RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780774|ref|YP_003065187.1| phosphatidate cytidylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (269 letters) >3ixz_B Potassium-transporting ATPase subunit beta; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} (B:) Length = 290 Score = 29.5 bits (66), Expect = 0.44 Identities = 10/48 (20%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 45 WKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFID 92 W TG + + + + +++ F+++++G F A + +L ID Sbjct: 22 WNPDTGQMLGRTLSRWVWISLYYVAFYVVMSGIF--ALCIYVLMRTID 67 >2jer_A Agmatine deiminase; hydrolase, tetramer, AGDI, 5- fold pseudosymmetric structure, agmatine degradation pathway, covalent amidino adduct; HET: AGT; 1.65A {Enterococcus faecalis} (A:157-289) Length = 133 Score = 27.8 bits (62), Expect = 1.4 Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Query: 215 FESYIKRYFGIKQSGWLLPGHGGVMDRVDG 244 E + Y +++ WL G G + +G Sbjct: 34 IEQKLCDYLNVEKVLWL--GDGIDPEETNG 61 >1xkn_A Putative peptidyl-arginine deiminase; alpha-beta protein, NESG, structural genomics, protein structure initiative, PSI; 1.60A {Chlorobium tepidum tls} (A:157-273) Length = 117 Score = 28.1 bits (63), Expect = 1.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 215 FESYIKRYFGIKQSGWLLPGHGGVMDRVDG 244 E+ ++RY GI++ WL G G D DG Sbjct: 33 IEAQLRRYLGIEKVLWL--GDGIAGDDTDG 60 >2ewo_A Putative agmatine deiminase; Q8DW17, SMR6, X-RAY, structural genomics, PSI, protein structure initiative; 2.90A {Streptococcus mutans} (A:161-293) Length = 133 Score = 27.8 bits (62), Expect = 1.8 Identities = 6/30 (20%), Positives = 10/30 (33%), Gaps = 2/30 (6%) Query: 215 FESYIKRYFGIKQSGWLLPGHGGVMDRVDG 244 E +K Y + W+ G +G Sbjct: 34 IEDKLKDYLNCVKVLWV--KDGIDPYETNG 61 >3hvm_A Agmatine deiminase; hydrolase; 2.10A {Helicobacter pylori J99} PDB: 2cmu_A (A:140-198) Length = 59 Score = 26.8 bits (60), Expect = 3.0 Identities = 7/25 (28%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Query: 216 ESYIKRYFGIKQSGWLLPGHGGVMD 240 E+ +K+ G KQ W +G + Sbjct: 35 ETMLKKELGAKQVLWY--SYGYLKG 57 >2p97_A Hypothetical protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} (A:102-201) Length = 100 Score = 26.7 bits (59), Expect = 3.5 Identities = 6/32 (18%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 211 LGDLFESYIKRYFGIKQSGWLLPGHGGVMDRV 242 + S ++R +++ +L G G + R Sbjct: 57 KQKVVAS-VRRLAALEKVEAVLVGDGWSVFRD 87 >1zbr_A AAQ65385, conserved hypothetical protein; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.60A {Porphyromonas gingivalis W83} (A:146-204) Length = 59 Score = 26.1 bits (58), Expect = 5.5 Identities = 8/47 (17%), Positives = 14/47 (29%), Gaps = 11/47 (23%) Query: 203 ILLSVSCQLGDL---------FESYIKRYFGIKQSGWLLPGHGGVMD 240 +L + SC +K G+ + L HG + Sbjct: 13 LLTTDSCLFEPNRNAGLSRTAIIDTLKESLGVSRVLSL--RHGALAG 57 >3l8r_A PTCA, putative PTS system, cellobiose-specific IIA component; helix; 2.50A {Streptococcus mutans} (A:) Length = 120 Score = 25.8 bits (57), Expect = 5.7 Identities = 6/19 (31%), Positives = 12/19 (63%) Query: 251 LMSAISFFGIATEMIGVLK 269 LM+ ++ +A EM+ + K Sbjct: 100 LMTTMTLREVAIEMLELYK 118 >1wcr_A PTS system, N, N'-diacetylchitobiose-specific IIA component; mutagenesis, transferase, sugar transport, phosphotransferase; NMR {Escherichia coli} (A:) Length = 103 Score = 25.7 bits (57), Expect = 6.5 Identities = 5/19 (26%), Positives = 12/19 (63%) Query: 251 LMSAISFFGIATEMIGVLK 269 LM+++ + TE+I + + Sbjct: 81 LMTSMLARELITELIELHE 99 >1at3_A Herpes simplex virus type II protease; serine protease, viral protease, HSV2 protease; HET: DFP; 2.50A {Human herpesvirus 2} (A:) Length = 247 Score = 25.5 bits (56), Expect = 8.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 105 RALGVVYSGLPSIALSSLRGDD 126 R L ++ + LPS++LS+ R D Sbjct: 116 RLLYLITNYLPSVSLSTKRRGD 137 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.334 0.147 0.484 Gapped Lambda K H 0.267 0.0677 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,156,176 Number of extensions: 94389 Number of successful extensions: 407 Number of sequences better than 10.0: 1 Number of HSP's gapped: 405 Number of HSP's successfully gapped: 51 Length of query: 269 Length of database: 4,956,049 Length adjustment: 87 Effective length of query: 182 Effective length of database: 2,015,014 Effective search space: 366732548 Effective search space used: 366732548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 54 (24.7 bits)