RPSBLAST alignment of GI: 254780770 and protein with PDBid: 1pn2

>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280
 Score = 40.8 bits (95), Expect = 2e-04
 Identities = 26/115 (22%), Positives = 42/115 (36%), Gaps = 17/115 (14%)

Query: 43  GIKNVTFNEPHFMGHFP-GRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKA 101
           G +N    +P+F       +P++ G+        +A A+      F++          KA
Sbjct: 181 GDRNPLHIDPNFAKGAKFPKPILHGMCT---YGLSAKALIDKFGMFNEI---------KA 228

Query: 102 RFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEK 156
           RF   VFPG+ L     K  +  D   FQ       T+       A+ +   K K
Sbjct: 229 RFTGIVFPGETLRVLAWKESD--DTIVFQTHVVDRGTIAINNA--AIKLVGDKAK 279