RPSBLAST alignment of GI: 254780770 and protein with PDBid: 3kh8

>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332
 Score = 53.2 bits (127), Expect = 2e-08
 Identities = 21/107 (19%), Positives = 35/107 (32%), Gaps = 6/107 (5%)

Query: 49  FNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVF 108
           +N  H       + V     IL G+     A  A+   F         S  + RF  P F
Sbjct: 229 YNSLHIDPEI-AKSVGFKQPILHGLCSMGVASRALFKQFCGGDVARFKS-IRVRFSSPCF 286

Query: 109 PGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKE 155
           PG+ ++  + +  +      FQ   K    V+ +      V  +   
Sbjct: 287 PGETIQTRMWQEGSGK--VLFQAVVKERGAVIVDGG--EFVYTQDAS 329