKVDGKKVAEAELTFMI 141


>gi|145300050|ref|YP_001142891.1| (3R)-hydroxymyristoyl-ACP dehydratase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|172044431|sp|A4SQH1|FABZ_AERS4 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|142852822|gb|ABO91143.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 153

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 84/145 (57%), Gaps = 15/145 (10%)

Query: 13  IVELMRFLPHRYPFLLVDKVVNIQ-RDESAI--GIKNVTFNEPHFMGHFPGRPVMPGVLI 69
           I E+M  LPHRYPFL+VD+V + +  DE      IKNV+FNEP F GHFP +PV PGVLI
Sbjct: 10  IQEIMDLLPHRYPFLMVDRVDDYEISDERKTLRAIKNVSFNEPIFQGHFPAKPVFPGVLI 69

Query: 70  LEGMAQTAGAICAIHNGFDQYAPP------YLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123
           LE MAQ  G +      F     P      Y  SID ARF++PV PGD+L   V  ++ R
Sbjct: 70  LEAMAQATGILA-----FTMVGKPSPNELYYFASIDNARFKRPVGPGDQLVLDVEFLKER 124

Query: 124 VDLWKFQCCAKVENTVVAEAEI-CA 147
             + KF   A V   VV  AE+ CA
Sbjct: 125 RGIAKFTGVATVNGEVVCTAELMCA 149


>gi|320102299|ref|YP_004177890.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Isosphaera pallida ATCC 43644]
 gi|319749581|gb|ADV61341.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Isosphaera pallida ATCC 43644]
          Length = 448

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           ++SD   L  ++I+E+   LPHRYPFLLVD++  I+ +     IKNVT NEP FMGH+P 
Sbjct: 289 LLSDSTALGIREIMEI---LPHRYPFLLVDRIEWIEPNRRLEAIKNVTINEPCFMGHWPS 345

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           +PV+PGVLI+E +AQ  G + +    ++      L +I + RFR+P+ PGD+L   V  V
Sbjct: 346 QPVLPGVLIVEALAQAGGVLLSRSPRYEARR-GMLAAIQRVRFRRPIVPGDQLRLLVEVV 404

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           R R    + +  A  +  V AEA     ++H+  E
Sbjct: 405 RARASAVELKAVATCQGDVAAEAVFT--LVHQSDE 437


>gi|323446671|gb|EGB02748.1| hypothetical protein AURANDRAFT_17075 [Aureococcus anophagefferens]
          Length = 147

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (60%), Gaps = 2/130 (1%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPF LVDKVV  +  ESA+GIK +TFNEP F GHFP RP+MPGV+ +E +A
Sbjct: 8   EVQKILPHRYPFALVDKVVAYEPGESAVGIKQITFNEPQFGGHFPDRPIMPGVMQIEALA 67

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRL--EYHVNKVRNRVDLWKFQCC 132
           Q AG +C    G +  A  +   +D  ++++PV PGD L  E  +   + +  + K    
Sbjct: 68  QLAGVVCLQMEGAEPGAVFFFAGVDGVKWKRPVVPGDTLVMEVEITNWKAKFGIAKATGR 127

Query: 133 AKVENTVVAE 142
           A V+  +  E
Sbjct: 128 AYVDGNLAVE 137


>gi|34497662|ref|NP_901877.1| (3R)-hydroxymyristoyl-ACP dehydratase [Chromobacterium violaceum
           ATCC 12472]
 gi|47605641|sp|Q7NVY3|FABZ_CHRVO RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|34103518|gb|AAQ59880.1| (3R)-hydroxymyristol acyl carrier protein dehydratase
           [Chromobacterium violaceum ATCC 12472]
          Length = 150

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ E+MR LPHRYPFLLVD+V  ++ +     +KNVT NEP F+GHF   PVMPGVLI+E
Sbjct: 9   DVREIMRCLPHRYPFLLVDRVTEMEPNVRIKALKNVTINEPFFVGHFEQYPVMPGVLIIE 68

Query: 72  GMAQTAGAICAIHNGFDQYAPP--YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ AG I AI +  ++      + + ID ARF++ V PGD+L + V ++  +  + K+
Sbjct: 69  ALAQAAG-ILAIKSQGERLENELYFFVGIDNARFKRQVVPGDQLVFEVTQMTVKRGIGKY 127

Query: 130 QCCAKVENTVVAEAEI-CA 147
              A V+  V  EAEI CA
Sbjct: 128 AARALVDGQVACEAEIMCA 146


>gi|282891955|ref|ZP_06300434.1| hypothetical protein pah_c200o124 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498215|gb|EFB40555.1| hypothetical protein pah_c200o124 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 157

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+++ LPHRYPFLLVD++V +  ++  I G KN+TFNE  F GHFPG P+MPGVLIL
Sbjct: 13  DIKEILKILPHRYPFLLVDRIVEMDLEKGYILGQKNITFNESFFQGHFPGAPIMPGVLIL 72

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           E +AQ  G +  +    +      LM++++A+FR PV PGD L              K +
Sbjct: 73  EALAQAGGILVYLKGESEVEKIAVLMNVNQAKFRSPVRPGDVLFLKGEGQHFSKKGGKIK 132

Query: 131 CCAKVENTVVAEAEI 145
             A V N V  EAEI
Sbjct: 133 ATAYVNNKVAVEAEI 147


>gi|167038786|ref|YP_001661771.1| (3R)-hydroxymyristoyl-ACP dehydratase [Thermoanaerobacter sp. X514]
 gi|300913629|ref|ZP_07130946.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter sp. X561]
 gi|307723356|ref|YP_003903107.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter sp. X513]
 gi|226700822|sp|B0K1H6|FABZ_THEPX RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|166853026|gb|ABY91435.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter sp. X514]
 gi|300890314|gb|EFK85459.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter sp. X561]
 gi|307580417|gb|ADN53816.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermoanaerobacter sp. X513]
          Length = 142

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 18  RFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTA 77
           + LPHRYPFLLVD+++ I+  + A+GIKNVT NEP F GHFP  P+MPGVLI+E +AQ A
Sbjct: 8   KILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQGHFPDNPIMPGVLIVEALAQVA 67

Query: 78  G-AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVE 136
           G A+  I     +        IDK RF+K V PGD+L   V     ++ L K +  AKV 
Sbjct: 68  GIAVMNIEEFKGKLG--LFTGIDKCRFKKVVRPGDQLVLEVLIDSIKMGLVKAKGVAKVG 125

Query: 137 NTVVAEAEICAMVMHE 152
           + V A AE+  ++  E
Sbjct: 126 DEVAATAELMFIMTEE 141


>gi|295707197|ref|YP_003600272.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           megaterium DSM 319]
 gi|294804856|gb|ADF41922.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           megaterium DSM 319]
          Length = 144

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + A+G+KNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIEQIKEIIPHRYPFLLVDRILEVEDGKKAVGLKNVSANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    +Q    +   ID  RF+K V PGD+L   V  VR R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENQGRLAFFAGIDNCRFKKQVRPGDQLHLEVEIVRARGSIGKGKG 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +V E +I    + +KKE
Sbjct: 122 IATVDGELVCETDIM-FALGDKKE 144


>gi|148381535|ref|YP_001256076.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum A str.
           ATCC 3502]
 gi|153932539|ref|YP_001385909.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum A str.
           ATCC 19397]
 gi|153934998|ref|YP_001389316.1| (3R)-hydroxymyristoyl-ACP dehydratase [Clostridium botulinum A str.
           Hall]
 gi|190359376|sp|A7FPN7|FABZ_CLOB1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|190359377|sp|A5I7X1|FABZ_CLOBH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|148291019|emb|CAL85156.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Clostridium botulinum A str. ATCC 3502]
 gi|152928583|gb|ABS34083.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum A str. ATCC 19397]
 gi|152930912|gb|ABS36411.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Clostridium botulinum A str. Hall]
          Length = 144

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLLVDK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLVDKITELEEGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD L+  ++  + +      + 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLKLSIDLTKIKGVAGVGKA 124

Query: 132 CAKVENTVVAEAEICAMV 149
            A V+  V AEAE+  ++
Sbjct: 125 VATVDGKVAAEAELLFVI 142


>gi|254513854|ref|ZP_05125915.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [gamma
           proteobacterium NOR5-3]
 gi|219676097|gb|EED32462.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [gamma
           proteobacterium NOR5-3]
          Length = 144

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 82/144 (56%), Gaps = 13/144 (9%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD+VV +   ES +  KN++ NEP F GHFPG PV PGVL LE
Sbjct: 2   DISDIRELLPHRYPFLLVDRVVELVPGESIVAYKNLSINEPFFDGHFPGNPVFPGVLTLE 61

Query: 72  GMAQTAGAICAIHNGFD--QYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            MAQ AG +     GF   Q  P       L+  D  RF++P  PGDR+  H   +  + 
Sbjct: 62  AMAQAAGLL-----GFKTMQKTPADGSIYMLVGADNVRFKRPCVPGDRVYLHAQIIGEKR 116

Query: 125 DLWKFQCCAKVENTVVAEAEI-CA 147
            +WKF   A+V+    A A I CA
Sbjct: 117 GIWKFAVQAEVDGKRCASATILCA 140


>gi|196232094|ref|ZP_03130949.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chthoniobacter flavus Ellin428]
 gi|196223816|gb|EDY18331.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Chthoniobacter flavus Ellin428]
          Length = 435

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 2/137 (1%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           D  D++++M+ LPHRYPFL+VD+VV +  D     IK+V+ NEP F GHFPG P+MPGVL
Sbjct: 294 DILDVMDVMKVLPHRYPFLMVDRVVQLSEDRCT-AIKSVSMNEPFFQGHFPGHPIMPGVL 352

Query: 69  ILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            LE MAQ AG++    +        Y MS D  +FRKPV PGD L   V  ++ +  + K
Sbjct: 353 QLEAMAQ-AGSVLLFKHVNVTGKIGYFMSADSVKFRKPVVPGDTLFIEVELMQKKRAIMK 411

Query: 129 FQCCAKVENTVVAEAEI 145
            +    V   VV+EAE+
Sbjct: 412 ARGRCLVNGEVVSEAEM 428


>gi|85373592|ref|YP_457654.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Erythrobacter litoralis HTCC2594]
 gi|122544863|sp|Q2NBT4|FABZ_ERYLH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|84786675|gb|ABC62857.1| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Erythrobacter litoralis HTCC2594]
          Length = 151

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 84/142 (59%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+V ++   E    +K VT NE  F GHFPG P+MPGVL +E
Sbjct: 8   DIQQVLKALPHRYPLLLVDRVKSMDLGERIHAVKGVTMNEEFFQGHFPGAPIMPGVLQVE 67

Query: 72  GMAQTAGAICAIHN----GFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            MAQ A AI  I      G  +    + M I+ A+FRKPV PG  L+  V   + R  ++
Sbjct: 68  AMAQAA-AILGIETLELAGTGKLV--FFMGIENAKFRKPVTPGCLLDLEVEFTQKRSRVY 124

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           KF+  A VE    +EAE  AM+
Sbjct: 125 KFRGKASVEGVTTSEAEFTAMI 146


>gi|83858377|ref|ZP_00951899.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853200|gb|EAP91052.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 152

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 85/147 (57%), Gaps = 3/147 (2%)

Query: 2   ISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGR 61
           +SDL      D  E++R LPHRYPFLLVD+       ES +G K V+  EPHF GHFP  
Sbjct: 1   MSDLETAIGPD--EILRRLPHRYPFLLVDRAERYVPGESIVGFKCVSAAEPHFQGHFPEN 58

Query: 62  PVMPGVLILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           PVMPGVLI+E MAQT   + +     D      Y M +++A+FR+PV PGD LE  V   
Sbjct: 59  PVMPGVLIIEAMAQTGAILMSKTLDADISNTLIYFMGVEQAKFRRPVRPGDVLEMPVEVT 118

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICA 147
            NR  ++KF+  A+V     A+A   A
Sbjct: 119 ANRRGVFKFKGEARVNGVRCADATFSA 145


>gi|89095668|ref|ZP_01168562.1| (3R)-hydroxymyristoyl ACP dehydratase [Bacillus sp. NRRL B-14911]
 gi|89089414|gb|EAR68521.1| (3R)-hydroxymyristoyl ACP dehydratase [Bacillus sp. NRRL B-14911]
          Length = 144

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ ++  + AIGIKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DINQIKEIIPHRYPFLLVDRILEVEEAQRAIGIKNVTANEEFFNGHFPDYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF++ V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFAGIDNCRFKRQVKPGDQLRLEVEMTRVRGAIGKGKG 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  +V EAE+    + +K+E
Sbjct: 122 TATVDGELVCEAELT-FALGDKQE 144


>gi|167767819|ref|ZP_02439872.1| hypothetical protein CLOSS21_02354 [Clostridium sp. SS2/1]
 gi|317497124|ref|ZP_07955450.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710558|gb|EDS21137.1| hypothetical protein CLOSS21_02354 [Clostridium sp. SS2/1]
 gi|291558850|emb|CBL37650.1| beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ
           [butyrate-producing bacterium SSC/2]
 gi|316895534|gb|EFV17690.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 141

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 5/140 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++M  +PHR PFLLVD++  ++  +  +G K VT+NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKDIMNTIPHRSPFLLVDRIEEMEEGKRIVGKKCVTYNEPFFAGHFPQEPVMPGVLIIE 63

Query: 72  GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQT GA+CA+    D+Y     +L  ++KA+FR  V PGD L   V  ++ +  +   
Sbjct: 64  ALAQT-GAVCALSA--DEYKGKIAFLGGVNKAKFRGKVVPGDVLTLEVEMIKVKGPVGVA 120

Query: 130 QCCAKVENTVVAEAEICAMV 149
           Q  A V+   VA AEI  M+
Sbjct: 121 QGTATVDGKKVASAEITFMI 140


>gi|313903626|ref|ZP_07837016.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466179|gb|EFR61703.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 149

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  ++  LPHRYPFLLVD++++++    A+G K V+ NEP F GHFPGRP+MPGVLILE
Sbjct: 12  DIQAILEVLPHRYPFLLVDRILSLEPGRRAVGRKCVSANEPFFQGHFPGRPIMPGVLILE 71

Query: 72  GMAQT-AGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
            MAQ  A A+ ++     + A       D+ R+R+PV PGD LE  V  +     L K +
Sbjct: 72  AMAQVGAAAVLSVPANRGRLA--LFAGADRVRWRRPVIPGDCLEIEVEIIAMHGPLGKGR 129

Query: 131 CCAKVENTVVAEAEIC 146
             A V+  + AEAE+ 
Sbjct: 130 ARATVDGELAAEAELS 145


>gi|54293499|ref|YP_125914.1| (3R)-hydroxymyristoyl-[acyl carrier protein]dehydratase [Legionella
           pneumophila str. Lens]
 gi|62286753|sp|Q5WZ34|FABZ_LEGPL RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|53753331|emb|CAH14778.1| (3R)-hydroxymyristoyl-[acyl carrier protein]dehydratase [Legionella
           pneumophila str. Lens]
 gi|307609313|emb|CBW98793.1| (3R)-hydroxymyristoyl- [Legionella pneumophila 130b]
          Length = 150

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 6/150 (4%)

Query: 9   DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVL 68
           ++ DI ++   LPHRYPF+LVD+V++ +  E  I IKNVT NE  F GHFPG P+MPGVL
Sbjct: 3   ESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINENFFTGHFPGNPIMPGVL 62

Query: 69  ILEGMAQTAGAICAIH----NGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
           +LE +AQ +G +  +      G++     Y   ID ARF++ V PGD+L   V  V  + 
Sbjct: 63  MLEALAQASGILANLSRQPKEGYEFLH--YFAGIDNARFKQVVIPGDQLRLEVRLVGQKR 120

Query: 125 DLWKFQCCAKVENTVVAEAEICAMVMHEKK 154
           D W+    A + + +   A++ +     KK
Sbjct: 121 DFWRMHGEAYIGDKLACSADLLSATKEIKK 150


>gi|157159645|ref|YP_001456963.1| (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli HS]
 gi|166971618|sp|A7ZWC6|FABZ_ECOHS RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|157065325|gb|ABV04580.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Escherichia coli HS]
          Length = 151

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (59%), Gaps = 5/149 (3%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           M ++   L  ++I+EL   LPHR+PFLLVD+V++ +       +KNV+ NE  F GHFPG
Sbjct: 1   MTTNTHTLQIEEILEL---LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNESFFQGHFPG 57

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK 119
           +P+ PGVLILE MAQ  G +     G  +     Y   ID+ARF++PV PGD++   V  
Sbjct: 58  KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF 117

Query: 120 VRNRVDLWKFQCCAKVENTVVAEAE-ICA 147
            + R  L +F+  A V+  VV EA  +CA
Sbjct: 118 EKTRRGLTRFKGVALVDGKVVCEATMMCA 146


>gi|20806701|ref|NP_621872.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratase [Thermoanaerobacter tengcongensis MB4]
 gi|24211698|sp|Q8RD71|FABZ_THETN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|20515155|gb|AAM23476.1| 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
           dehydratases [Thermoanaerobacter tengcongensis MB4]
          Length = 141

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 88/139 (63%), Gaps = 3/139 (2%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           ++ + LPHRYPFLLVD+++ ++  + A+GIKNVT NEP F GHFP  P+MPGVLI+E +A
Sbjct: 5   DIRKILPHRYPFLLVDRIIELEEGKRAVGIKNVTSNEPFFQGHFPDNPIMPGVLIVEALA 64

Query: 75  QTAGAICAIHNGFDQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCA 133
           Q AG   A+ N  +      L + IDK RF+K V PGD+L   V+    R+ L K +  A
Sbjct: 65  QVAG--IAVMNVEEFKGKLGLFAGIDKCRFKKVVRPGDQLILEVSIDSIRMGLVKAKGVA 122

Query: 134 KVENTVVAEAEICAMVMHE 152
           KV   + A AE+  ++  E
Sbjct: 123 KVGEEIAATAELMFVMAEE 141


>gi|237740036|ref|ZP_04570517.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Fusobacterium sp. 2_1_31]
 gi|229422053|gb|EEO37100.1| 3-hydroxymyristoyl-(acyl carrier protein) dehydratase
           [Fusobacterium sp. 2_1_31]
          Length = 141

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           D++E+M+ +PHRYPFLLVD+++ + ++   I G KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DVLEIMKRIPHRYPFLLVDRILEMDKENQTIKGKKNVTINEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  +   F     PY  +I+ A+F+ PV PGD L Y V   + + +  K  
Sbjct: 63  EGMAQCLGVM--VMENFSGKV-PYFAAIESAKFKNPVKPGDTLIYDVKVDKVKRNFVKAT 119

Query: 131 CCAKVENTVVAEAEICAMV 149
               V++ VVAEA    ++
Sbjct: 120 GKTYVDDAVVAEANFTFVI 138


>gi|159903931|ref|YP_001551275.1| putative (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Prochlorococcus marinus str. MIT 9211]
 gi|159889107|gb|ABX09321.1| Putative (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
           [Prochlorococcus marinus str. MIT 9211]
          Length = 135

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 17  MRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQT 76
           M  LPHRYPF LVD+V++ Q  +SA+ IKNVT NEP F GHFPGRP+MPGVLI+E MAQ 
Sbjct: 1   MGLLPHRYPFALVDRVIDYQPGKSAVAIKNVTVNEPQFQGHFPGRPLMPGVLIVEAMAQV 60

Query: 77  AGAICA----IHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVR-NRVDLWKFQC 131
            G I      +  G   +A      ID  RFR+PV PGD+L      +   R    K + 
Sbjct: 61  GGLIVTQMPDLPKGLFVFA-----GIDGVRFRRPVVPGDQLTIGCELISIKRQRFGKVKG 115

Query: 132 CAKVENTVVAEAEI 145
            AKV+  +V   E+
Sbjct: 116 EAKVDGQLVCSGEL 129


>gi|229542506|ref|ZP_04431566.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           coagulans 36D1]
 gi|229326926|gb|EEN92601.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           coagulans 36D1]
          Length = 141

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++   LPHRYPFLL+D+++ ++  + A+GIKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 3   DLQQIKDILPHRYPFLLIDRILEVEEGKRAVGIKNVSGNEPFFAGHFPSYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++        IDK RF++ V PGD+L   V  +R +  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGKLALFAGIDKCRFKRQVKPGDQLHLEVEIIRLKGPVGKGKA 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +  EAEI
Sbjct: 122 VATVDGELACEAEI 135


>gi|330968949|gb|EGH69015.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 139

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 80/133 (60%), Gaps = 4/133 (3%)

Query: 19  FLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTA 77
           +LPHRYPFLLVD+V  +  +   I   KNV+ NEP F GHFP  P+MPGVLI+E MAQ A
Sbjct: 3   YLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPEHPIMPGVLIIEAMAQAA 62

Query: 78  G--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV 135
           G  A   + +        Y +  DK RFR+PV PGD+L      + ++  +WKF+C A V
Sbjct: 63  GILAFKMLDSKPSDGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSSKRQIWKFECKATV 122

Query: 136 ENTVVAEAE-ICA 147
           +   V  AE ICA
Sbjct: 123 DGKAVCSAEIICA 135


>gi|52082160|ref|YP_080951.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus licheniformis ATCC
           14580]
 gi|52787552|ref|YP_093381.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bacillus licheniformis ATCC
           14580]
 gi|319648037|ref|ZP_08002254.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           sp. BT1B_CT2]
 gi|62286779|sp|Q65E26|FABZ_BACLD RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|52005371|gb|AAU25313.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Bacillus
           licheniformis ATCC 14580]
 gi|52350054|gb|AAU42688.1| YwpB [Bacillus licheniformis ATCC 14580]
 gi|317389672|gb|EFV70482.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           sp. BT1B_CT2]
          Length = 144

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 90/148 (60%), Gaps = 5/148 (3%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           LDA+ I E+   +PHRYPFLLVD+V  ++  + A G KNVT NE  F GHFP  PVMPGV
Sbjct: 2   LDAQQIKEI---IPHRYPFLLVDRVTEVEEGKRAAGYKNVTVNEEFFNGHFPDYPVMPGV 58

Query: 68  LILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           LI+E +AQ  GA+  +    ++    +   ID  RF+K V PGD+L   +  +R R  + 
Sbjct: 59  LIVEALAQV-GAVALLMKEENRGRLAFFAGIDSCRFKKQVKPGDQLHLELEVLRFRGSIG 117

Query: 128 KFQCCAKVENTVVAEAEICAMVMHEKKE 155
           K +  AKV+  VV EAE+    + EK+E
Sbjct: 118 KGKGVAKVDGEVVCEAELM-FSLGEKQE 144


>gi|330868553|gb|EGH03262.1| (3R)-hydroxymyristoyl-ACP dehydratase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 138

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 80/133 (60%), Gaps = 4/133 (3%)

Query: 19  FLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTA 77
           +LPHRYPFLLVD+V  +  +   I   KNV+ NEP F GHFP  P+MPGVLI+E MAQ A
Sbjct: 2   YLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPEHPIMPGVLIIEAMAQAA 61

Query: 78  G--AICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKV 135
           G  A   + +        Y +  DK RFR+PV PGD+L      + ++  +WKF+C A V
Sbjct: 62  GILAFKMLDSKPSDGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSSKRQIWKFECKATV 121

Query: 136 ENTVVAEAE-ICA 147
           +   V  AE ICA
Sbjct: 122 DGKAVCSAEIICA 134


>gi|187478239|ref|YP_786263.1| (3R)-hydroxymyristoyl-ACP dehydratase [Bordetella avium 197N]
 gi|109828898|sp|Q2L150|FABZ_BORA1 RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|115422825|emb|CAJ49353.1| (3R)-hydroxymyristol-[acyl carrier protein] dehydratase [Bordetella
           avium 197N]
          Length = 151

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 86/143 (60%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+V+ +   +S + +KNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKGIMERLPHRYPMLLIDRVLEMVPGKSIVAVKNVSINEPFFNGHFPHHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAIHNGFDQYAPP-----YLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +       +     A       YL+ ID ARFR+PV PGD+L   V   R    +
Sbjct: 64  AMAQASALFSFTDDNGGLKADAGKTAYYLVGIDGARFRRPVVPGDQLRIEVEAERLSRTI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+  +VAEA++ CA+
Sbjct: 124 CKYQGRALVDGQLVAEAKLMCAI 146


>gi|56421864|ref|YP_149182.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacillus kaustophilus
           HTA426]
 gi|62286709|sp|Q5KUM2|FABZ_GEOKA RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|56381706|dbj|BAD77614.1| hydroxymyristoyl-[acyl carrier protein] dehydratase [Geobacillus
           kaustophilus HTA426]
          Length = 145

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ I+  + A+GIKNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIQSIIPHRYPFLLVDRILEIEEGKRAVGIKNVSANESFFAGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  + +  ++    +   ID  RF+K V PGD+L   V  +R R  + K + 
Sbjct: 63  ALAQV-GAVVLLQSEENRGRLAFFAGIDNCRFKKQVKPGDQLRLEVEILRARGAIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +V E E+
Sbjct: 122 IATVDGELVCETEL 135


>gi|237741611|ref|ZP_04572092.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Fusobacterium sp. 4_1_13]
 gi|256844937|ref|ZP_05550395.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 3_1_36A2]
 gi|294785778|ref|ZP_06751066.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 3_1_27]
 gi|229429259|gb|EEO39471.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Fusobacterium sp. 4_1_13]
 gi|256718496|gb|EEU32051.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 3_1_36A2]
 gi|294487492|gb|EFG34854.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 3_1_27]
          Length = 141

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI+E+M+ +PHRYPFLLVD+++ + ++   I G KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DILEIMKRIPHRYPFLLVDRILEMDKENQTIKGKKNVTMNEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAP---PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
           EGMAQ  G +        +  P   PY  +ID  +F+ PV PGD L Y V   + + +  
Sbjct: 63  EGMAQCLGVLVM------EGTPGKVPYFAAIDNTKFKNPVRPGDTLIYDVKVDKVKRNFV 116

Query: 128 KFQCCAKVENTVVAEAEICAMV 149
           K      V++ VVAEA    ++
Sbjct: 117 KASGKVYVDDAVVAEASFTFVI 138


>gi|297617613|ref|YP_003702772.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297145450|gb|ADI02207.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 144

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 83/139 (59%), Gaps = 8/139 (5%)

Query: 8   LDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGV 67
           L A DI      LPHRYPFLLVD+++ ++  + A+GIKNVT NEP F GHFPG PVMPGV
Sbjct: 2   LSAGDI---QTILPHRYPFLLVDRIIELEPGKRAVGIKNVTVNEPFFQGHFPGVPVMPGV 58

Query: 68  LILEGMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVD 125
           L+LE +AQ  G  CA+    +QY     Y   IDK RF++ V PGD+L   V   + +  
Sbjct: 59  LVLEALAQVGG--CALLCQ-EQYRGRLAYFAGIDKVRFKRMVVPGDQLLLEVELTKMKSL 115

Query: 126 LWKFQCCAKVENTVVAEAE 144
           + K Q  A V   +V   E
Sbjct: 116 IGKAQGRATVGGELVVSGE 134


>gi|269925793|ref|YP_003322416.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789453|gb|ACZ41594.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 146

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 5/131 (3%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + +PHRYPF+LVD+++ I+    A+GIKNV+ NEP+F GHFPG P+MPGVL +E +A
Sbjct: 6   EIQKIIPHRYPFILVDRIIEIEYGVRAVGIKNVSANEPYFQGHFPGMPIMPGVLQVEALA 65

Query: 75  QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGD--RLEYHVNKVRNRVDLWKFQCC 132
           Q  GA+  +    ++    Y   ID  RFRKPV PGD   LE  +++VR ++   K    
Sbjct: 66  QV-GAVAILGMEENRGKLAYFAGIDDVRFRKPVKPGDVLTLEVVLDRVRGKIGTGK--GV 122

Query: 133 AKVENTVVAEA 143
           A+V +TV  E 
Sbjct: 123 ARVGDTVTTEG 133


>gi|238026914|ref|YP_002911145.1| (3R)-hydroxymyristoyl-ACP dehydratase [Burkholderia glumae BGR1]
 gi|237876108|gb|ACR28441.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Burkholderia glumae BGR1]
          Length = 169

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 88/145 (60%), Gaps = 12/145 (8%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI +++  LPHRYPFLLVD+V+ +   ES   +KNVT NEP F GHFP RPVMPGVLI+E
Sbjct: 23  DIHKILTLLPHRYPFLLVDRVLELTPHESIKALKNVTINEPFFTGHFPQRPVMPGVLIIE 82

Query: 72  GMAQTAGAICAIHNGFDQYAPP-------YLMSIDKARFRKPVFPGDRLEYHVNKVRNRV 124
            +AQ A  +      F +  P        Y + ID ARF++ V PGD+L  +V   R   
Sbjct: 83  ALAQAAALLT-----FSEEEPKNPGNTLYYFVGIDGARFKRVVEPGDQLILNVKFERYIR 137

Query: 125 DLWKFQCCAKVENTVVAEAEICAMV 149
            +WKF+  A+VE  V AEAE+   V
Sbjct: 138 GIWKFKATAQVEGKVAAEAELMCTV 162


>gi|72255615|gb|AAZ66933.1| 117M18_14 [Brassica rapa]
          Length = 224

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 86/146 (58%), Gaps = 3/146 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHR+PFLLVD+V+     ESA+ IKNVT N+  F GHFP RP+MPGVL++E
Sbjct: 80  DINQIREILPHRFPFLLVDRVIEYTAGESAVAIKNVTINDNFFPGHFPERPIMPGVLMVE 139

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN--KVRNRVDLWKF 129
            MAQ  G +          +  +   +DK RFRKPV  GD L   +   K++ R  + K 
Sbjct: 140 AMAQVGGIVMLNPEVGGSKSNFFFAGVDKVRFRKPVIAGDTLVMRMTLVKLQKRFGIAKM 199

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKE 155
           +  A V NT+V E E   M M +++E
Sbjct: 200 EGKAYVGNTLVCEGEFL-MAMGKEEE 224


>gi|311105994|ref|YP_003978847.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Achromobacter xylosoxidans A8]
 gi|310760683|gb|ADP16132.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Achromobacter xylosoxidans A8]
          Length = 151

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 84/143 (58%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+VV +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKGIMERLPHRYPMLLIDRVVEMVPGKSIVAIKNVSINEPFFNGHFPHHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAI-HNGF----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +        NG           YL+ ID ARFR+PV PGD+L   V   R    +
Sbjct: 64  AMAQASALFSFTDENGGLKCEGSKTAYYLVGIDGARFRRPVVPGDQLRIEVEAERLSRSI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+   VA A++ CA+
Sbjct: 124 CKYQARATVDGQEVASAKLMCAI 146


>gi|295134209|ref|YP_003584885.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Zunongwangia profunda SM-A87]
 gi|294982224|gb|ADF52689.1| bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
           deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase [Zunongwangia profunda SM-A87]
          Length = 466

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 90/152 (59%), Gaps = 4/152 (2%)

Query: 4   DLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV 63
           DL+     D+  +M  LPHR PFLLVDK+  +  D + +G+KNVT NEP F+GHFPG+PV
Sbjct: 317 DLSAKPIMDVNAIMETLPHRSPFLLVDKIYELT-DSTVVGVKNVTMNEPFFVGHFPGKPV 375

Query: 64  MPGVLILEGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRN 122
           MPGVL +E MAQT G I A+ +  D +    Y M ID  RF++ V PGD L + +  +  
Sbjct: 376 MPGVLQVEAMAQT-GGILALKSVPDPENYLTYFMKIDNVRFKQQVVPGDTLIFKLELLAP 434

Query: 123 -RVDLWKFQCCAKVENTVVAEAEICAMVMHEK 153
            R  + + Q  A V   +  EA + A ++  K
Sbjct: 435 IRRGICQMQAYAYVNGKLATEAVLMAQIVKSK 466


>gi|94676689|ref|YP_588967.1| (3R)-hydroxymyristoyl-ACP dehydratase [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
 gi|158564232|sp|Q1LSU7|FABZ_BAUCH RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|94219839|gb|ABF13998.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 149

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (62%), Gaps = 2/129 (1%)

Query: 21  PHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAI 80
           PHR+PFLLVD+V++ ++ +    IKNV++NEP F GHFPG+P+ PGVLILE MAQ  G +
Sbjct: 18  PHRFPFLLVDRVIDFKKWQFLYAIKNVSYNEPFFQGHFPGKPIFPGVLILEAMAQATGIL 77

Query: 81  CAIHNG-FDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTV 139
                G  D     Y  +ID ARF++PV PGD++   V  ++ R  + +F+    V+  V
Sbjct: 78  AFKSAGKLDSSELYYFAAIDNARFKRPVQPGDQMILEVKFIKERRGVARFKGVTTVDGEV 137

Query: 140 VAEA-EICA 147
             EA  +CA
Sbjct: 138 ACEALMMCA 146


>gi|186683208|ref|YP_001866404.1| (3R)-hydroxymyristoyl-ACP dehydratase [Nostoc punctiforme PCC
           73102]
 gi|186465660|gb|ACC81461.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Nostoc
           punctiforme PCC 73102]
          Length = 176

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 12/137 (8%)

Query: 15  ELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74
           E+ + LPHRYPFLLVDK+++    + A+G+KNVT NE +F GHFPGRP+MPGVLI+E MA
Sbjct: 40  EIQKLLPHRYPFLLVDKIIDYVPGKKAVGVKNVTINEHYFQGHFPGRPLMPGVLIVEAMA 99

Query: 75  QTAGAI----CAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNK--VRNRVDLWK 128
           Q  G +     ++  G   +A      IDK RFR+ V PGD+L   V    V+ R    K
Sbjct: 100 QVGGIVLTQMSSVEGGLFVFA-----GIDKVRFRRQVVPGDQLVMTVELLWVKQR-RFGK 153

Query: 129 FQCCAKVENTVVAEAEI 145
            Q  A+V+  +  E E+
Sbjct: 154 MQGRAEVDGQLACEGEL 170


>gi|332527881|ref|ZP_08403918.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rubrivivax benzoatilyticus JA2]
 gi|332112458|gb|EGJ12251.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Rubrivivax benzoatilyticus JA2]
          Length = 150

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 86/142 (60%), Gaps = 7/142 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++++ LPHRYP LLVD+VV  +++     IKNVT NEP FMGHFP RPVMPGV++LE
Sbjct: 7   DIHKILKKLPHRYPILLVDRVVEFEKNVRIKAIKNVTINEPFFMGHFPARPVMPGVMMLE 66

Query: 72  GMAQTAGAIC----AIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLW 127
            +AQ+A  +         G D     Y + ID ARF++ V PGD+L       R +  ++
Sbjct: 67  ALAQSAALLSFESMGTEPGDDTVV--YFVGIDGARFKRVVEPGDQLVLEAWIDRAKGGIY 124

Query: 128 KFQCCAKVENTVVAEAEI-CAM 148
           K++  A V+     EAE+ C M
Sbjct: 125 KYKTRASVDGETAVEAELMCTM 146


>gi|239828560|ref|YP_002951184.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacillus sp. WCH70]
 gi|259646353|sp|C5D965|FABZ_GEOSW RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|239808853|gb|ACS25918.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Geobacillus sp. WCH70]
          Length = 145

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ I+  + A+GIKNV+ NE  F+GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIQAIIPHRYPFLLVDRILEIEEGKRAVGIKNVSANESFFVGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF+K V PGD+L   V  +R +  + K + 
Sbjct: 63  ALAQV-GAVAMLKKEENRGRLAFFTGIDNCRFKKQVKPGDQLRLEVEIIRAKGPIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V+  +V E EI
Sbjct: 122 VATVDGELVCETEI 135


>gi|327402277|ref|YP_004343115.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Fluviicola
           taffensis DSM 16823]
 gi|327317785|gb|AEA42277.1| 3-hydroxyacyl-(acyl-carrier-protein) dehydratase [Fluviicola
           taffensis DSM 16823]
          Length = 468

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 87/146 (59%), Gaps = 4/146 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++ R LPHRYPFLLVDK+++I  DE  IG+KNVT NEP F GHFPG P+ PGVL +E
Sbjct: 324 NINDIERMLPHRYPFLLVDKIMDIT-DEKIIGVKNVTMNEPMFQGHFPGNPIFPGVLQIE 382

Query: 72  GMAQTAGAICAIHNGFDQYA-PPYLMSIDKARFRKPVFPGDRLEYHVNKVRN-RVDLWKF 129
             AQ  G I A+    D +    Y M ID  +F++ V PGD L + +  +   R  L   
Sbjct: 383 ATAQ-CGGIFALSKVEDPHLYSTYFMKIDNVKFKQKVIPGDTLVFELTLISPIRRGLVHM 441

Query: 130 QCCAKVENTVVAEAEICAMVMHEKKE 155
           Q  A V    V EAE+ A V+ +K E
Sbjct: 442 QGNAYVNGKHVMEAEMLAQVIKDKVE 467


>gi|121535889|ref|ZP_01667686.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermosinus carboxydivorans Nor1]
 gi|121305508|gb|EAX46453.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Thermosinus carboxydivorans Nor1]
          Length = 144

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            + E+ + +PHRYPFLLVD+++ ++  + A+GIKNVT NE  F GHFPG+PVMPGVL+LE
Sbjct: 3   SVTEIQQVIPHRYPFLLVDRIIELEPMKRAVGIKNVTVNEAFFNGHFPGQPVMPGVLLLE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            MAQ  G +  ++    +    +   +D+ +FR+PV PGD++      V+ R  + K   
Sbjct: 63  AMAQV-GGVAMLYPQEYRGKLAFFAGMDRVKFRRPVVPGDQVRMVAEIVKVRGTMGKVWA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKK 154
            A V++ +VAE E    +   +K
Sbjct: 122 EAFVDDQLVAEGEFLFALSSAQK 144


>gi|298370296|ref|ZP_06981612.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298281756|gb|EFI23245.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 154

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 83/146 (56%), Gaps = 4/146 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           ++ E+   LPHR+PFLL+D+V   +  +S   IKNVTFNE  F GHFP  PVMPGVLI+E
Sbjct: 8   EVREIQEILPHRFPFLLIDRVTAAEPGKSLTAIKNVTFNEQFFQGHFPESPVMPGVLIVE 67

Query: 72  GMAQTAGAICAIHNGFDQYAP---PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
            MAQ  G +  +  G  +           +D  RF++ V PGD+L + V  + +R  + K
Sbjct: 68  AMAQACGVLAVLSQGSAKRREGEITLFAGLDNVRFKRQVVPGDQLVFDVELLAHRRGIGK 127

Query: 129 FQCCAKVENTVVAEAEI-CAMVMHEK 153
           F   AKV   +  EA I CA  + EK
Sbjct: 128 FNATAKVNGELACEATIMCAQRIVEK 153


>gi|138896902|ref|YP_001127355.1| (3R)-hydroxymyristoyl-ACP dehydratase [Geobacillus
           thermodenitrificans NG80-2]
 gi|158513840|sp|A4ITF6|FABZ_GEOTN RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|134268415|gb|ABO68610.1| (3R)-hydroxymyristoyl-(acyl-carrier-protein)dehydratase
           [Geobacillus thermodenitrificans NG80-2]
          Length = 145

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 83/134 (61%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   +PHRYPFLLVD+++ I+  + A+GIKNV+ NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIQQIQAIIPHRYPFLLVDRILEIEEGKRAVGIKNVSANESFFAGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  + +  ++    +   ID  RF+K V PGD+L   V  +R R  + K + 
Sbjct: 63  ALAQV-GAVVLLQSEENRGRLAFFAGIDNCRFKKQVQPGDQLRLEVEILRARGSIGKGKG 121

Query: 132 CAKVENTVVAEAEI 145
            A V   +V E E+
Sbjct: 122 VATVNGELVCETEL 135


>gi|317406257|gb|EFV86501.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
           [Achromobacter xylosoxidans C54]
          Length = 151

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 84/143 (58%), Gaps = 6/143 (4%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI  +M  LPHRYP LL+D+VV +   +S + IKNV+ NEP F GHFP  PVMPGVLI+E
Sbjct: 4   DIKGIMERLPHRYPMLLIDRVVEMVPGKSIVAIKNVSINEPFFNGHFPHHPVMPGVLIVE 63

Query: 72  GMAQTAGAICAI-HNGF----DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
            MAQ +        NG           YL+ ID ARFR+PV PGD+L   V   R    +
Sbjct: 64  AMAQASALFSFTDENGGLKCEGAKTAYYLVGIDGARFRRPVVPGDQLRIEVEAERLSRSI 123

Query: 127 WKFQCCAKVENTVVAEAEI-CAM 148
            K+Q  A V+   VA A++ CA+
Sbjct: 124 CKYQARATVDGQEVASAKLMCAI 146


>gi|187777418|ref|ZP_02993891.1| hypothetical protein CLOSPO_00985 [Clostridium sporogenes ATCC
           15579]
 gi|187774346|gb|EDU38148.1| hypothetical protein CLOSPO_00985 [Clostridium sporogenes ATCC
           15579]
          Length = 144

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E+ + +PHRYPFLL+DK+  ++  +SA+G KNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 6   DINEIKKIIPHRYPFLLIDKITELEDGKSAVGYKNVTANEYFFNGHFPEEPVMPGVLIIE 65

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +     +    Y   I+KA+FRK V PGD L+  ++  + +      + 
Sbjct: 66  ALAQV-GAVAILSKEEFKGKIAYFGGINKAKFRKKVVPGDVLKLSIDLTKIKGVAGVGKA 124

Query: 132 CAKVENTVVAEAEICAMV 149
            A V+  V AEAE+  ++
Sbjct: 125 VATVDGKVAAEAELLFVI 142


>gi|30249670|ref|NP_841740.1| thioester dehydrase [Nitrosomonas europaea ATCC 19718]
 gi|33516885|sp|Q82U05|FABZ_NITEU RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein]
           dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase
 gi|30180707|emb|CAD85619.1| Bacterial thioester dehydrase [Nitrosomonas europaea ATCC 19718]
          Length = 153

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (61%), Gaps = 2/136 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI E++++LPHRYP +LVD+VV+++  +     KNV+ NEP+F GHFP  PVMPGVLI+E
Sbjct: 11  DIHEILKYLPHRYPLILVDRVVSLESGKRIHAYKNVSINEPYFSGHFPHHPVMPGVLIIE 70

Query: 72  GMAQTAGAICAIHNGF--DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
            +AQ A  +         D     Y + ID  RF+KPV  GD+L   V   R    +WK+
Sbjct: 71  ALAQAAALLTIRSENMEKDNGQVYYFVGIDAVRFKKPVIAGDQLVLKVEITRQLKGIWKY 130

Query: 130 QCCAKVENTVVAEAEI 145
             CA+V+  VV EA++
Sbjct: 131 AACAEVDGQVVTEAQL 146


>gi|319786398|ref|YP_004145873.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464910|gb|ADV26642.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 152

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 87/139 (62%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGI-KNVTFNEPHFMGHFPGRPVMPGVLIL 70
           D+  +   +PHRYPFLLVD+V  +  +   I   KNV+ NEP FMGHFPG+P+MPGVLI+
Sbjct: 10  DVTTIRTLIPHRYPFLLVDRVDELDIEGKRIVCRKNVSINEPFFMGHFPGQPIMPGVLII 69

Query: 71  EGMAQTAGAICAIHNGFD-QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           E +AQ  G +  +  G D Q    Y++ ++ ARF K V PGD LE HV+  R   ++  +
Sbjct: 70  EALAQAGGVLTQLTMGRDAQSKLFYMVKVENARFSKQVVPGDVLELHVSVKRVIRNMAVY 129

Query: 130 QCCAKVENTVVAEAEI-CA 147
              AKV+  VVA AE+ CA
Sbjct: 130 YGEAKVDGEVVACAEVLCA 148


>gi|290892687|ref|ZP_06555679.1| 3Rhydroxymyristoyl-acyl-carrier-protein [Listeria monocytogenes FSL
           J2-071]
 gi|290557747|gb|EFD91269.1| 3Rhydroxymyristoyl-acyl-carrier-protein [Listeria monocytogenes FSL
           J2-071]
          Length = 144

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           DI ++   LPHRYPFLLVD+V++++  +    IKNVT NE  F GHFP  PVMPGVLI+E
Sbjct: 3   DIKKIKEILPHRYPFLLVDRVISVEEGKKVTAIKNVTANEEFFNGHFPEYPVMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQT+G I  + N  ++        ID  RF++ V PGD+L       R R  + K + 
Sbjct: 63  ALAQTSG-IAMMQNEANKGKIGLFAGIDGCRFKRQVVPGDQLLLEAEITRMRGAIAKAKV 121

Query: 132 CAKVENTVVAEAEI 145
            A VE  +V EAEI
Sbjct: 122 KATVEGDLVCEAEI 135


>gi|93006530|ref|YP_580967.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Psychrobacter cryohalolentis K5]
 gi|92394208|gb|ABE75483.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Psychrobacter
           cryohalolentis K5]
          Length = 169

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (59%), Gaps = 6/134 (4%)

Query: 16  LMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQ 75
           L  +LPHRYPFLLVDK+V     E   GIKNVT NE  F GHFP  P+MPGVL++E MAQ
Sbjct: 31  LKHYLPHRYPFLLVDKIVACTPGECITGIKNVTINEEFFNGHFPDEPIMPGVLMVECMAQ 90

Query: 76  TAGAICAIHNGF---DQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +G +  I  G    D Y   YL + +DK RF++ V PGD+L      V  +  ++KF C
Sbjct: 91  VSGVLGFISAGLTAEDGYL--YLFAGVDKVRFKRRVIPGDQLIIRSKIVMQKQGMYKFDC 148

Query: 132 CAKVENTVVAEAEI 145
              VE+ +   A+I
Sbjct: 149 TVHVEDELAVSAQI 162


>gi|71066082|ref|YP_264809.1| (3R)-hydroxymyristoyl-ACP dehydratase [Psychrobacter arcticus
           273-4]
 gi|71039067|gb|AAZ19375.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Psychrobacter
           arcticus 273-4]
          Length = 169

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (59%), Gaps = 6/134 (4%)

Query: 16  LMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQ 75
           L  +LPHRYPFLLVDK+V     E   GIKNVT NE  F GHFP  P+MPGVL++E MAQ
Sbjct: 31  LKHYLPHRYPFLLVDKIVACTPGECITGIKNVTINEEFFNGHFPDEPIMPGVLMVECMAQ 90

Query: 76  TAGAICAIHNGF---DQYAPPYLMS-IDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +G +  I  G    D Y   YL + +DK RF++ V PGD+L      V  +  ++KF C
Sbjct: 91  VSGVLGFISAGLTAEDGYL--YLFAGVDKVRFKRRVIPGDQLIIRSKIVMQKQGIYKFDC 148

Query: 132 CAKVENTVVAEAEI 145
              VE+ +   A+I
Sbjct: 149 TVHVEDELAVSAQI 162


>gi|229020488|ref|ZP_04177237.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH1273]
 gi|229027457|ref|ZP_04183700.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH1272]
 gi|228733839|gb|EEL84590.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH1272]
 gi|228740798|gb|EEL91047.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [Bacillus
           cereus AH1273]
          Length = 144

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           +I ++   +PHRYPFLLVDK++ ++  + AIGIKNVT NE  F GHFP   +MPGVLI+E
Sbjct: 3   NIEQIKEIIPHRYPFLLVDKILEVEEGKKAIGIKNVTANEEFFNGHFPDYAIMPGVLIVE 62

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+  +    ++    +   ID  RF+K V PGD+L   V   R R  + K + 
Sbjct: 63  ALAQV-GAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGRA 121

Query: 132 CAKVENTVVAEAEICAMVMHEKKE 155
            A V+  V  EAEI    + +KKE
Sbjct: 122 IATVDGEVACEAEIT-FAIGDKKE 144


>gi|94967267|ref|YP_589315.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Candidatus
           Koribacter versatilis Ellin345]
 gi|94549317|gb|ABF39241.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Candidatus
           Koribacter versatilis Ellin345]
          Length = 166

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 1/147 (0%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
           D+ ++ + LPHRYP LL+D+++  +R E  + IKNVT NE  F GHFPG P+MPGVLI+E
Sbjct: 19  DVTDIQKILPHRYPLLLLDRIIEFKRKERIVAIKNVTINEQFFQGHFPGYPIMPGVLIVE 78

Query: 72  GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131
            +AQ  GA+                 I+KA+FRKPV PGD++   V+ +  R    K   
Sbjct: 79  AIAQAGGALLLTEIPDQNEKLMVFAGIEKAKFRKPVVPGDQVRLEVDVIVWRNTAAKLMG 138

Query: 132 CAKVENTVVAEAEI-CAMVMHEKKEKN 157
            A V + +  EA + C +V    K +N
Sbjct: 139 KAFVGDKLACEATVSCQIVPRPAKPEN 165


>gi|285018801|ref|YP_003376512.1| (3r)-hydroxymyristol acyl carrier protein dehydratase
           beta-hydroxyacyl-(acyl carrier protein) dehydratase
           [Xanthomonas albilineans GPE PC73]
 gi|283474019|emb|CBA16520.1| probable (3r)-hydroxymyristol acyl carrier protein dehydratase.
           beta-hydroxyacyl-(acyl carrier protein) dehydratase
           [Xanthomonas albilineans]
          Length = 150

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQ-RDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI ++M  +PHRYPFL++DKV+++   +   +  KNVT NEP F GHFP  P+MPGVLI+
Sbjct: 9   DINKIMALMPHRYPFLMLDKVISLDFENRKIVAHKNVTINEPFFQGHFPNLPIMPGVLII 68

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLM-SIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129
           E +AQ  G +  +  G D  + P+ M  ++  RF  PV PGD LE HV   R   ++  +
Sbjct: 69  EAIAQVGGLLIQLMAGPDADSTPFFMVKVNNVRFNTPVVPGDVLELHVEIKRIIRNMALY 128

Query: 130 QCCAKVENTVVAEAEI-CA 147
              AKV   VVA AE+ CA
Sbjct: 129 CGEAKVNGKVVAYAEVMCA 147


>gi|262067093|ref|ZP_06026705.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium periodonticum ATCC 33693]
 gi|294782873|ref|ZP_06748199.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 1_1_41FAA]
 gi|291379192|gb|EFE86710.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium periodonticum ATCC 33693]
 gi|294481514|gb|EFG29289.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Fusobacterium sp. 1_1_41FAA]
          Length = 141

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           D++E+M+ +PHRYPFLLVD+++ + ++   I G KNVT NE  F GHFPG P+MPGVLI+
Sbjct: 3   DVLEIMKRIPHRYPFLLVDRILEMDKENQTIKGKKNVTINEEFFNGHFPGHPIMPGVLIV 62

Query: 71  EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQ 130
           EGMAQ  G +  +   F     PY  +I+ A+F+ PV PGD L Y V   + + +  K  
Sbjct: 63  EGMAQCLGVM--VMENFPGKV-PYFAAIESAKFKNPVKPGDTLIYDVKVEKVKRNFVKAT 119

Query: 131 CCAKVENTVVAEAEICAMV 149
               V++ VVAEA    ++
Sbjct: 120 GKTYVDDAVVAEANFTFVI 138


>gi|21242163|ref|NP_641745.1| (3R)-hydroxymyristoyl-ACP dehydratase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78047023|ref|YP_363198.1| (3R)-hydroxymyristoyl-ACP dehydratase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294625963|ref|ZP_06704575.1| 3R -hydroxymyristoyl ACP dehydratase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666392|ref|ZP_06731638.1| 3R -hydroxymyristoyl ACP dehydratase [Xanthomonas fuscans subsp.
           aurantifolii str. I