>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

Probab=99.23 E-value=1e-11 Score=100.51 Aligned_cols=61 Identities=23% Similarity=0.370 Sum_probs=56.3 Q ss_pred CCCCCCCCCCHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCC-CCCCCCEEEEEECCCCEE Q ss_conf 2000245675565300145662888878304540011111014-678863169996587313 Q gi|254780773|r 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE-NPLHEISLVLYREHVGVL 180 (349) Q Consensus 120 p~I~~V~~~spA~~AGL~~GD~Il~InG~~V~s~~dl~~~i~~-~~g~~v~i~v~R~~~~~~ 180 (349) T Consensus 12 v~V~~V~~gsPA~~AGL~~GDVI~~Ing~~I~~~~d~~~~l~~~~pG~~v~v~v~R~g~~lT 73 (79) T cd00991 12 VVIVGVIVGSPAENAVLHTGDVIYSINGTPITTLEDFMEALKPTKPGEVITVTVLPSTTKLT 73 (79) T ss_pred EEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHCCCCCCEEEEEEEECCEEEE T ss_conf 79999678996998699988899998999987999999999618999989999998999977

HHsearch alignment for GI: 254780773 and conserved domain: cd00991