RPSBLAST alignment for GI: 254780773 and conserved domain: cd00136

>gnl|CDD|29042 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.. Length = 70
 Score = 42.9 bits (101), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF--EEVAPYVRENPLHEISLVLY 173
            VV +V P SPA  AG++ GD I++++G  V     E+VA  +++    +++L + 
Sbjct: 15  VVVLSVEPGSPAERAGLQAGDVILAVNGTDVKNLTLEDVAELLKKEVGEKVTLTVR 70