HHsearch alignment for GI: 254780773 and conserved domain: KOG3129

>KOG3129 consensus.
Probab=98.22  E-value=2.5e-06  Score=63.32  Aligned_cols=78  Identities=28%  Similarity=0.388  Sum_probs=63.8

Q ss_pred             CCCCCCCCCCHHHHHHCCCCCEEEEECCCCCCCCHHH---HHHCCCCCCCCCEEEEEECCCCEEEECCCCCCCCCCCCCE
Q ss_conf             2000245675565300145662888878304540011---1110146788631699965873131011211005654310
Q gi|254780773|r  120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV---APYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG  196 (349)
Q Consensus       120 p~I~~V~~~spA~~AGL~~GD~Il~InG~~V~s~~dl---~~~i~~~~g~~v~i~v~R~~~~~~~~~v~p~~~~~~~~~g  196 (349)
T Consensus       141 a~V~sV~~~SPA~~aGl~~gD~il~fGnV~sgn~~~lq~i~~~v~~~e~~~v~v~v~R~g~-~v~L~ltP~~W~GrGLLG  219 (231)
T KOG3129         141 AVVDSVVPGSPADEAGLCVGDEILKFGNVHSGNFLPLQNIAAVVQSNEDQIVSVTVIREGQ-KVVLSLTPKKWQGRGLLG  219 (231)
T ss_pred             EEEEECCCCCHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCC-EEEEEECCCCCCCCCCEE
T ss_conf             8875227898345407543765788533246552258898999874437623579961797-788996764355886010


Q ss_pred             EE
Q ss_conf             00
Q gi|254780773|r  197 IK  198 (349)
Q Consensus       197 ~~  198 (349)
T Consensus       220 C~  221 (231)
T KOG3129         220 CN  221 (231)
T ss_pred             EE
T ss_conf             01